>>6L49:HELIX   88 AJ7 GLN W   85  ALA W  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 88 AJ7 GLN W 85 ALA W 114 1 30 ATOM 34856 N GLN W 85 209.772 226.540 117.934 1.00999.99 N ATOM 34857 CA GLN W 85 209.810 227.987 117.801 1.00999.99 C ATOM 34858 C GLN W 85 209.953 228.617 119.181 1.00999.99 C ATOM 34859 O GLN W 85 209.487 228.064 120.181 1.00999.99 O ATOM 34860 CB GLN W 85 208.546 228.494 117.109 1.00999.99 C ATOM 34861 CG GLN W 85 208.269 227.825 115.773 1.00999.99 C ATOM 34862 CD GLN W 85 207.341 228.640 114.895 1.00999.99 C ATOM 34863 OE1 GLN W 85 206.507 229.398 115.390 1.00999.99 O ATOM 34864 NE2 GLN W 85 207.485 228.491 113.584 1.00999.99 N ATOM 34865 N SER W 86 210.621 229.772 119.235 1.00999.99 N ATOM 34866 CA SER W 86 210.825 230.448 120.513 1.00999.99 C ATOM 34867 C SER W 86 209.525 231.027 121.057 1.00999.99 C ATOM 34868 O SER W 86 209.347 231.112 122.280 1.00999.99 O ATOM 34869 CB SER W 86 211.877 231.546 120.365 1.00999.99 C ATOM 34870 OG SER W 86 213.159 230.994 120.118 1.00999.99 O ATOM 34871 N SER W 87 208.604 231.413 120.166 1.00999.99 N ATOM 34872 CA SER W 87 207.307 231.923 120.598 1.00999.99 C ATOM 34873 C SER W 87 206.469 230.837 121.257 1.00999.99 C ATOM 34874 O SER W 87 205.671 231.134 122.153 1.00999.99 O ATOM 34875 CB SER W 87 206.557 232.525 119.409 1.00999.99 C ATOM 34876 OG SER W 87 206.627 231.674 118.278 1.00999.99 O ATOM 34877 N ALA W 88 206.657 229.577 120.849 1.00999.99 N ATOM 34878 CA ALA W 88 205.970 228.463 121.497 1.00999.99 C ATOM 34879 C ALA W 88 206.427 228.290 122.940 1.00999.99 C ATOM 34880 O ALA W 88 205.598 228.113 123.842 1.00999.99 O ATOM 34881 CB ALA W 88 206.203 227.175 120.708 1.00999.99 C ATOM 34882 N VAL W 89 207.739 228.369 123.177 1.00999.99 N ATOM 34883 CA VAL W 89 208.273 228.238 124.530 1.00999.99 C ATOM 34884 C VAL W 89 207.882 229.442 125.379 1.00999.99 C ATOM 34885 O VAL W 89 207.583 229.303 126.573 1.00999.99 O ATOM 34886 CB VAL W 89 209.800 228.046 124.483 1.00999.99 C ATOM 34887 CG1 VAL W 89 210.319 227.542 125.822 1.00999.99 C ATOM 34888 CG2 VAL W 89 210.181 227.088 123.363 1.00999.99 C ATOM 34889 N MET W 90 207.845 230.635 124.773 1.00999.99 N ATOM 34890 CA MET W 90 207.445 231.830 125.512 1.00999.99 C ATOM 34891 C MET W 90 205.964 231.795 125.884 1.00999.99 C ATOM 34892 O MET W 90 205.593 232.179 127.000 1.00999.99 O ATOM 34893 CB MET W 90 207.766 233.084 124.699 1.00999.99 C ATOM 34894 CG MET W 90 209.248 233.422 124.639 1.00999.99 C ATOM 34895 SD MET W 90 210.044 233.363 126.255 1.00999.99 S ATOM 34896 CE MET W 90 209.371 234.838 127.013 1.00999.99 C ATOM 34897 N ALA W 91 205.109 231.314 124.974 1.00999.99 N ATOM 34898 CA ALA W 91 203.686 231.196 125.277 1.00999.99 C ATOM 34899 C ALA W 91 203.427 230.105 126.308 1.00999.99 C ATOM 34900 O ALA W 91 202.553 230.261 127.172 1.00999.99 O ATOM 34901 CB ALA W 91 202.898 230.923 123.996 1.00999.99 C ATOM 34902 N LEU W 92 204.186 229.001 126.235 1.00999.99 N ATOM 34903 CA LEU W 92 204.113 227.953 127.249 1.00999.99 C ATOM 34904 C LEU W 92 204.494 228.484 128.624 1.00999.99 C ATOM 34905 O LEU W 92 203.791 228.231 129.610 1.00999.99 O ATOM 34906 CB LEU W 92 205.030 226.791 126.863 1.00999.99 C ATOM 34907 CG LEU W 92 204.479 225.680 125.971 1.00999.99 C ATOM 34908 CD1 LEU W 92 205.616 224.893 125.341 1.00999.99 C ATOM 34909 CD2 LEU W 92 203.580 224.762 126.773 1.00999.99 C ATOM 34910 N GLN W 93 205.583 229.257 128.696 1.00999.99 N ATOM 34911 CA GLN W 93 206.040 229.814 129.966 1.00999.99 C ATOM 34912 C GLN W 93 205.054 230.838 130.519 1.00999.99 C ATOM 34913 O GLN W 93 204.779 230.846 131.724 1.00999.99 O ATOM 34914 CB GLN W 93 207.425 230.436 129.783 1.00999.99 C ATOM 34915 CG GLN W 93 208.060 230.960 131.056 1.00999.99 C ATOM 34916 CD GLN W 93 209.478 231.446 130.832 1.00999.99 C ATOM 34917 OE1 GLN W 93 210.008 231.362 129.724 1.00999.99 O ATOM 34918 NE2 GLN W 93 210.096 231.970 131.882 1.00999.99 N ATOM 34919 N GLU W 94 204.482 231.679 129.648 1.00999.99 N ATOM 34920 CA GLU W 94 203.525 232.691 130.094 1.00999.99 C ATOM 34921 C GLU W 94 202.227 232.063 130.593 1.00999.99 C ATOM 34922 O GLU W 94 201.724 232.436 131.663 1.00999.99 O ATOM 34923 CB GLU W 94 203.238 233.673 128.959 1.00999.99 C ATOM 34924 CG GLU W 94 204.163 234.875 128.931 1.00999.99 C ATOM 34925 CD GLU W 94 203.656 236.019 129.784 1.00999.99 C ATOM 34926 OE1 GLU W 94 202.496 235.953 130.243 1.00999.99 O ATOM 34927 OE2 GLU W 94 204.418 236.984 129.998 1.00999.99 O ATOM 34928 N ALA W 95 201.678 231.100 129.842 1.00999.99 N ATOM 34929 CA ALA W 95 200.439 230.451 130.259 1.00999.99 C ATOM 34930 C ALA W 95 200.648 229.595 131.500 1.00999.99 C ATOM 34931 O ALA W 95 199.762 229.517 132.363 1.00999.99 O ATOM 34932 CB ALA W 95 199.880 229.607 129.118 1.00999.99 C ATOM 34933 N CYS W 96 201.823 228.972 131.629 1.00999.99 N ATOM 34934 CA CYS W 96 202.099 228.181 132.819 1.00999.99 C ATOM 34935 C CYS W 96 202.298 229.067 134.041 1.00999.99 C ATOM 34936 O CYS W 96 201.877 228.704 135.143 1.00999.99 O ATOM 34937 CB CYS W 96 203.332 227.301 132.602 1.00 30.00 C ATOM 34938 SG CYS W 96 203.131 226.036 131.328 1.00 30.00 S ATOM 34939 N GLU W 97 202.915 230.241 133.864 1.00999.99 N ATOM 34940 CA GLU W 97 203.048 231.178 134.974 1.00999.99 C ATOM 34941 C GLU W 97 201.696 231.752 135.381 1.00999.99 C ATOM 34942 O GLU W 97 201.456 231.996 136.567 1.00999.99 O ATOM 34943 CB GLU W 97 204.016 232.300 134.604 1.00999.99 C ATOM 34944 CG GLU W 97 205.479 231.953 134.814 1.00999.99 C ATOM 34945 CD GLU W 97 206.341 233.182 135.010 1.00999.99 C ATOM 34946 OE1 GLU W 97 205.789 234.244 135.368 1.00999.99 O ATOM 34947 OE2 GLU W 97 207.569 233.091 134.801 1.00999.99 O ATOM 34948 N ALA W 98 200.790 231.942 134.417 1.00999.99 N ATOM 34949 CA ALA W 98 199.450 232.420 134.753 1.00999.99 C ATOM 34950 C ALA W 98 198.643 231.355 135.490 1.00999.99 C ATOM 34951 O ALA W 98 197.939 231.663 136.463 1.00999.99 O ATOM 34952 CB ALA W 98 198.722 232.864 133.489 1.00999.99 C ATOM 34953 N TYR W 99 198.741 230.097 135.049 1.00999.99 N ATOM 34954 CA TYR W 99 198.073 229.007 135.756 1.00999.99 C ATOM 34955 C TYR W 99 198.664 228.806 137.149 1.00999.99 C ATOM 34956 O TYR W 99 197.927 228.550 138.111 1.00999.99 O ATOM 34957 CB TYR W 99 198.164 227.721 134.935 1.00999.99 C ATOM 34958 CG TYR W 99 197.812 226.471 135.707 1.00999.99 C ATOM 34959 CD1 TYR W 99 196.520 226.259 136.177 1.00999.99 C ATOM 34960 CD2 TYR W 99 198.775 225.503 135.969 1.00999.99 C ATOM 34961 CE1 TYR W 99 196.196 225.115 136.885 1.00999.99 C ATOM 34962 CE2 TYR W 99 198.461 224.357 136.676 1.00999.99 C ATOM 34963 CZ TYR W 99 197.172 224.169 137.132 1.00999.99 C ATOM 34964 OH TYR W 99 196.859 223.029 137.835 1.00999.99 O ATOM 34965 N LEU W 100 199.982 228.976 137.285 1.00999.99 N ATOM 34966 CA LEU W 100 200.618 228.835 138.590 1.00999.99 C ATOM 34967 C LEU W 100 200.262 229.990 139.517 1.00999.99 C ATOM 34968 O LEU W 100 200.089 229.782 140.720 1.00999.99 O ATOM 34969 CB LEU W 100 202.135 228.720 138.431 1.00999.99 C ATOM 34970 CG LEU W 100 202.668 227.330 138.070 1.00999.99 C ATOM 34971 CD1 LEU W 100 204.191 227.303 138.092 1.00999.99 C ATOM 34972 CD2 LEU W 100 202.091 226.267 138.995 1.00999.99 C ATOM 34973 N VAL W 101 200.122 231.209 138.984 1.00999.99 N ATOM 34974 CA VAL W 101 199.781 232.328 139.858 1.00999.99 C ATOM 34975 C VAL W 101 198.305 232.273 140.253 1.00999.99 C ATOM 34976 O VAL W 101 197.945 232.664 141.372 1.00999.99 O ATOM 34977 CB VAL W 101 200.195 233.676 139.216 1.00999.99 C ATOM 34978 CG1 VAL W 101 199.252 234.135 138.114 1.00999.99 C ATOM 34979 CG2 VAL W 101 200.311 234.752 140.270 1.00999.99 C ATOM 34980 N GLY W 102 197.444 231.706 139.395 1.00999.99 N ATOM 34981 CA GLY W 102 196.060 231.469 139.799 1.00999.99 C ATOM 34982 C GLY W 102 195.975 230.371 140.856 1.00999.99 C ATOM 34983 O GLY W 102 195.199 230.481 141.819 1.00999.99 O ATOM 34984 N LEU W 103 196.794 229.322 140.706 1.00999.99 N ATOM 34985 CA LEU W 103 196.838 228.256 141.703 1.00999.99 C ATOM 34986 C LEU W 103 197.399 228.752 143.031 1.00999.99 C ATOM 34987 O LEU W 103 196.920 228.349 144.094 1.00999.99 O ATOM 34988 CB LEU W 103 197.664 227.082 141.180 1.00999.99 C ATOM 34989 CG LEU W 103 197.649 225.815 142.039 1.00999.99 C ATOM 34990 CD1 LEU W 103 196.223 225.373 142.346 1.00999.99 C ATOM 34991 CD2 LEU W 103 198.429 224.701 141.369 1.00999.99 C ATOM 34992 N PHE W 104 198.391 229.647 142.995 1.00999.99 N ATOM 34993 CA PHE W 104 198.924 230.207 144.235 1.00999.99 C ATOM 34994 C PHE W 104 197.947 231.175 144.887 1.00999.99 C ATOM 34995 O PHE W 104 197.909 231.265 146.119 1.00999.99 O ATOM 34996 CB PHE W 104 200.264 230.909 143.994 1.00999.99 C ATOM 34997 CG PHE W 104 201.452 229.986 144.002 1.00999.99 C ATOM 34998 CD1 PHE W 104 201.724 229.196 145.110 1.00999.99 C ATOM 34999 CD2 PHE W 104 202.330 229.950 142.929 1.00999.99 C ATOM 35000 CE1 PHE W 104 202.825 228.354 145.128 1.00999.99 C ATOM 35001 CE2 PHE W 104 203.433 229.113 142.939 1.00999.99 C ATOM 35002 CZ PHE W 104 203.681 228.316 144.042 1.00999.99 C ATOM 35003 N GLU W 105 197.147 231.894 144.089 1.00999.99 N ATOM 35004 CA GLU W 105 196.100 232.743 144.654 1.00999.99 C ATOM 35005 C GLU W 105 195.045 231.909 145.374 1.00999.99 C ATOM 35006 O GLU W 105 194.659 232.218 146.510 1.00999.99 O ATOM 35007 CB GLU W 105 195.455 233.586 143.553 1.00999.99 C ATOM 35008 CG GLU W 105 196.176 234.886 143.251 1.00999.99 C ATOM 35009 CD GLU W 105 195.449 235.718 142.212 1.00999.99 C ATOM 35010 OE1 GLU W 105 194.419 235.245 141.687 1.00999.99 O ATOM 35011 OE2 GLU W 105 195.906 236.843 141.921 1.00999.99 O ATOM 35012 N ASP W 106 194.587 230.826 144.734 1.00999.99 N ATOM 35013 CA ASP W 106 193.616 229.949 145.385 1.00999.99 C ATOM 35014 C ASP W 106 194.229 229.194 146.563 1.00999.99 C ATOM 35015 O ASP W 106 193.534 228.920 147.549 1.00999.99 O ATOM 35016 CB ASP W 106 193.024 228.975 144.368 1.00999.99 C ATOM 35017 CG ASP W 106 191.818 229.550 143.651 1.00999.99 C ATOM 35018 OD1 ASP W 106 191.476 230.724 143.908 1.00999.99 O ATOM 35019 OD2 ASP W 106 191.207 228.829 142.837 1.00999.99 O ATOM 35020 N THR W 107 195.530 228.900 146.501 1.00999.99 N ATOM 35021 CA THR W 107 196.223 228.241 147.602 1.00999.99 C ATOM 35022 C THR W 107 196.336 229.160 148.815 1.00999.99 C ATOM 35023 O THR W 107 196.092 228.732 149.950 1.00999.99 O ATOM 35024 CB THR W 107 197.605 227.784 147.123 1.00999.99 C ATOM 35025 OG1 THR W 107 197.453 226.755 146.136 1.00999.99 O ATOM 35026 CG2 THR W 107 198.449 227.254 148.266 1.00999.99 C ATOM 35027 N ASN W 108 196.674 230.434 148.591 1.00999.99 N ATOM 35028 CA ASN W 108 196.717 231.398 149.685 1.00999.99 C ATOM 35029 C ASN W 108 195.330 231.676 150.248 1.00999.99 C ATOM 35030 O ASN W 108 195.189 231.876 151.460 1.00999.99 O ATOM 35031 CB ASN W 108 197.369 232.699 149.218 1.00999.99 C ATOM 35032 CG ASN W 108 197.745 233.605 150.373 1.00999.99 C ATOM 35033 OD1 ASN W 108 197.951 233.144 151.496 1.00999.99 O ATOM 35034 ND2 ASN W 108 197.830 234.901 150.104 1.00999.99 N ATOM 35035 N LEU W 109 194.297 231.672 149.396 1.00999.99 N ATOM 35036 CA LEU W 109 192.930 231.828 149.890 1.00999.99 C ATOM 35037 C LEU W 109 192.508 230.634 150.742 1.00999.99 C ATOM 35038 O LEU W 109 191.835 230.800 151.768 1.00999.99 O ATOM 35039 CB LEU W 109 191.970 232.019 148.717 1.00999.99 C ATOM 35040 CG LEU W 109 191.901 233.424 148.116 1.00999.99 C ATOM 35041 CD1 LEU W 109 191.161 233.402 146.789 1.00999.99 C ATOM 35042 CD2 LEU W 109 191.239 234.390 149.086 1.00999.99 C ATOM 35043 N CYS W 110 192.918 229.425 150.345 1.00999.99 N ATOM 35044 CA CYS W 110 192.642 228.238 151.147 1.00999.99 C ATOM 35045 C CYS W 110 193.424 228.245 152.455 1.00999.99 C ATOM 35046 O CYS W 110 192.937 227.735 153.470 1.00999.99 O ATOM 35047 CB CYS W 110 192.981 226.982 150.347 1.00999.99 C ATOM 35048 SG CYS W 110 191.714 226.445 149.193 1.00999.99 S ATOM 35049 N ALA W 111 194.636 228.807 152.446 1.00999.99 N ATOM 35050 CA ALA W 111 195.439 228.874 153.663 1.00999.99 C ATOM 35051 C ALA W 111 194.873 229.890 154.647 1.00999.99 C ATOM 35052 O ALA W 111 194.886 229.656 155.861 1.00999.99 O ATOM 35053 CB ALA W 111 196.888 229.211 153.318 1.00999.99 C ATOM 35054 N ILE W 112 194.386 231.028 154.143 1.00999.99 N ATOM 35055 CA ILE W 112 193.699 231.997 154.997 1.00999.99 C ATOM 35056 C ILE W 112 192.393 231.406 155.518 1.00999.99 C ATOM 35057 O ILE W 112 192.007 231.626 156.675 1.00999.99 O ATOM 35058 CB ILE W 112 193.479 233.315 154.225 1.00999.99 C ATOM 35059 CG1 ILE W 112 194.823 233.973 153.924 1.00999.99 C ATOM 35060 CG2 ILE W 112 192.605 234.299 154.995 1.00999.99 C ATOM 35061 CD1 ILE W 112 194.719 235.154 153.001 1.00999.99 C ATOM 35062 N HIS W 113 191.724 230.599 154.690 1.00999.99 N ATOM 35063 CA HIS W 113 190.501 229.925 155.110 1.00999.99 C ATOM 35064 C HIS W 113 190.758 228.875 156.187 1.00999.99 C ATOM 35065 O HIS W 113 189.868 228.593 156.996 1.00999.99 O ATOM 35066 CB HIS W 113 189.837 229.279 153.900 1.00999.99 C ATOM 35067 CG HIS W 113 188.481 228.715 154.181 1.00999.99 C ATOM 35068 ND1 HIS W 113 187.332 229.470 154.099 1.00999.99 N ATOM 35069 CD2 HIS W 113 188.091 227.471 154.545 1.00999.99 C ATOM 35070 CE1 HIS W 113 186.292 228.714 154.399 1.00999.99 C ATOM 35071 NE2 HIS W 113 186.724 227.497 154.674 1.00999.99 N ATOM 35072 N ALA W 114 191.965 228.307 156.230 1.00999.99 N ATOM 35073 CA ALA W 114 192.301 227.231 157.155 1.00999.99 C ATOM 35074 C ALA W 114 192.861 227.736 158.479 1.00999.99 C ATOM 35075 O ALA W 114 193.625 227.005 159.131 1.00999.99 O ATOM 35076 CB ALA W 114 193.292 226.270 156.497 1.00999.99 C