>>6L49:HELIX   42 AE6 GLN K   85  ALA K  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 42 AE6 GLN K 85 ALA K 114 1 30 ATOM 25887 N GLN K 85 179.802 164.186 122.120 1.00999.99 N ATOM 25888 CA GLN K 85 179.639 162.746 121.986 1.00999.99 C ATOM 25889 C GLN K 85 179.783 162.085 123.351 1.00999.99 C ATOM 25890 O GLN K 85 180.430 162.624 124.253 1.00999.99 O ATOM 25891 CB GLN K 85 180.669 162.186 121.005 1.00999.99 C ATOM 25892 CG GLN K 85 180.603 162.816 119.623 1.00999.99 C ATOM 25893 CD GLN K 85 181.692 162.311 118.697 1.00999.99 C ATOM 25894 OE1 GLN K 85 182.628 161.640 119.129 1.00999.99 O ATOM 25895 NE2 GLN K 85 181.574 162.634 117.414 1.00999.99 N ATOM 25896 N SER K 86 179.160 160.912 123.503 1.00999.99 N ATOM 25897 CA SER K 86 179.152 160.235 124.797 1.00999.99 C ATOM 25898 C SER K 86 180.528 159.694 125.168 1.00999.99 C ATOM 25899 O SER K 86 180.841 159.572 126.359 1.00999.99 O ATOM 25900 CB SER K 86 178.121 159.106 124.792 1.00999.99 C ATOM 25901 OG SER K 86 176.801 159.620 124.824 1.00999.99 O ATOM 25902 N SER K 87 181.359 159.378 124.169 1.00999.99 N ATOM 25903 CA SER K 87 182.713 158.907 124.439 1.00999.99 C ATOM 25904 C SER K 87 183.581 160.001 125.048 1.00999.99 C ATOM 25905 O SER K 87 184.425 159.712 125.903 1.00999.99 O ATOM 25906 CB SER K 87 183.351 158.377 123.155 1.00999.99 C ATOM 25907 OG SER K 87 183.166 159.284 122.082 1.00999.99 O ATOM 25908 N ALA K 88 183.368 161.257 124.641 1.00999.99 N ATOM 25909 CA ALA K 88 184.110 162.374 125.219 1.00999.99 C ATOM 25910 C ALA K 88 183.745 162.586 126.684 1.00999.99 C ATOM 25911 O ALA K 88 184.628 162.803 127.523 1.00999.99 O ATOM 25912 CB ALA K 88 183.850 163.647 124.415 1.00999.99 C ATOM 25913 N VAL K 89 182.452 162.500 127.009 1.00999.99 N ATOM 25914 CA VAL K 89 182.010 162.661 128.391 1.00999.99 C ATOM 25915 C VAL K 89 182.473 161.485 129.244 1.00999.99 C ATOM 25916 O VAL K 89 182.843 161.659 130.412 1.00999.99 O ATOM 25917 CB VAL K 89 180.481 162.836 128.444 1.00999.99 C ATOM 25918 CG1 VAL K 89 180.043 163.325 129.817 1.00999.99 C ATOM 25919 CG2 VAL K 89 180.020 163.801 127.364 1.00999.99 C ATOM 25920 N MET K 90 182.501 160.279 128.666 1.00999.99 N ATOM 25921 CA MET K 90 182.970 159.114 129.414 1.00999.99 C ATOM 25922 C MET K 90 184.475 159.175 129.660 1.00999.99 C ATOM 25923 O MET K 90 184.945 158.802 130.742 1.00999.99 O ATOM 25924 CB MET K 90 182.596 157.829 128.676 1.00999.99 C ATOM 25925 CG MET K 90 181.147 157.410 128.865 1.00999.99 C ATOM 25926 SD MET K 90 180.650 157.385 130.598 1.00999.99 S ATOM 25927 CE MET K 90 178.908 156.998 130.445 1.00999.99 C ATOM 25928 N ALA K 91 185.243 159.665 128.681 1.00999.99 N ATOM 25929 CA ALA K 91 186.682 159.825 128.875 1.00999.99 C ATOM 25930 C ALA K 91 186.986 160.931 129.878 1.00999.99 C ATOM 25931 O ALA K 91 187.921 160.805 130.681 1.00999.99 O ATOM 25932 CB ALA K 91 187.364 160.108 127.537 1.00999.99 C ATOM 25933 N LEU K 92 186.196 162.012 129.856 1.00999.99 N ATOM 25934 CA LEU K 92 186.342 163.072 130.850 1.00999.99 C ATOM 25935 C LEU K 92 186.014 162.569 132.249 1.00999.99 C ATOM 25936 O LEU K 92 186.710 162.905 133.214 1.00999.99 O ATOM 25937 CB LEU K 92 185.445 164.256 130.489 1.00999.99 C ATOM 25938 CG LEU K 92 186.044 165.303 129.554 1.00999.99 C ATOM 25939 CD1 LEU K 92 184.973 166.255 129.051 1.00999.99 C ATOM 25940 CD2 LEU K 92 187.145 166.058 130.269 1.00999.99 C ATOM 25941 N GLN K 93 184.974 161.737 132.369 1.00999.99 N ATOM 25942 CA GLN K 93 184.605 161.167 133.660 1.00999.99 C ATOM 25943 C GLN K 93 185.670 160.203 134.169 1.00999.99 C ATOM 25944 O GLN K 93 185.990 160.206 135.363 1.00999.99 O ATOM 25945 CB GLN K 93 183.251 160.467 133.548 1.00999.99 C ATOM 25946 CG GLN K 93 182.711 159.922 134.858 1.00999.99 C ATOM 25947 CD GLN K 93 181.330 159.318 134.707 1.00999.99 C ATOM 25948 OE1 GLN K 93 180.741 159.348 133.626 1.00999.99 O ATOM 25949 NE2 GLN K 93 180.807 158.758 135.790 1.00999.99 N ATOM 25950 N GLU K 94 186.253 159.400 133.273 1.00999.99 N ATOM 25951 CA GLU K 94 187.297 158.458 133.672 1.00999.99 C ATOM 25952 C GLU K 94 188.566 159.185 134.106 1.00999.99 C ATOM 25953 O GLU K 94 189.185 158.826 135.117 1.00999.99 O ATOM 25954 CB GLU K 94 187.594 157.494 132.523 1.00999.99 C ATOM 25955 CG GLU K 94 186.733 156.243 132.525 1.00999.99 C ATOM 25956 CD GLU K 94 187.257 155.181 133.469 1.00999.99 C ATOM 25957 OE1 GLU K 94 186.478 154.281 133.847 1.00999.99 O ATOM 25958 OE2 GLU K 94 188.451 155.244 133.832 1.00999.99 O ATOM 25959 N ALA K 95 188.957 160.226 133.360 1.00999.99 N ATOM 25960 CA ALA K 95 190.143 160.999 133.721 1.00999.99 C ATOM 25961 C ALA K 95 189.933 161.774 135.016 1.00999.99 C ATOM 25962 O ALA K 95 190.844 161.851 135.850 1.00999.99 O ATOM 25963 CB ALA K 95 190.513 161.950 132.585 1.00999.99 C ATOM 25964 N CYS K 96 188.731 162.330 135.210 1.00999.99 N ATOM 25965 CA CYS K 96 188.425 163.043 136.445 1.00999.99 C ATOM 25966 C CYS K 96 188.397 162.098 137.638 1.00999.99 C ATOM 25967 O CYS K 96 188.888 162.443 138.718 1.00999.99 O ATOM 25968 CB CYS K 96 187.087 163.774 136.323 1.00 30.00 C ATOM 25969 SG CYS K 96 187.069 165.097 135.092 1.00 30.00 S ATOM 25970 N GLU K 97 187.864 160.884 137.448 1.00999.99 N ATOM 25971 CA GLU K 97 187.850 159.889 138.517 1.00999.99 C ATOM 25972 C GLU K 97 189.259 159.444 138.886 1.00999.99 C ATOM 25973 O GLU K 97 189.583 159.337 140.074 1.00999.99 O ATOM 25974 CB GLU K 97 187.005 158.683 138.105 1.00999.99 C ATOM 25975 CG GLU K 97 185.517 158.850 138.357 1.00999.99 C ATOM 25976 CD GLU K 97 184.772 157.531 138.385 1.00999.99 C ATOM 25977 OE1 GLU K 97 185.432 156.470 138.390 1.00999.99 O ATOM 25978 OE2 GLU K 97 183.524 157.554 138.400 1.00999.99 O ATOM 25979 N ALA K 98 190.116 159.208 137.885 1.00999.99 N ATOM 25980 CA ALA K 98 191.486 158.780 138.160 1.00999.99 C ATOM 25981 C ALA K 98 192.287 159.884 138.845 1.00999.99 C ATOM 25982 O ALA K 98 193.024 159.623 139.807 1.00999.99 O ATOM 25983 CB ALA K 98 192.168 158.343 136.866 1.00999.99 C ATOM 25984 N TYR K 99 192.119 161.131 138.389 1.00999.99 N ATOM 25985 CA TYR K 99 192.825 162.249 139.007 1.00999.99 C ATOM 25986 C TYR K 99 192.329 162.506 140.426 1.00999.99 C ATOM 25987 O TYR K 99 193.124 162.827 141.318 1.00999.99 O ATOM 25988 CB TYR K 99 192.672 163.501 138.141 1.00999.99 C ATOM 25989 CG TYR K 99 193.175 164.770 138.790 1.00999.99 C ATOM 25990 CD1 TYR K 99 194.506 164.899 139.169 1.00999.99 C ATOM 25991 CD2 TYR K 99 192.321 165.846 139.009 1.00999.99 C ATOM 25992 CE1 TYR K 99 194.972 166.060 139.760 1.00999.99 C ATOM 25993 CE2 TYR K 99 192.778 167.012 139.597 1.00999.99 C ATOM 25994 CZ TYR K 99 194.104 167.113 139.971 1.00999.99 C ATOM 25995 OH TYR K 99 194.564 168.269 140.557 1.00999.99 O ATOM 25996 N LEU K 100 191.029 162.308 140.673 1.00999.99 N ATOM 25997 CA LEU K 100 190.502 162.553 142.011 1.00999.99 C ATOM 25998 C LEU K 100 190.893 161.443 142.983 1.00999.99 C ATOM 25999 O LEU K 100 191.166 161.721 144.155 1.00999.99 O ATOM 26000 CB LEU K 100 188.984 162.728 141.959 1.00999.99 C ATOM 26001 CG LEU K 100 188.473 164.114 141.538 1.00999.99 C ATOM 26002 CD1 LEU K 100 186.983 164.258 141.817 1.00999.99 C ATOM 26003 CD2 LEU K 100 189.262 165.245 142.193 1.00999.99 C ATOM 26004 N VAL K 101 190.961 160.187 142.524 1.00999.99 N ATOM 26005 CA VAL K 101 191.413 159.140 143.444 1.00999.99 C ATOM 26006 C VAL K 101 192.923 159.208 143.655 1.00999.99 C ATOM 26007 O VAL K 101 193.414 158.828 144.724 1.00999.99 O ATOM 26008 CB VAL K 101 190.961 157.730 143.000 1.00999.99 C ATOM 26009 CG1 VAL K 101 189.453 157.675 142.847 1.00999.99 C ATOM 26010 CG2 VAL K 101 191.654 157.281 141.717 1.00999.99 C ATOM 26011 N GLY K 102 193.680 159.745 142.689 1.00999.99 N ATOM 26012 CA GLY K 102 195.103 159.977 142.930 1.00999.99 C ATOM 26013 C GLY K 102 195.313 161.117 143.923 1.00999.99 C ATOM 26014 O GLY K 102 196.184 161.035 144.806 1.00999.99 O ATOM 26015 N LEU K 103 194.503 162.176 143.804 1.00999.99 N ATOM 26016 CA LEU K 103 194.534 163.270 144.769 1.00999.99 C ATOM 26017 C LEU K 103 194.115 162.798 146.157 1.00999.99 C ATOM 26018 O LEU K 103 194.690 163.226 147.161 1.00999.99 O ATOM 26019 CB LEU K 103 193.629 164.406 144.295 1.00999.99 C ATOM 26020 CG LEU K 103 193.570 165.652 145.182 1.00999.99 C ATOM 26021 CD1 LEU K 103 194.664 166.641 144.804 1.00999.99 C ATOM 26022 CD2 LEU K 103 192.195 166.297 145.122 1.00999.99 C ATOM 26023 N PHE K 104 193.136 161.892 146.230 1.00999.99 N ATOM 26024 CA PHE K 104 192.712 161.353 147.519 1.00999.99 C ATOM 26025 C PHE K 104 193.757 160.418 148.115 1.00999.99 C ATOM 26026 O PHE K 104 193.904 160.366 149.342 1.00999.99 O ATOM 26027 CB PHE K 104 191.374 160.630 147.371 1.00999.99 C ATOM 26028 CG PHE K 104 190.183 161.496 147.663 1.00999.99 C ATOM 26029 CD1 PHE K 104 190.065 162.142 148.885 1.00999.99 C ATOM 26030 CD2 PHE K 104 189.184 161.667 146.716 1.00999.99 C ATOM 26031 CE1 PHE K 104 188.970 162.942 149.158 1.00999.99 C ATOM 26032 CE2 PHE K 104 188.085 162.466 146.982 1.00999.99 C ATOM 26033 CZ PHE K 104 187.979 163.105 148.205 1.00999.99 C ATOM 26034 N GLU K 105 194.491 159.686 147.268 1.00999.99 N ATOM 26035 CA GLU K 105 195.604 158.866 147.741 1.00999.99 C ATOM 26036 C GLU K 105 196.697 159.729 148.361 1.00999.99 C ATOM 26037 O GLU K 105 197.171 159.451 149.471 1.00999.99 O ATOM 26038 CB GLU K 105 196.170 158.037 146.587 1.00999.99 C ATOM 26039 CG GLU K 105 195.468 156.712 146.352 1.00999.99 C ATOM 26040 CD GLU K 105 196.042 155.951 145.173 1.00999.99 C ATOM 26041 OE1 GLU K 105 197.046 156.419 144.594 1.00999.99 O ATOM 26042 OE2 GLU K 105 195.491 154.886 144.824 1.00999.99 O ATOM 26043 N ASP K 106 197.092 160.800 147.663 1.00999.99 N ATOM 26044 CA ASP K 106 198.107 161.696 148.216 1.00999.99 C ATOM 26045 C ASP K 106 197.584 162.480 149.418 1.00999.99 C ATOM 26046 O ASP K 106 198.356 162.800 150.330 1.00999.99 O ATOM 26047 CB ASP K 106 198.619 162.641 147.132 1.00999.99 C ATOM 26048 CG ASP K 106 199.625 161.975 146.216 1.00999.99 C ATOM 26049 OD1 ASP K 106 200.200 160.942 146.618 1.00999.99 O ATOM 26050 OD2 ASP K 106 199.848 162.483 145.099 1.00999.99 O ATOM 26051 N THR K 107 196.277 162.747 149.461 1.00999.99 N ATOM 26052 CA THR K 107 195.668 163.430 150.597 1.00999.99 C ATOM 26053 C THR K 107 195.685 162.550 151.842 1.00999.99 C ATOM 26054 O THR K 107 196.034 163.010 152.937 1.00999.99 O ATOM 26055 CB THR K 107 194.238 163.839 150.228 1.00999.99 C ATOM 26056 OG1 THR K 107 194.277 164.855 149.218 1.00999.99 O ATOM 26057 CG2 THR K 107 193.476 164.360 151.431 1.00999.99 C ATOM 26058 N ASN K 108 195.338 161.269 151.687 1.00999.99 N ATOM 26059 CA ASN K 108 195.405 160.341 152.811 1.00999.99 C ATOM 26060 C ASN K 108 196.843 160.067 153.231 1.00999.99 C ATOM 26061 O ASN K 108 197.105 159.859 154.422 1.00999.99 O ATOM 26062 CB ASN K 108 194.693 159.036 152.462 1.00999.99 C ATOM 26063 CG ASN K 108 194.282 158.252 153.691 1.00999.99 C ATOM 26064 OD1 ASN K 108 194.992 157.349 154.131 1.00999.99 O ATOM 26065 ND2 ASN K 108 193.133 158.601 154.259 1.00999.99 N ATOM 26066 N LEU K 109 197.785 160.081 152.279 1.00999.99 N ATOM 26067 CA LEU K 109 199.197 159.957 152.632 1.00999.99 C ATOM 26068 C LEU K 109 199.676 161.163 153.435 1.00999.99 C ATOM 26069 O LEU K 109 200.453 161.016 154.387 1.00999.99 O ATOM 26070 CB LEU K 109 200.038 159.783 151.368 1.00999.99 C ATOM 26071 CG LEU K 109 200.115 158.366 150.796 1.00999.99 C ATOM 26072 CD1 LEU K 109 200.856 158.363 149.469 1.00999.99 C ATOM 26073 CD2 LEU K 109 200.779 157.424 151.788 1.00999.99 C ATOM 26074 N CYS K 110 199.205 162.361 153.077 1.00999.99 N ATOM 26075 CA CYS K 110 199.526 163.556 153.851 1.00999.99 C ATOM 26076 C CYS K 110 198.865 163.535 155.225 1.00999.99 C ATOM 26077 O CYS K 110 199.430 164.061 156.191 1.00999.99 O ATOM 26078 CB CYS K 110 199.091 164.804 153.087 1.00999.99 C ATOM 26079 SG CYS K 110 200.254 165.384 151.846 1.00999.99 S ATOM 26080 N ALA K 111 197.669 162.949 155.324 1.00999.99 N ATOM 26081 CA ALA K 111 196.973 162.881 156.606 1.00999.99 C ATOM 26082 C ALA K 111 197.647 161.896 157.553 1.00999.99 C ATOM 26083 O ALA K 111 197.781 162.174 158.750 1.00999.99 O ATOM 26084 CB ALA K 111 195.510 162.500 156.390 1.00999.99 C ATOM 26085 N ILE K 112 198.064 160.735 157.036 1.00999.99 N ATOM 26086 CA ILE K 112 198.848 159.791 157.830 1.00999.99 C ATOM 26087 C ILE K 112 200.205 160.392 158.185 1.00999.99 C ATOM 26088 O ILE K 112 200.717 160.183 159.295 1.00999.99 O ATOM 26089 CB ILE K 112 198.975 158.456 157.066 1.00999.99 C ATOM 26090 CG1 ILE K 112 197.601 157.808 156.911 1.00999.99 C ATOM 26091 CG2 ILE K 112 199.920 157.477 157.761 1.00999.99 C ATOM 26092 CD1 ILE K 112 197.618 156.546 156.091 1.00999.99 C ATOM 26093 N HIS K 113 200.777 161.191 157.279 1.00999.99 N ATOM 26094 CA HIS K 113 202.059 161.835 157.539 1.00999.99 C ATOM 26095 C HIS K 113 201.970 162.884 158.643 1.00999.99 C ATOM 26096 O HIS K 113 202.952 163.112 159.357 1.00999.99 O ATOM 26097 CB HIS K 113 202.586 162.469 156.254 1.00999.99 C ATOM 26098 CG HIS K 113 203.965 163.026 156.386 1.00999.99 C ATOM 26099 ND1 HIS K 113 205.067 162.229 156.602 1.00999.99 N ATOM 26100 CD2 HIS K 113 204.421 164.300 156.347 1.00999.99 C ATOM 26101 CE1 HIS K 113 206.144 162.987 156.685 1.00999.99 C ATOM 26102 NE2 HIS K 113 205.781 164.248 156.531 1.00999.99 N ATOM 26103 N ALA K 114 200.807 163.518 158.812 1.00999.99 N ATOM 26104 CA ALA K 114 200.620 164.544 159.831 1.00999.99 C ATOM 26105 C ALA K 114 200.050 163.990 161.133 1.00999.99 C ATOM 26106 O ALA K 114 199.389 164.737 161.871 1.00999.99 O ATOM 26107 CB ALA K 114 199.726 165.661 159.293 1.00999.99 C