>>6L49:HELIX   57 AG3 GLN O   85  ALA O  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 57 AG3 GLN O 85 ALA O 114 1 30 ATOM 28889 N GLN O 85 233.597 168.034 130.435 1.00999.99 N ATOM 28890 CA GLN O 85 233.757 169.478 130.375 1.00999.99 C ATOM 28891 C GLN O 85 233.478 170.086 131.743 1.00999.99 C ATOM 28892 O GLN O 85 232.681 169.555 132.521 1.00999.99 O ATOM 28893 CB GLN O 85 232.814 170.075 129.330 1.00999.99 C ATOM 28894 CG GLN O 85 232.918 169.431 127.959 1.00999.99 C ATOM 28895 CD GLN O 85 232.257 170.261 126.876 1.00999.99 C ATOM 28896 OE1 GLN O 85 231.301 170.993 127.135 1.00999.99 O ATOM 28897 NE2 GLN O 85 232.768 170.157 125.655 1.00999.99 N ATOM 28898 N SER O 86 234.158 171.197 132.042 1.00999.99 N ATOM 28899 CA SER O 86 233.930 171.884 133.310 1.00999.99 C ATOM 28900 C SER O 86 232.540 172.504 133.366 1.00999.99 C ATOM 28901 O SER O 86 231.919 172.537 134.437 1.00999.99 O ATOM 28902 CB SER O 86 235.000 172.953 133.530 1.00999.99 C ATOM 28903 OG SER O 86 236.267 172.365 133.769 1.00999.99 O ATOM 28904 N SER O 87 232.034 172.977 132.223 1.00999.99 N ATOM 28905 CA SER O 87 230.665 173.472 132.157 1.00999.99 C ATOM 28906 C SER O 87 229.654 172.352 132.364 1.00999.99 C ATOM 28907 O SER O 87 228.591 172.586 132.945 1.00999.99 O ATOM 28908 CB SER O 87 230.422 174.170 130.819 1.00999.99 C ATOM 28909 OG SER O 87 230.572 173.266 129.738 1.00999.99 O ATOM 28910 N ALA O 88 229.982 171.130 131.931 1.00999.99 N ATOM 28911 CA ALA O 88 229.102 169.987 132.163 1.00999.99 C ATOM 28912 C ALA O 88 229.024 169.634 133.645 1.00999.99 C ATOM 28913 O ALA O 88 227.936 169.348 134.165 1.00999.99 O ATOM 28914 CB ALA O 88 229.586 168.786 131.354 1.00999.99 C ATOM 28915 N VAL O 89 230.166 169.663 134.339 1.00999.99 N ATOM 28916 CA VAL O 89 230.193 169.376 135.770 1.00999.99 C ATOM 28917 C VAL O 89 229.474 170.472 136.550 1.00999.99 C ATOM 28918 O VAL O 89 228.715 170.188 137.486 1.00999.99 O ATOM 28919 CB VAL O 89 231.648 169.192 136.243 1.00999.99 C ATOM 28920 CG1 VAL O 89 231.706 168.912 137.737 1.00999.99 C ATOM 28921 CG2 VAL O 89 232.314 168.063 135.473 1.00999.99 C ATOM 28922 N MET O 90 229.673 171.736 136.156 1.00999.99 N ATOM 28923 CA MET O 90 228.965 172.838 136.804 1.00999.99 C ATOM 28924 C MET O 90 227.464 172.789 136.534 1.00999.99 C ATOM 28925 O MET O 90 226.669 173.131 137.416 1.00999.99 O ATOM 28926 CB MET O 90 229.544 174.177 136.346 1.00999.99 C ATOM 28927 CG MET O 90 230.920 174.484 136.915 1.00999.99 C ATOM 28928 SD MET O 90 230.923 174.639 138.710 1.00999.99 S ATOM 28929 CE MET O 90 230.209 176.270 138.902 1.00999.99 C ATOM 28930 N ALA O 91 227.060 172.327 135.347 1.00999.99 N ATOM 28931 CA ALA O 91 225.642 172.195 135.030 1.00999.99 C ATOM 28932 C ALA O 91 224.997 171.079 135.842 1.00999.99 C ATOM 28933 O ALA O 91 223.881 171.239 136.357 1.00999.99 O ATOM 28934 CB ALA O 91 225.466 171.943 133.533 1.00999.99 C ATOM 28935 N LEU O 92 225.690 169.939 135.958 1.00999.99 N ATOM 28936 CA LEU O 92 225.212 168.841 136.796 1.00999.99 C ATOM 28937 C LEU O 92 225.110 169.262 138.256 1.00999.99 C ATOM 28938 O LEU O 92 224.123 168.946 138.932 1.00999.99 O ATOM 28939 CB LEU O 92 226.140 167.634 136.655 1.00999.99 C ATOM 28940 CG LEU O 92 225.754 166.573 135.625 1.00999.99 C ATOM 28941 CD1 LEU O 92 226.936 165.668 135.314 1.00999.99 C ATOM 28942 CD2 LEU O 92 224.572 165.762 136.122 1.00999.99 C ATOM 28943 N GLN O 93 226.102 170.020 138.739 1.00999.99 N ATOM 28944 CA GLN O 93 226.099 170.499 140.117 1.00999.99 C ATOM 28945 C GLN O 93 224.964 171.485 140.369 1.00999.99 C ATOM 28946 O GLN O 93 224.292 171.406 141.403 1.00999.99 O ATOM 28947 CB GLN O 93 227.446 171.143 140.438 1.00999.99 C ATOM 28948 CG GLN O 93 227.911 170.963 141.869 1.00999.99 C ATOM 28949 CD GLN O 93 229.389 171.256 142.031 1.00999.99 C ATOM 28950 OE1 GLN O 93 230.189 170.985 141.136 1.00999.99 O ATOM 28951 NE2 GLN O 93 229.758 171.820 143.173 1.00999.99 N ATOM 28952 N GLU O 94 224.714 172.393 139.419 1.00999.99 N ATOM 28953 CA GLU O 94 223.659 173.389 139.588 1.00999.99 C ATOM 28954 C GLU O 94 222.275 172.749 139.547 1.00999.99 C ATOM 28955 O GLU O 94 221.410 173.071 140.374 1.00999.99 O ATOM 28956 CB GLU O 94 223.785 174.467 138.511 1.00999.99 C ATOM 28957 CG GLU O 94 224.776 175.569 138.848 1.00999.99 C ATOM 28958 CD GLU O 94 224.149 176.688 139.656 1.00999.99 C ATOM 28959 OE1 GLU O 94 222.909 176.689 139.811 1.00999.99 O ATOM 28960 OE2 GLU O 94 224.895 177.566 140.136 1.00999.99 O ATOM 28961 N ALA O 95 222.054 171.825 138.602 1.00999.99 N ATOM 28962 CA ALA O 95 220.761 171.152 138.509 1.00999.99 C ATOM 28963 C ALA O 95 220.513 170.253 139.715 1.00999.99 C ATOM 28964 O ALA O 95 219.396 170.223 140.252 1.00999.99 O ATOM 28965 CB ALA O 95 220.681 170.346 137.213 1.00999.99 C ATOM 28966 N CYS O 96 221.552 169.548 140.179 1.00999.99 N ATOM 28967 CA CYS O 96 221.415 168.692 141.350 1.00999.99 C ATOM 28968 C CYS O 96 221.177 169.508 142.614 1.00999.99 C ATOM 28969 O CYS O 96 220.367 169.118 143.462 1.00999.99 O ATOM 28970 CB CYS O 96 222.657 167.815 141.519 1.00 30.00 C ATOM 28971 SG CYS O 96 222.915 166.622 140.186 1.00 30.00 S ATOM 28972 N GLU O 97 221.844 170.662 142.741 1.00999.99 N ATOM 28973 CA GLU O 97 221.647 171.509 143.912 1.00999.99 C ATOM 28974 C GLU O 97 220.258 172.132 143.921 1.00999.99 C ATOM 28975 O GLU O 97 219.627 172.221 144.979 1.00999.99 O ATOM 28976 CB GLU O 97 222.723 172.593 143.965 1.00999.99 C ATOM 28977 CG GLU O 97 223.997 172.160 144.669 1.00999.99 C ATOM 28978 CD GLU O 97 224.697 173.308 145.368 1.00999.99 C ATOM 28979 OE1 GLU O 97 224.015 174.287 145.737 1.00999.99 O ATOM 28980 OE2 GLU O 97 225.930 173.232 145.546 1.00999.99 O ATOM 28981 N ALA O 98 219.751 172.541 142.753 1.00999.99 N ATOM 28982 CA ALA O 98 218.401 173.097 142.696 1.00999.99 C ATOM 28983 C ALA O 98 217.344 172.033 142.977 1.00999.99 C ATOM 28984 O ALA O 98 216.340 172.312 143.649 1.00999.99 O ATOM 28985 CB ALA O 98 218.158 173.748 141.338 1.00999.99 C ATOM 28986 N TYR O 99 217.568 170.802 142.500 1.00999.99 N ATOM 28987 CA TYR O 99 216.646 169.709 142.801 1.00999.99 C ATOM 28988 C TYR O 99 216.666 169.354 144.285 1.00999.99 C ATOM 28989 O TYR O 99 215.611 169.098 144.879 1.00999.99 O ATOM 28990 CB TYR O 99 216.989 168.489 141.944 1.00999.99 C ATOM 28991 CG TYR O 99 216.267 167.220 142.341 1.00999.99 C ATOM 28992 CD1 TYR O 99 214.877 167.148 142.324 1.00999.99 C ATOM 28993 CD2 TYR O 99 216.978 166.089 142.724 1.00999.99 C ATOM 28994 CE1 TYR O 99 214.216 165.986 142.684 1.00999.99 C ATOM 28995 CE2 TYR O 99 216.328 164.923 143.084 1.00999.99 C ATOM 28996 CZ TYR O 99 214.948 164.877 143.064 1.00999.99 C ATOM 28997 OH TYR O 99 214.300 163.718 143.423 1.00999.99 O ATOM 28998 N LEU O 100 217.849 169.374 144.911 1.00999.99 N ATOM 28999 CA LEU O 100 217.930 169.095 146.342 1.00999.99 C ATOM 29000 C LEU O 100 217.328 170.220 147.178 1.00999.99 C ATOM 29001 O LEU O 100 216.739 169.954 148.229 1.00999.99 O ATOM 29002 CB LEU O 100 219.381 168.845 146.755 1.00999.99 C ATOM 29003 CG LEU O 100 220.024 167.523 146.319 1.00999.99 C ATOM 29004 CD1 LEU O 100 221.363 167.319 147.016 1.00999.99 C ATOM 29005 CD2 LEU O 100 219.096 166.338 146.559 1.00999.99 C ATOM 29006 N VAL O 101 217.433 171.471 146.720 1.00999.99 N ATOM 29007 CA VAL O 101 216.824 172.582 147.451 1.00999.99 C ATOM 29008 C VAL O 101 215.301 172.538 147.330 1.00999.99 C ATOM 29009 O VAL O 101 214.583 172.794 148.305 1.00999.99 O ATOM 29010 CB VAL O 101 217.424 173.921 146.971 1.00999.99 C ATOM 29011 CG1 VAL O 101 216.593 175.111 147.417 1.00999.99 C ATOM 29012 CG2 VAL O 101 218.826 174.079 147.523 1.00999.99 C ATOM 29013 N GLY O 102 214.783 172.166 146.152 1.00999.99 N ATOM 29014 CA GLY O 102 213.336 171.994 146.007 1.00999.99 C ATOM 29015 C GLY O 102 212.825 170.818 146.838 1.00999.99 C ATOM 29016 O GLY O 102 211.735 170.890 147.430 1.00999.99 O ATOM 29017 N LEU O 103 213.616 169.740 146.917 1.00999.99 N ATOM 29018 CA LEU O 103 213.271 168.617 147.783 1.00999.99 C ATOM 29019 C LEU O 103 213.296 169.021 149.253 1.00999.99 C ATOM 29020 O LEU O 103 212.444 168.587 150.034 1.00999.99 O ATOM 29021 CB LEU O 103 214.228 167.451 147.530 1.00999.99 C ATOM 29022 CG LEU O 103 214.020 166.180 148.356 1.00999.99 C ATOM 29023 CD1 LEU O 103 212.768 165.439 147.910 1.00999.99 C ATOM 29024 CD2 LEU O 103 215.243 165.282 148.272 1.00999.99 C ATOM 29025 N PHE O 104 214.245 169.878 149.639 1.00999.99 N ATOM 29026 CA PHE O 104 214.297 170.382 151.009 1.00999.99 C ATOM 29027 C PHE O 104 213.127 171.306 151.319 1.00999.99 C ATOM 29028 O PHE O 104 212.633 171.316 152.452 1.00999.99 O ATOM 29029 CB PHE O 104 215.615 171.116 151.247 1.00999.99 C ATOM 29030 CG PHE O 104 216.678 170.261 151.859 1.00999.99 C ATOM 29031 CD1 PHE O 104 216.443 169.597 153.051 1.00999.99 C ATOM 29032 CD2 PHE O 104 217.912 170.119 151.244 1.00999.99 C ATOM 29033 CE1 PHE O 104 217.417 168.805 153.619 1.00999.99 C ATOM 29034 CE2 PHE O 104 218.895 169.328 151.809 1.00999.99 C ATOM 29035 CZ PHE O 104 218.646 168.670 153.000 1.00999.99 C ATOM 29036 N GLU O 105 212.674 172.078 150.328 1.00999.99 N ATOM 29037 CA GLU O 105 211.510 172.940 150.514 1.00999.99 C ATOM 29038 C GLU O 105 210.249 172.115 150.733 1.00999.99 C ATOM 29039 O GLU O 105 209.469 172.385 151.656 1.00999.99 O ATOM 29040 CB GLU O 105 211.344 173.864 149.308 1.00999.99 C ATOM 29041 CG GLU O 105 212.294 175.044 149.292 1.00999.99 C ATOM 29042 CD GLU O 105 212.306 175.759 147.957 1.00999.99 C ATOM 29043 OE1 GLU O 105 211.547 175.347 147.053 1.00999.99 O ATOM 29044 OE2 GLU O 105 213.073 176.733 147.811 1.00999.99 O ATOM 29045 N ASP O 106 210.046 171.084 149.904 1.00999.99 N ATOM 29046 CA ASP O 106 208.900 170.199 150.109 1.00999.99 C ATOM 29047 C ASP O 106 209.027 169.396 151.401 1.00999.99 C ATOM 29048 O ASP O 106 208.017 169.113 152.056 1.00999.99 O ATOM 29049 CB ASP O 106 208.733 169.266 148.913 1.00999.99 C ATOM 29050 CG ASP O 106 208.058 169.943 147.740 1.00999.99 C ATOM 29051 OD1 ASP O 106 207.429 171.003 147.945 1.00999.99 O ATOM 29052 OD2 ASP O 106 208.154 169.418 146.612 1.00999.99 O ATOM 29053 N THR O 107 210.258 169.064 151.800 1.00999.99 N ATOM 29054 CA THR O 107 210.503 168.359 153.055 1.00999.99 C ATOM 29055 C THR O 107 210.116 169.215 154.255 1.00999.99 C ATOM 29056 O THR O 107 209.435 168.745 155.175 1.00999.99 O ATOM 29057 CB THR O 107 211.979 167.958 153.120 1.00999.99 C ATOM 29058 OG1 THR O 107 212.268 167.027 152.070 1.00999.99 O ATOM 29059 CG2 THR O 107 212.325 167.335 154.452 1.00999.99 C ATOM 29060 N ASN O 108 210.518 170.489 154.243 1.00999.99 N ATOM 29061 CA ASN O 108 210.110 171.415 155.294 1.00999.99 C ATOM 29062 C ASN O 108 208.608 171.666 155.272 1.00999.99 C ATOM 29063 O ASN O 108 207.999 171.863 156.331 1.00999.99 O ATOM 29064 CB ASN O 108 210.872 172.730 155.152 1.00999.99 C ATOM 29065 CG ASN O 108 210.803 173.576 156.401 1.00999.99 C ATOM 29066 OD1 ASN O 108 210.844 173.061 157.518 1.00999.99 O ATOM 29067 ND2 ASN O 108 210.691 174.886 156.220 1.00999.99 N ATOM 29068 N LEU O 109 207.995 171.637 154.083 1.00999.99 N ATOM 29069 CA LEU O 109 206.546 171.797 153.979 1.00999.99 C ATOM 29070 C LEU O 109 205.805 170.633 154.631 1.00999.99 C ATOM 29071 O LEU O 109 204.836 170.841 155.371 1.00999.99 O ATOM 29072 CB LEU O 109 206.142 171.945 152.513 1.00999.99 C ATOM 29073 CG LEU O 109 206.227 173.367 151.957 1.00999.99 C ATOM 29074 CD1 LEU O 109 206.493 173.343 150.463 1.00999.99 C ATOM 29075 CD2 LEU O 109 204.953 174.136 152.269 1.00999.99 C ATOM 29076 N CYS O 110 206.254 169.397 154.382 1.00999.99 N ATOM 29077 CA CYS O 110 205.636 168.255 155.057 1.00999.99 C ATOM 29078 C CYS O 110 205.971 168.215 156.543 1.00999.99 C ATOM 29079 O CYS O 110 205.192 167.669 157.333 1.00999.99 O ATOM 29080 CB CYS O 110 206.044 166.928 154.414 1.00999.99 C ATOM 29081 SG CYS O 110 205.918 166.812 152.630 1.00999.99 S ATOM 29082 N ALA O 111 207.123 168.762 156.940 1.00999.99 N ATOM 29083 CA ALA O 111 207.487 168.768 158.354 1.00999.99 C ATOM 29084 C ALA O 111 206.619 169.740 159.142 1.00999.99 C ATOM 29085 O ALA O 111 206.139 169.415 160.234 1.00999.99 O ATOM 29086 CB ALA O 111 208.965 169.116 158.511 1.00999.99 C ATOM 29087 N ILE O 112 206.402 170.937 158.597 1.00999.99 N ATOM 29088 CA ILE O 112 205.494 171.894 159.221 1.00999.99 C ATOM 29089 C ILE O 112 204.045 171.418 159.100 1.00999.99 C ATOM 29090 O ILE O 112 203.224 171.667 159.995 1.00999.99 O ATOM 29091 CB ILE O 112 205.750 173.282 158.601 1.00999.99 C ATOM 29092 CG1 ILE O 112 207.107 173.789 159.085 1.00999.99 C ATOM 29093 CG2 ILE O 112 204.675 174.306 158.955 1.00999.99 C ATOM 29094 CD1 ILE O 112 207.828 174.632 158.100 1.00999.99 C ATOM 29095 N HIS O 113 203.730 170.665 158.042 1.00999.99 N ATOM 29096 CA HIS O 113 202.414 170.049 157.913 1.00999.99 C ATOM 29097 C HIS O 113 202.177 168.981 158.977 1.00999.99 C ATOM 29098 O HIS O 113 201.031 168.754 159.384 1.00999.99 O ATOM 29099 CB HIS O 113 202.268 169.457 156.513 1.00999.99 C ATOM 29100 CG HIS O 113 200.950 168.797 156.265 1.00999.99 C ATOM 29101 ND1 HIS O 113 199.798 169.507 156.008 1.00999.99 N ATOM 29102 CD2 HIS O 113 200.602 167.489 156.230 1.00999.99 C ATOM 29103 CE1 HIS O 113 198.798 168.665 155.822 1.00999.99 C ATOM 29104 NE2 HIS O 113 199.257 167.434 155.957 1.00999.99 N ATOM 29105 N ALA O 114 203.241 168.330 159.455 1.00999.99 N ATOM 29106 CA ALA O 114 203.136 167.307 160.488 1.00999.99 C ATOM 29107 C ALA O 114 203.401 167.849 161.889 1.00999.99 C ATOM 29108 O ALA O 114 203.924 167.108 162.736 1.00999.99 O ATOM 29109 CB ALA O 114 204.085 166.149 160.180 1.00999.99 C