>>6L49:HELIX   73 AI1 GLN S   85  ALA S  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 73 AI1 GLN S 85 ALA S 114 1 30 ATOM 31854 N GLN S 85 156.823 223.342 130.472 1.00999.99 N ATOM 31855 CA GLN S 85 156.569 221.909 130.495 1.00999.99 C ATOM 31856 C GLN S 85 157.116 221.308 131.783 1.00999.99 C ATOM 31857 O GLN S 85 158.053 221.842 132.385 1.00999.99 O ATOM 31858 CB GLN S 85 157.207 221.236 129.281 1.00999.99 C ATOM 31859 CG GLN S 85 156.676 221.734 127.947 1.00999.99 C ATOM 31860 CD GLN S 85 157.326 221.042 126.766 1.00999.99 C ATOM 31861 OE1 GLN S 85 158.366 220.398 126.904 1.00999.99 O ATOM 31862 NE2 GLN S 85 156.714 221.172 125.594 1.00999.99 N ATOM 31863 N SER S 86 156.517 220.192 132.212 1.00999.99 N ATOM 31864 CA SER S 86 156.935 219.557 133.459 1.00999.99 C ATOM 31865 C SER S 86 158.320 218.936 133.342 1.00999.99 C ATOM 31866 O SER S 86 159.047 218.854 134.341 1.00999.99 O ATOM 31867 CB SER S 86 155.913 218.500 133.879 1.00999.99 C ATOM 31868 OG SER S 86 154.718 219.103 134.344 1.00999.99 O ATOM 31869 N SER S 87 158.703 218.507 132.136 1.00999.99 N ATOM 31870 CA SER S 87 160.038 217.957 131.924 1.00999.99 C ATOM 31871 C SER S 87 161.110 219.030 132.077 1.00999.99 C ATOM 31872 O SER S 87 162.201 218.756 132.592 1.00999.99 O ATOM 31873 CB SER S 87 160.117 217.302 130.544 1.00999.99 C ATOM 31874 OG SER S 87 159.878 218.247 129.516 1.00999.99 O ATOM 31875 N ALA S 88 160.804 220.265 131.666 1.00999.99 N ATOM 31876 CA ALA S 88 161.738 221.374 131.853 1.00999.99 C ATOM 31877 C ALA S 88 161.912 221.712 133.329 1.00999.99 C ATOM 31878 O ALA S 88 163.028 222.010 133.777 1.00999.99 O ATOM 31879 CB ALA S 88 161.253 222.599 131.079 1.00999.99 C ATOM 31880 N VAL S 89 160.823 221.651 134.099 1.00999.99 N ATOM 31881 CA VAL S 89 160.892 221.922 135.531 1.00999.99 C ATOM 31882 C VAL S 89 161.666 220.822 136.249 1.00999.99 C ATOM 31883 O VAL S 89 162.477 221.100 137.141 1.00999.99 O ATOM 31884 CB VAL S 89 159.472 222.096 136.103 1.00999.99 C ATOM 31885 CG1 VAL S 89 159.519 222.410 137.590 1.00999.99 C ATOM 31886 CG2 VAL S 89 158.742 223.198 135.356 1.00999.99 C ATOM 31887 N MET S 90 161.458 219.561 135.848 1.00999.99 N ATOM 31888 CA MET S 90 162.229 218.462 136.427 1.00999.99 C ATOM 31889 C MET S 90 163.705 218.541 136.048 1.00999.99 C ATOM 31890 O MET S 90 164.569 218.199 136.865 1.00999.99 O ATOM 31891 CB MET S 90 161.647 217.117 135.993 1.00999.99 C ATOM 31892 CG MET S 90 160.285 216.801 136.590 1.00999.99 C ATOM 31893 SD MET S 90 160.190 217.134 138.358 1.00999.99 S ATOM 31894 CE MET S 90 158.522 216.590 138.711 1.00999.99 C ATOM 31895 N ALA S 91 164.010 219.019 134.837 1.00999.99 N ATOM 31896 CA ALA S 91 165.399 219.193 134.421 1.00999.99 C ATOM 31897 C ALA S 91 166.084 220.294 135.223 1.00999.99 C ATOM 31898 O ALA S 91 167.227 220.127 135.674 1.00999.99 O ATOM 31899 CB ALA S 91 165.459 219.502 132.925 1.00999.99 C ATOM 31900 N LEU S 92 165.394 221.426 135.410 1.00999.99 N ATOM 31901 CA LEU S 92 165.928 222.512 136.228 1.00999.99 C ATOM 31902 C LEU S 92 166.102 222.080 137.679 1.00999.99 C ATOM 31903 O LEU S 92 167.094 222.439 138.325 1.00999.99 O ATOM 31904 CB LEU S 92 165.009 223.731 136.140 1.00999.99 C ATOM 31905 CG LEU S 92 165.311 224.718 135.013 1.00999.99 C ATOM 31906 CD1 LEU S 92 164.106 225.596 134.717 1.00999.99 C ATOM 31907 CD2 LEU S 92 166.516 225.564 135.372 1.00999.99 C ATOM 31908 N GLN S 93 165.167 221.270 138.187 1.00999.99 N ATOM 31909 CA GLN S 93 165.250 220.763 139.553 1.00999.99 C ATOM 31910 C GLN S 93 166.434 219.822 139.732 1.00999.99 C ATOM 31911 O GLN S 93 167.164 219.925 140.724 1.00999.99 O ATOM 31912 CB GLN S 93 163.945 220.056 139.913 1.00999.99 C ATOM 31913 CG GLN S 93 163.560 220.129 141.375 1.00999.99 C ATOM 31914 CD GLN S 93 162.091 219.829 141.591 1.00999.99 C ATOM 31915 OE1 GLN S 93 161.287 219.908 140.662 1.00999.99 O ATOM 31916 NE2 GLN S 93 161.735 219.470 142.815 1.00999.99 N ATOM 31917 N GLU S 94 166.652 218.918 138.770 1.00999.99 N ATOM 31918 CA GLU S 94 167.769 217.981 138.861 1.00999.99 C ATOM 31919 C GLU S 94 169.109 218.696 138.734 1.00999.99 C ATOM 31920 O GLU S 94 170.056 218.383 139.468 1.00999.99 O ATOM 31921 CB GLU S 94 167.633 216.902 137.787 1.00999.99 C ATOM 31922 CG GLU S 94 166.688 215.770 138.157 1.00999.99 C ATOM 31923 CD GLU S 94 167.339 214.736 139.057 1.00999.99 C ATOM 31924 OE1 GLU S 94 166.604 213.969 139.714 1.00999.99 O ATOM 31925 OE2 GLU S 94 168.586 214.692 139.108 1.00999.99 O ATOM 31926 N ALA S 95 169.198 219.677 137.824 1.00999.99 N ATOM 31927 CA ALA S 95 170.439 220.431 137.660 1.00999.99 C ATOM 31928 C ALA S 95 170.748 221.272 138.894 1.00999.99 C ATOM 31929 O ALA S 95 171.898 221.303 139.356 1.00999.99 O ATOM 31930 CB ALA S 95 170.354 221.317 136.417 1.00999.99 C ATOM 31931 N CYS S 96 169.727 221.927 139.461 1.00999.99 N ATOM 31932 CA CYS S 96 169.923 222.730 140.663 1.00999.99 C ATOM 31933 C CYS S 96 170.276 221.860 141.861 1.00999.99 C ATOM 31934 O CYS S 96 171.120 222.240 142.682 1.00999.99 O ATOM 31935 CB CYS S 96 168.671 223.555 140.965 1.00 30.00 C ATOM 31936 SG CYS S 96 168.281 224.804 139.718 1.00 30.00 S ATOM 31937 N GLU S 97 169.667 220.673 141.958 1.00999.99 N ATOM 31938 CA GLU S 97 169.976 219.766 143.056 1.00999.99 C ATOM 31939 C GLU S 97 171.401 219.237 142.960 1.00999.99 C ATOM 31940 O GLU S 97 172.114 219.216 143.967 1.00999.99 O ATOM 31941 CB GLU S 97 168.973 218.614 143.091 1.00999.99 C ATOM 31942 CG GLU S 97 167.709 218.940 143.871 1.00999.99 C ATOM 31943 CD GLU S 97 166.917 217.711 144.269 1.00999.99 C ATOM 31944 OE1 GLU S 97 167.456 216.588 144.186 1.00999.99 O ATOM 31945 OE2 GLU S 97 165.748 217.870 144.672 1.00999.99 O ATOM 31946 N ALA S 98 171.847 218.849 141.757 1.00999.99 N ATOM 31947 CA ALA S 98 173.216 218.360 141.591 1.00999.99 C ATOM 31948 C ALA S 98 174.239 219.464 141.842 1.00999.99 C ATOM 31949 O ALA S 98 175.285 219.222 142.465 1.00999.99 O ATOM 31950 CB ALA S 98 173.394 217.766 140.195 1.00999.99 C ATOM 31951 N TYR S 99 173.927 220.694 141.414 1.00999.99 N ATOM 31952 CA TYR S 99 174.825 221.819 141.651 1.00999.99 C ATOM 31953 C TYR S 99 174.914 222.163 143.136 1.00999.99 C ATOM 31954 O TYR S 99 176.007 222.434 143.648 1.00999.99 O ATOM 31955 CB TYR S 99 174.363 223.024 140.833 1.00999.99 C ATOM 31956 CG TYR S 99 175.106 224.306 141.126 1.00999.99 C ATOM 31957 CD1 TYR S 99 176.484 224.389 140.958 1.00999.99 C ATOM 31958 CD2 TYR S 99 174.426 225.439 141.557 1.00999.99 C ATOM 31959 CE1 TYR S 99 177.165 225.564 141.221 1.00999.99 C ATOM 31960 CE2 TYR S 99 175.096 226.617 141.820 1.00999.99 C ATOM 31961 CZ TYR S 99 176.463 226.674 141.652 1.00999.99 C ATOM 31962 OH TYR S 99 177.128 227.847 141.915 1.00999.99 O ATOM 31963 N LEU S 100 173.789 222.115 143.855 1.00999.99 N ATOM 31964 CA LEU S 100 173.831 222.411 145.284 1.00999.99 C ATOM 31965 C LEU S 100 174.465 221.277 146.086 1.00999.99 C ATOM 31966 O LEU S 100 175.086 221.536 147.121 1.00999.99 O ATOM 31967 CB LEU S 100 172.425 222.722 145.803 1.00999.99 C ATOM 31968 CG LEU S 100 171.818 224.059 145.354 1.00999.99 C ATOM 31969 CD1 LEU S 100 170.536 224.370 146.117 1.00999.99 C ATOM 31970 CD2 LEU S 100 172.811 225.210 145.475 1.00999.99 C ATOM 31971 N VAL S 101 174.351 220.028 145.620 1.00999.99 N ATOM 31972 CA VAL S 101 175.033 218.922 146.295 1.00999.99 C ATOM 31973 C VAL S 101 176.545 219.024 146.098 1.00999.99 C ATOM 31974 O VAL S 101 177.319 218.806 147.040 1.00999.99 O ATOM 31975 CB VAL S 101 174.466 217.565 145.822 1.00999.99 C ATOM 31976 CG1 VAL S 101 175.344 216.394 146.265 1.00999.99 C ATOM 31977 CG2 VAL S 101 173.071 217.357 146.396 1.00999.99 C ATOM 31978 N GLY S 102 176.989 219.407 144.894 1.00999.99 N ATOM 31979 CA GLY S 102 178.420 219.628 144.677 1.00999.99 C ATOM 31980 C GLY S 102 178.930 220.830 145.473 1.00999.99 C ATOM 31981 O GLY S 102 180.054 220.806 146.002 1.00999.99 O ATOM 31982 N LEU S 103 178.100 221.873 145.592 1.00999.99 N ATOM 31983 CA LEU S 103 178.449 223.028 146.413 1.00999.99 C ATOM 31984 C LEU S 103 178.546 222.652 147.888 1.00999.99 C ATOM 31985 O LEU S 103 179.437 223.128 148.597 1.00999.99 O ATOM 31986 CB LEU S 103 177.416 224.136 146.208 1.00999.99 C ATOM 31987 CG LEU S 103 177.641 225.450 146.955 1.00999.99 C ATOM 31988 CD1 LEU S 103 178.625 226.337 146.207 1.00999.99 C ATOM 31989 CD2 LEU S 103 176.318 226.164 147.185 1.00999.99 C ATOM 31990 N PHE S 104 177.659 221.771 148.357 1.00999.99 N ATOM 31991 CA PHE S 104 177.719 221.308 149.739 1.00999.99 C ATOM 31992 C PHE S 104 178.911 220.393 149.981 1.00999.99 C ATOM 31993 O PHE S 104 179.465 220.382 151.087 1.00999.99 O ATOM 31994 CB PHE S 104 176.422 220.591 150.104 1.00999.99 C ATOM 31995 CG PHE S 104 175.418 221.475 150.770 1.00999.99 C ATOM 31996 CD1 PHE S 104 175.737 222.131 151.947 1.00999.99 C ATOM 31997 CD2 PHE S 104 174.157 221.655 150.223 1.00999.99 C ATOM 31998 CE1 PHE S 104 174.820 222.950 152.569 1.00999.99 C ATOM 31999 CE2 PHE S 104 173.230 222.474 150.841 1.00999.99 C ATOM 32000 CZ PHE S 104 173.564 223.122 152.017 1.00999.99 C ATOM 32001 N GLU S 105 179.316 219.628 148.963 1.00999.99 N ATOM 32002 CA GLU S 105 180.520 218.808 149.069 1.00999.99 C ATOM 32003 C GLU S 105 181.760 219.679 149.223 1.00999.99 C ATOM 32004 O GLU S 105 182.597 219.441 150.104 1.00999.99 O ATOM 32005 CB GLU S 105 180.649 217.905 147.842 1.00999.99 C ATOM 32006 CG GLU S 105 179.745 216.686 147.861 1.00999.99 C ATOM 32007 CD GLU S 105 179.664 216.005 146.511 1.00999.99 C ATOM 32008 OE1 GLU S 105 180.360 216.453 145.576 1.00999.99 O ATOM 32009 OE2 GLU S 105 178.902 215.024 146.384 1.00999.99 O ATOM 32010 N ASP S 106 181.877 220.718 148.386 1.00999.99 N ATOM 32011 CA ASP S 106 182.991 221.656 148.522 1.00999.99 C ATOM 32012 C ASP S 106 182.901 222.460 149.817 1.00999.99 C ATOM 32013 O ASP S 106 183.935 222.809 150.402 1.00999.99 O ATOM 32014 CB ASP S 106 183.041 222.587 147.312 1.00999.99 C ATOM 32015 CG ASP S 106 183.533 221.884 146.062 1.00999.99 C ATOM 32016 OD1 ASP S 106 184.212 220.845 146.194 1.00999.99 O ATOM 32017 OD2 ASP S 106 183.241 222.367 144.949 1.00999.99 O ATOM 32018 N THR S 107 181.680 222.718 150.295 1.00999.99 N ATOM 32019 CA THR S 107 181.469 223.414 151.560 1.00999.99 C ATOM 32020 C THR S 107 181.977 222.591 152.739 1.00999.99 C ATOM 32021 O THR S 107 182.697 223.103 153.605 1.00999.99 O ATOM 32022 CB THR S 107 179.978 223.727 151.714 1.00999.99 C ATOM 32023 OG1 THR S 107 179.560 224.597 150.655 1.00999.99 O ATOM 32024 CG2 THR S 107 179.683 224.382 153.047 1.00999.99 C ATOM 32025 N ASN S 108 181.633 221.301 152.775 1.00999.99 N ATOM 32026 CA ASN S 108 182.118 220.445 153.852 1.00999.99 C ATOM 32027 C ASN S 108 183.611 220.168 153.727 1.00999.99 C ATOM 32028 O ASN S 108 184.287 219.992 154.746 1.00999.99 O ATOM 32029 CB ASN S 108 181.342 219.132 153.888 1.00999.99 C ATOM 32030 CG ASN S 108 181.508 218.400 155.205 1.00999.99 C ATOM 32031 OD1 ASN S 108 182.432 217.607 155.375 1.00999.99 O ATOM 32032 ND2 ASN S 108 180.617 218.674 156.150 1.00999.99 N ATOM 32033 N LEU S 109 184.147 220.152 152.501 1.00999.99 N ATOM 32034 CA LEU S 109 185.591 220.010 152.326 1.00999.99 C ATOM 32035 C LEU S 109 186.334 221.228 152.867 1.00999.99 C ATOM 32036 O LEU S 109 187.384 221.098 153.511 1.00999.99 O ATOM 32037 CB LEU S 109 185.917 219.789 150.849 1.00999.99 C ATOM 32038 CG LEU S 109 185.796 218.360 150.320 1.00999.99 C ATOM 32039 CD1 LEU S 109 185.514 218.374 148.827 1.00999.99 C ATOM 32040 CD2 LEU S 109 187.056 217.565 150.623 1.00999.99 C ATOM 32041 N CYS S 110 185.788 222.424 152.630 1.00999.99 N ATOM 32042 CA CYS S 110 186.376 223.635 153.194 1.00999.99 C ATOM 32043 C CYS S 110 186.200 223.695 154.707 1.00999.99 C ATOM 32044 O CYS S 110 187.034 224.285 155.403 1.00999.99 O ATOM 32045 CB CYS S 110 185.752 224.867 152.547 1.00999.99 C ATOM 32046 SG CYS S 110 186.395 225.283 150.930 1.00999.99 S ATOM 32047 N ALA S 111 185.118 223.107 155.226 1.00999.99 N ATOM 32048 CA ALA S 111 184.925 223.041 156.672 1.00999.99 C ATOM 32049 C ALA S 111 185.929 222.099 157.326 1.00999.99 C ATOM 32050 O ALA S 111 186.421 222.374 158.426 1.00999.99 O ATOM 32051 CB ALA S 111 183.495 222.605 156.989 1.00999.99 C ATOM 32052 N ILE S 112 186.232 220.977 156.668 1.00999.99 N ATOM 32053 CA ILE S 112 187.266 220.065 157.155 1.00999.99 C ATOM 32054 C ILE S 112 188.637 220.727 157.080 1.00999.99 C ATOM 32055 O ILE S 112 189.465 220.584 157.992 1.00999.99 O ATOM 32056 CB ILE S 112 187.217 218.747 156.357 1.00999.99 C ATOM 32057 CG1 ILE S 112 185.944 217.980 156.691 1.00999.99 C ATOM 32058 CG2 ILE S 112 188.432 217.861 156.630 1.00999.99 C ATOM 32059 CD1 ILE S 112 185.794 216.720 155.906 1.00999.99 C ATOM 32060 N HIS S 113 188.877 221.502 156.017 1.00999.99 N ATOM 32061 CA HIS S 113 190.166 222.160 155.826 1.00999.99 C ATOM 32062 C HIS S 113 190.439 223.226 156.881 1.00999.99 C ATOM 32063 O HIS S 113 191.603 223.499 157.195 1.00999.99 O ATOM 32064 CB HIS S 113 190.219 222.777 154.434 1.00999.99 C ATOM 32065 CG HIS S 113 191.587 223.210 154.013 1.00999.99 C ATOM 32066 ND1 HIS S 113 192.639 222.331 153.882 1.00999.99 N ATOM 32067 CD2 HIS S 113 192.072 224.431 153.684 1.00999.99 C ATOM 32068 CE1 HIS S 113 193.715 222.992 153.493 1.00999.99 C ATOM 32069 NE2 HIS S 113 193.397 224.268 153.366 1.00999.99 N ATOM 32070 N ALA S 114 189.393 223.826 157.448 1.00999.99 N ATOM 32071 CA ALA S 114 189.542 224.831 158.489 1.00999.99 C ATOM 32072 C ALA S 114 189.490 224.239 159.894 1.00999.99 C ATOM 32073 O ALA S 114 189.168 224.968 160.841 1.00999.99 O ATOM 32074 CB ALA S 114 188.471 225.910 158.335 1.00999.99 C