>>6L49:HELIX   52 AF7 SER N   52  ASN N   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 52 AF7 SER N 52 ASN N 81 1 30 ATOM 27940 N SER N 52 224.939 190.335 130.481 1.00999.99 N ATOM 27941 CA SER N 52 226.193 189.611 130.622 1.00999.99 C ATOM 27942 C SER N 52 226.175 188.355 129.759 1.00999.99 C ATOM 27943 O SER N 52 225.122 187.907 129.300 1.00999.99 O ATOM 27944 CB SER N 52 226.448 189.240 132.086 1.00999.99 C ATOM 27945 OG SER N 52 226.591 190.400 132.887 1.00999.99 O ATOM 27946 N SER N 53 227.367 187.788 129.546 1.00999.99 N ATOM 27947 CA SER N 53 227.492 186.603 128.700 1.00999.99 C ATOM 27948 C SER N 53 226.902 185.366 129.365 1.00999.99 C ATOM 27949 O SER N 53 226.305 184.521 128.682 1.00999.99 O ATOM 27950 CB SER N 53 228.960 186.365 128.345 1.00999.99 C ATOM 27951 OG SER N 53 229.483 187.442 127.586 1.00999.99 O ATOM 27952 N LYS N 54 227.060 185.241 130.687 1.00999.99 N ATOM 27953 CA LYS N 54 226.406 184.160 131.418 1.00999.99 C ATOM 27954 C LYS N 54 224.893 184.322 131.409 1.00999.99 C ATOM 27955 O LYS N 54 224.164 183.324 131.409 1.00999.99 O ATOM 27956 CB LYS N 54 226.926 184.104 132.855 1.00999.99 C ATOM 27957 CG LYS N 54 228.332 183.543 132.989 1.00999.99 C ATOM 27958 CD LYS N 54 228.703 183.331 134.448 1.00999.99 C ATOM 27959 CE LYS N 54 230.055 182.648 134.582 1.00999.99 C ATOM 27960 NZ LYS N 54 230.400 182.373 136.004 1.00999.99 N ATOM 27961 N ALA N 55 224.405 185.564 131.399 1.00999.99 N ATOM 27962 CA ALA N 55 222.983 185.796 131.183 1.00999.99 C ATOM 27963 C ALA N 55 222.606 185.601 129.720 1.00999.99 C ATOM 27964 O ALA N 55 221.468 185.222 129.421 1.00999.99 O ATOM 27965 CB ALA N 55 222.601 187.200 131.650 1.00999.99 C ATOM 27966 N MET N 56 223.549 185.839 128.801 1.00999.99 N ATOM 27967 CA MET N 56 223.258 185.698 127.377 1.00999.99 C ATOM 27968 C MET N 56 223.079 184.236 126.987 1.00999.99 C ATOM 27969 O MET N 56 222.250 183.918 126.126 1.00999.99 O ATOM 27970 CB MET N 56 224.367 186.341 126.543 1.00999.99 C ATOM 27971 CG MET N 56 224.021 186.525 125.074 1.00999.99 C ATOM 27972 SD MET N 56 222.644 187.661 124.823 1.00999.99 S ATOM 27973 CE MET N 56 221.374 186.528 124.265 1.00999.99 C ATOM 27974 N GLY N 57 223.841 183.335 127.616 1.00999.99 N ATOM 27975 CA GLY N 57 223.655 181.906 127.370 1.00999.99 C ATOM 27976 C GLY N 57 222.291 181.432 127.862 1.00999.99 C ATOM 27977 O GLY N 57 221.625 180.633 127.190 1.00999.99 O ATOM 27978 N ILE N 58 221.845 181.950 129.011 1.00999.99 N ATOM 27979 CA ILE N 58 220.531 181.605 129.547 1.00999.99 C ATOM 27980 C ILE N 58 219.424 182.163 128.658 1.00999.99 C ATOM 27981 O ILE N 58 218.418 181.489 128.403 1.00999.99 O ATOM 27982 CB ILE N 58 220.414 182.105 131.001 1.00999.99 C ATOM 27983 CG1 ILE N 58 221.479 181.439 131.873 1.00999.99 C ATOM 27984 CG2 ILE N 58 219.031 181.835 131.579 1.00999.99 C ATOM 27985 CD1 ILE N 58 221.580 182.021 133.260 1.00999.99 C ATOM 27986 N MET N 59 219.611 183.381 128.137 1.00999.99 N ATOM 27987 CA MET N 59 218.614 183.977 127.250 1.00999.99 C ATOM 27988 C MET N 59 218.530 183.238 125.917 1.00999.99 C ATOM 27989 O MET N 59 217.430 183.031 125.386 1.00999.99 O ATOM 27990 CB MET N 59 218.931 185.455 127.020 1.00999.99 C ATOM 27991 CG MET N 59 218.628 186.347 128.211 1.00999.99 C ATOM 27992 SD MET N 59 216.948 186.137 128.820 1.00999.99 S ATOM 27993 CE MET N 59 216.021 186.694 127.397 1.00999.99 C ATOM 27994 N ASN N 60 219.677 182.814 125.375 1.00999.99 N ATOM 27995 CA ASN N 60 219.676 182.054 124.128 1.00999.99 C ATOM 27996 C ASN N 60 219.064 180.672 124.322 1.00999.99 C ATOM 27997 O ASN N 60 218.333 180.186 123.448 1.00999.99 O ATOM 27998 CB ASN N 60 221.099 181.941 123.582 1.00999.99 C ATOM 27999 CG ASN N 60 221.145 181.326 122.197 1.00999.99 C ATOM 28000 OD1 ASN N 60 220.761 181.957 121.212 1.00999.99 O ATOM 28001 ND2 ASN N 60 221.618 180.088 122.115 1.00999.99 N ATOM 28002 N SER N 61 219.326 180.038 125.472 1.00999.99 N ATOM 28003 CA SER N 61 218.706 178.751 125.771 1.00999.99 C ATOM 28004 C SER N 61 217.201 178.891 125.971 1.00999.99 C ATOM 28005 O SER N 61 216.435 178.012 125.563 1.00999.99 O ATOM 28006 CB SER N 61 219.358 178.130 127.006 1.00999.99 C ATOM 28007 OG SER N 61 220.769 178.245 126.948 1.00999.99 O ATOM 28008 N PHE N 62 216.761 180.007 126.563 1.00999.99 N ATOM 28009 CA PHE N 62 215.333 180.265 126.737 1.00999.99 C ATOM 28010 C PHE N 62 214.639 180.476 125.396 1.00999.99 C ATOM 28011 O PHE N 62 213.555 179.922 125.159 1.00999.99 O ATOM 28012 CB PHE N 62 215.145 181.482 127.648 1.00999.99 C ATOM 28013 CG PHE N 62 213.770 182.090 127.591 1.00999.99 C ATOM 28014 CD1 PHE N 62 212.689 181.450 128.179 1.00999.99 C ATOM 28015 CD2 PHE N 62 213.565 183.317 126.972 1.00999.99 C ATOM 28016 CE1 PHE N 62 211.424 182.014 128.138 1.00999.99 C ATOM 28017 CE2 PHE N 62 212.303 183.884 126.924 1.00999.99 C ATOM 28018 CZ PHE N 62 211.231 183.232 127.508 1.00999.99 C ATOM 28019 N VAL N 63 215.265 181.254 124.505 1.00999.99 N ATOM 28020 CA VAL N 63 214.704 181.509 123.179 1.00999.99 C ATOM 28021 C VAL N 63 214.639 180.220 122.365 1.00999.99 C ATOM 28022 O VAL N 63 213.613 179.917 121.739 1.00999.99 O ATOM 28023 CB VAL N 63 215.520 182.607 122.465 1.00999.99 C ATOM 28024 CG1 VAL N 63 215.249 182.624 120.965 1.00999.99 C ATOM 28025 CG2 VAL N 63 215.214 183.969 123.071 1.00999.99 C ATOM 28026 N ASN N 64 215.705 179.410 122.416 1.00999.99 N ATOM 28027 CA ASN N 64 215.721 178.147 121.683 1.00999.99 C ATOM 28028 C ASN N 64 214.737 177.133 122.258 1.00999.99 C ATOM 28029 O ASN N 64 214.121 176.378 121.497 1.00999.99 O ATOM 28030 CB ASN N 64 217.134 177.565 121.673 1.00999.99 C ATOM 28031 CG ASN N 64 218.051 178.283 120.702 1.00999.99 C ATOM 28032 OD1 ASN N 64 218.148 177.912 119.532 1.00999.99 O ATOM 28033 ND2 ASN N 64 218.728 179.319 121.183 1.00999.99 N ATOM 28034 N ASP N 65 214.544 177.123 123.581 1.00999.99 N ATOM 28035 CA ASP N 65 213.599 176.190 124.188 1.00999.99 C ATOM 28036 C ASP N 65 212.158 176.561 123.858 1.00999.99 C ATOM 28037 O ASP N 65 211.341 175.679 123.563 1.00999.99 O ATOM 28038 CB ASP N 65 213.809 176.142 125.701 1.00999.99 C ATOM 28039 CG ASP N 65 212.763 175.303 126.408 1.00999.99 C ATOM 28040 OD1 ASP N 65 212.806 174.062 126.278 1.00999.99 O ATOM 28041 OD2 ASP N 65 211.897 175.886 127.094 1.00999.99 O ATOM 28042 N ILE N 66 211.832 177.859 123.882 1.00999.99 N ATOM 28043 CA ILE N 66 210.481 178.284 123.516 1.00999.99 C ATOM 28044 C ILE N 66 210.236 178.059 122.024 1.00999.99 C ATOM 28045 O ILE N 66 209.140 177.642 121.621 1.00999.99 O ATOM 28046 CB ILE N 66 210.259 179.766 123.876 1.00 30.00 C ATOM 28047 CG1 ILE N 66 210.286 179.955 125.394 1.00 30.00 C ATOM 28048 CG2 ILE N 66 208.945 180.264 123.295 1.00 30.00 C ATOM 28049 CD1 ILE N 66 210.339 181.403 125.826 1.00 30.00 C ATOM 28050 N PHE N 67 211.268 178.265 121.194 1.00999.99 N ATOM 28051 CA PHE N 67 211.165 177.992 119.760 1.00999.99 C ATOM 28052 C PHE N 67 210.916 176.510 119.492 1.00999.99 C ATOM 28053 O PHE N 67 210.054 176.154 118.679 1.00999.99 O ATOM 28054 CB PHE N 67 212.439 178.479 119.055 1.00999.99 C ATOM 28055 CG PHE N 67 212.841 177.663 117.847 1.00999.99 C ATOM 28056 CD1 PHE N 67 212.168 177.795 116.638 1.00999.99 C ATOM 28057 CD2 PHE N 67 213.918 176.787 117.916 1.00999.99 C ATOM 28058 CE1 PHE N 67 212.543 177.052 115.531 1.00999.99 C ATOM 28059 CE2 PHE N 67 214.298 176.041 116.812 1.00999.99 C ATOM 28060 CZ PHE N 67 213.611 176.175 115.619 1.00999.99 C ATOM 28061 N GLU N 68 211.643 175.633 120.193 1.00999.99 N ATOM 28062 CA GLU N 68 211.464 174.195 120.010 1.00999.99 C ATOM 28063 C GLU N 68 210.106 173.728 120.522 1.00999.99 C ATOM 28064 O GLU N 68 209.473 172.867 119.902 1.00999.99 O ATOM 28065 CB GLU N 68 212.590 173.434 120.708 1.00999.99 C ATOM 28066 CG GLU N 68 213.897 173.405 119.933 1.00999.99 C ATOM 28067 CD GLU N 68 214.980 172.623 120.649 1.00999.99 C ATOM 28068 OE1 GLU N 68 214.708 172.099 121.749 1.00999.99 O ATOM 28069 OE2 GLU N 68 216.104 172.532 120.112 1.00999.99 O ATOM 28070 N ARG N 69 209.629 174.309 121.630 1.00999.99 N ATOM 28071 CA ARG N 69 208.324 173.930 122.169 1.00999.99 C ATOM 28072 C ARG N 69 207.187 174.368 121.251 1.00999.99 C ATOM 28073 O ARG N 69 206.251 173.595 121.005 1.00999.99 O ATOM 28074 CB ARG N 69 208.142 174.524 123.564 1.00999.99 C ATOM 28075 CG ARG N 69 208.742 173.689 124.682 1.00999.99 C ATOM 28076 CD ARG N 69 208.215 174.133 126.036 1.00999.99 C ATOM 28077 NE ARG N 69 208.817 175.390 126.469 1.00999.99 N ATOM 28078 CZ ARG N 69 208.575 175.968 127.641 1.00999.99 C ATOM 28079 NH1 ARG N 69 207.740 175.403 128.502 1.00999.99 N ATOM 28080 NH2 ARG N 69 209.168 177.113 127.952 1.00999.99 N ATOM 28081 N ILE N 70 207.260 175.595 120.722 1.00999.99 N ATOM 28082 CA ILE N 70 206.226 176.085 119.813 1.00999.99 C ATOM 28083 C ILE N 70 206.264 175.323 118.490 1.00999.99 C ATOM 28084 O ILE N 70 205.210 174.981 117.935 1.00999.99 O ATOM 28085 CB ILE N 70 206.378 177.610 119.627 1.00999.99 C ATOM 28086 CG1 ILE N 70 206.015 178.338 120.923 1.00999.99 C ATOM 28087 CG2 ILE N 70 205.501 178.139 118.496 1.00999.99 C ATOM 28088 CD1 ILE N 70 206.147 179.846 120.844 1.00999.99 C ATOM 28089 N ALA N 71 207.464 174.983 117.999 1.00999.99 N ATOM 28090 CA ALA N 71 207.578 174.202 116.770 1.00999.99 C ATOM 28091 C ALA N 71 207.051 172.782 116.953 1.00999.99 C ATOM 28092 O ALA N 71 206.383 172.246 116.060 1.00999.99 O ATOM 28093 CB ALA N 71 209.031 174.181 116.298 1.00999.99 C ATOM 28094 N GLY N 72 207.306 172.171 118.114 1.00999.99 N ATOM 28095 CA GLY N 72 206.779 170.840 118.369 1.00999.99 C ATOM 28096 C GLY N 72 205.273 170.828 118.554 1.00999.99 C ATOM 28097 O GLY N 72 204.593 169.899 118.106 1.00999.99 O ATOM 28098 N GLU N 73 204.729 171.869 119.196 1.00999.99 N ATOM 28099 CA GLU N 73 203.280 171.972 119.343 1.00999.99 C ATOM 28100 C GLU N 73 202.601 172.211 118.000 1.00999.99 C ATOM 28101 O GLU N 73 201.530 171.653 117.733 1.00999.99 O ATOM 28102 CB GLU N 73 202.929 173.085 120.330 1.00999.99 C ATOM 28103 CG GLU N 73 202.943 172.638 121.780 1.00999.99 C ATOM 28104 CD GLU N 73 201.723 171.817 122.148 1.00999.99 C ATOM 28105 OE1 GLU N 73 200.675 171.971 121.487 1.00999.99 O ATOM 28106 OE2 GLU N 73 201.818 171.005 123.092 1.00999.99 O ATOM 28107 N ALA N 74 203.225 173.014 117.132 1.00999.99 N ATOM 28108 CA ALA N 74 202.680 173.235 115.796 1.00999.99 C ATOM 28109 C ALA N 74 202.775 171.977 114.941 1.00999.99 C ATOM 28110 O ALA N 74 201.874 171.699 114.141 1.00999.99 O ATOM 28111 CB ALA N 74 203.402 174.399 115.121 1.00999.99 C ATOM 28112 N SER N 75 203.846 171.194 115.112 1.00999.99 N ATOM 28113 CA SER N 75 203.969 169.927 114.394 1.00999.99 C ATOM 28114 C SER N 75 202.920 168.923 114.856 1.00999.99 C ATOM 28115 O SER N 75 202.330 168.210 114.033 1.00999.99 O ATOM 28116 CB SER N 75 205.371 169.351 114.586 1.00999.99 C ATOM 28117 OG SER N 75 206.352 170.216 114.050 1.00999.99 O ATOM 28118 N ARG N 76 202.657 168.872 116.165 1.00999.99 N ATOM 28119 CA ARG N 76 201.636 167.966 116.682 1.00999.99 C ATOM 28120 C ARG N 76 200.237 168.403 116.258 1.00999.99 C ATOM 28121 O ARG N 76 199.383 167.561 115.958 1.00999.99 O ATOM 28122 CB ARG N 76 201.740 167.878 118.204 1.00999.99 C ATOM 28123 CG ARG N 76 201.337 166.529 118.776 1.00999.99 C ATOM 28124 CD ARG N 76 201.448 166.510 120.291 1.00999.99 C ATOM 28125 NE ARG N 76 202.833 166.387 120.736 1.00999.99 N ATOM 28126 CZ ARG N 76 203.541 167.384 121.257 1.00999.99 C ATOM 28127 NH1 ARG N 76 202.994 168.583 121.400 1.00999.99 N ATOM 28128 NH2 ARG N 76 204.796 167.183 121.635 1.00999.99 N ATOM 28129 N LEU N 77 199.992 169.717 116.201 1.00999.99 N ATOM 28130 CA LEU N 77 198.688 170.209 115.763 1.00999.99 C ATOM 28131 C LEU N 77 198.497 170.033 114.261 1.00999.99 C ATOM 28132 O LEU N 77 197.364 169.878 113.790 1.00999.99 O ATOM 28133 CB LEU N 77 198.525 171.675 116.160 1.00999.99 C ATOM 28134 CG LEU N 77 198.127 171.914 117.615 1.00999.99 C ATOM 28135 CD1 LEU N 77 198.542 173.299 118.056 1.00999.99 C ATOM 28136 CD2 LEU N 77 196.629 171.731 117.780 1.00999.99 C ATOM 28137 N ALA N 78 199.587 170.062 113.490 1.00999.99 N ATOM 28138 CA ALA N 78 199.482 169.779 112.063 1.00999.99 C ATOM 28139 C ALA N 78 199.266 168.292 111.814 1.00999.99 C ATOM 28140 O ALA N 78 198.543 167.911 110.886 1.00999.99 O ATOM 28141 CB ALA N 78 200.731 170.273 111.334 1.00999.99 C ATOM 28142 N HIS N 79 199.885 167.436 112.633 1.00999.99 N ATOM 28143 CA HIS N 79 199.677 166.000 112.486 1.00999.99 C ATOM 28144 C HIS N 79 198.301 165.572 112.981 1.00999.99 C ATOM 28145 O HIS N 79 197.763 164.563 112.511 1.00999.99 O ATOM 28146 CB HIS N 79 200.773 165.234 113.228 1.00999.99 C ATOM 28147 CG HIS N 79 201.989 164.967 112.397 1.00999.99 C ATOM 28148 ND1 HIS N 79 202.010 164.021 111.394 1.00999.99 N ATOM 28149 CD2 HIS N 79 203.224 165.522 112.416 1.00999.99 C ATOM 28150 CE1 HIS N 79 203.205 164.005 110.832 1.00999.99 C ATOM 28151 NE2 HIS N 79 203.961 164.905 111.435 1.00999.99 N ATOM 28152 N TYR N 80 197.713 166.320 113.918 1.00999.99 N ATOM 28153 CA TYR N 80 196.401 165.953 114.442 1.00999.99 C ATOM 28154 C TYR N 80 195.273 166.409 113.523 1.00999.99 C ATOM 28155 O TYR N 80 194.237 165.741 113.431 1.00999.99 O ATOM 28156 CB TYR N 80 196.210 166.538 115.842 1.00999.99 C ATOM 28157 CG TYR N 80 196.965 165.810 116.934 1.00999.99 C ATOM 28158 CD1 TYR N 80 197.500 164.544 116.716 1.00999.99 C ATOM 28159 CD2 TYR N 80 197.143 166.392 118.185 1.00999.99 C ATOM 28160 CE1 TYR N 80 198.192 163.879 117.713 1.00999.99 C ATOM 28161 CE2 TYR N 80 197.830 165.734 119.189 1.00999.99 C ATOM 28162 CZ TYR N 80 198.353 164.478 118.947 1.00999.99 C ATOM 28163 OH TYR N 80 199.039 163.820 119.942 1.00999.99 O ATOM 28164 N ASN N 81 195.450 167.538 112.840 1.00999.99 N ATOM 28165 CA ASN N 81 194.403 168.126 112.014 1.00999.99 C ATOM 28166 C ASN N 81 194.440 167.646 110.568 1.00999.99 C ATOM 28167 O ASN N 81 193.664 168.157 109.751 1.00999.99 O ATOM 28168 CB ASN N 81 194.500 169.653 112.054 1.00999.99 C ATOM 28169 CG ASN N 81 193.736 170.255 113.216 1.00999.99 C ATOM 28170 OD1 ASN N 81 192.701 170.893 113.029 1.00999.99 O ATOM 28171 ND2 ASN N 81 194.244 170.052 114.426 1.00999.99 N