>>6L49:HELIX   83 AJ2 SER V   52  ASN V   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 83 AJ2 SER V 52 ASN V 81 1 30 ATOM 33907 N SER V 52 201.325 248.440 120.857 1.00999.99 N ATOM 33908 CA SER V 52 202.462 247.556 120.663 1.00999.99 C ATOM 33909 C SER V 52 202.099 246.433 119.698 1.00999.99 C ATOM 33910 O SER V 52 200.925 246.169 119.427 1.00999.99 O ATOM 33911 CB SER V 52 202.929 246.977 121.999 1.00999.99 C ATOM 33912 OG SER V 52 202.978 247.981 122.998 1.00999.99 O ATOM 33913 N SER V 53 203.135 245.775 119.169 1.00999.99 N ATOM 33914 CA SER V 53 202.913 244.637 118.281 1.00999.99 C ATOM 33915 C SER V 53 202.364 243.436 119.039 1.00999.99 C ATOM 33916 O SER V 53 201.520 242.703 118.508 1.00999.99 O ATOM 33917 CB SER V 53 204.211 244.266 117.565 1.00999.99 C ATOM 33918 OG SER V 53 204.424 245.097 116.437 1.00999.99 O ATOM 33919 N LYS V 54 202.833 243.220 120.272 1.00999.99 N ATOM 33920 CA LYS V 54 202.222 242.215 121.135 1.00999.99 C ATOM 33921 C LYS V 54 200.791 242.599 121.480 1.00999.99 C ATOM 33922 O LYS V 54 199.892 241.748 121.482 1.00999.99 O ATOM 33923 CB LYS V 54 203.053 242.034 122.404 1.00999.99 C ATOM 33924 CG LYS V 54 204.545 241.909 122.155 1.00999.99 C ATOM 33925 CD LYS V 54 205.331 242.019 123.450 1.00999.99 C ATOM 33926 CE LYS V 54 206.827 242.018 123.188 1.00999.99 C ATOM 33927 NZ LYS V 54 207.607 242.256 124.433 1.00999.99 N ATOM 33928 N ALA V 55 200.558 243.889 121.742 1.00999.99 N ATOM 33929 CA ALA V 55 199.201 244.389 121.934 1.00999.99 C ATOM 33930 C ALA V 55 198.371 244.268 120.663 1.00999.99 C ATOM 33931 O ALA V 55 197.164 244.019 120.739 1.00999.99 O ATOM 33932 CB ALA V 55 199.241 245.842 122.406 1.00999.99 C ATOM 33933 N MET V 56 199.003 244.409 119.493 1.00999.99 N ATOM 33934 CA MET V 56 198.285 244.236 118.233 1.00999.99 C ATOM 33935 C MET V 56 197.864 242.785 118.030 1.00999.99 C ATOM 33936 O MET V 56 196.758 242.514 117.544 1.00999.99 O ATOM 33937 CB MET V 56 199.148 244.707 117.062 1.00999.99 C ATOM 33938 CG MET V 56 198.369 244.978 115.785 1.00999.99 C ATOM 33939 SD MET V 56 197.525 246.572 115.813 1.00999.99 S ATOM 33940 CE MET V 56 195.840 246.062 116.138 1.00999.99 C ATOM 33941 N GLY V 57 198.728 241.839 118.408 1.00999.99 N ATOM 33942 CA GLY V 57 198.355 240.430 118.324 1.00999.99 C ATOM 33943 C GLY V 57 197.287 240.081 119.354 1.00999.99 C ATOM 33944 O GLY V 57 196.424 239.236 119.090 1.00999.99 O ATOM 33945 N ILE V 58 197.319 240.738 120.522 1.00999.99 N ATOM 33946 CA ILE V 58 196.259 240.571 121.519 1.00999.99 C ATOM 33947 C ILE V 58 194.923 241.066 120.970 1.00999.99 C ATOM 33948 O ILE V 58 193.890 240.401 121.120 1.00999.99 O ATOM 33949 CB ILE V 58 196.639 241.290 122.831 1.00999.99 C ATOM 33950 CG1 ILE V 58 197.722 240.514 123.576 1.00999.99 C ATOM 33951 CG2 ILE V 58 195.438 241.450 123.755 1.00999.99 C ATOM 33952 CD1 ILE V 58 198.342 241.281 124.711 1.00999.99 C ATOM 33953 N MET V 59 194.933 242.217 120.288 1.00999.99 N ATOM 33954 CA MET V 59 193.705 242.764 119.715 1.00999.99 C ATOM 33955 C MET V 59 193.174 241.897 118.577 1.00999.99 C ATOM 33956 O MET V 59 191.959 241.676 118.474 1.00999.99 O ATOM 33957 CB MET V 59 193.943 244.192 119.225 1.00999.99 C ATOM 33958 CG MET V 59 194.174 245.209 120.329 1.00999.99 C ATOM 33959 SD MET V 59 193.345 244.773 121.864 1.00999.99 S ATOM 33960 CE MET V 59 191.704 245.390 121.531 1.00999.99 C ATOM 33961 N ASN V 60 194.070 241.385 117.726 1.00999.99 N ATOM 33962 CA ASN V 60 193.648 240.508 116.635 1.00999.99 C ATOM 33963 C ASN V 60 193.109 239.181 117.162 1.00999.99 C ATOM 33964 O ASN V 60 192.112 238.662 116.643 1.00999.99 O ATOM 33965 CB ASN V 60 194.812 240.273 115.673 1.00999.99 C ATOM 33966 CG ASN V 60 194.374 239.623 114.375 1.00999.99 C ATOM 33967 OD1 ASN V 60 193.710 240.247 113.548 1.00999.99 O ATOM 33968 ND2 ASN V 60 194.745 238.362 114.191 1.00999.99 N ATOM 33969 N SER V 61 193.737 238.636 118.210 1.00999.99 N ATOM 33970 CA SER V 61 193.250 237.406 118.824 1.00999.99 C ATOM 33971 C SER V 61 191.913 237.623 119.521 1.00999.99 C ATOM 33972 O SER V 61 191.046 236.743 119.488 1.00999.99 O ATOM 33973 CB SER V 61 194.289 236.871 119.808 1.00999.99 C ATOM 33974 OG SER V 61 194.384 237.707 120.948 1.00999.99 O ATOM 33975 N PHE V 62 191.722 238.797 120.135 1.00999.99 N ATOM 33976 CA PHE V 62 190.446 239.132 120.762 1.00999.99 C ATOM 33977 C PHE V 62 189.333 239.236 119.730 1.00999.99 C ATOM 33978 O PHE V 62 188.237 238.694 119.935 1.00999.99 O ATOM 33979 CB PHE V 62 190.581 240.445 121.537 1.00999.99 C ATOM 33980 CG PHE V 62 189.287 240.954 122.110 1.00999.99 C ATOM 33981 CD1 PHE V 62 188.696 240.319 123.192 1.00999.99 C ATOM 33982 CD2 PHE V 62 188.668 242.076 121.575 1.00999.99 C ATOM 33983 CE1 PHE V 62 187.507 240.787 123.726 1.00999.99 C ATOM 33984 CE2 PHE V 62 187.478 242.549 122.103 1.00999.99 C ATOM 33985 CZ PHE V 62 186.898 241.903 123.180 1.00999.99 C ATOM 33986 N VAL V 63 189.613 239.908 118.607 1.00999.99 N ATOM 33987 CA VAL V 63 188.636 240.057 117.532 1.00999.99 C ATOM 33988 C VAL V 63 188.275 238.698 116.936 1.00999.99 C ATOM 33989 O VAL V 63 187.089 238.374 116.774 1.00999.99 O ATOM 33990 CB VAL V 63 189.177 241.033 116.470 1.00999.99 C ATOM 33991 CG1 VAL V 63 188.437 240.886 115.148 1.00999.99 C ATOM 33992 CG2 VAL V 63 189.082 242.466 116.974 1.00999.99 C ATOM 33993 N ASN V 64 189.284 237.861 116.665 1.00999.99 N ATOM 33994 CA ASN V 64 189.027 236.554 116.064 1.00999.99 C ATOM 33995 C ASN V 64 188.305 235.617 117.030 1.00999.99 C ATOM 33996 O ASN V 64 187.412 234.868 116.616 1.00999.99 O ATOM 33997 CB ASN V 64 190.339 235.935 115.584 1.00999.99 C ATOM 33998 CG ASN V 64 190.860 236.585 114.314 1.00999.99 C ATOM 33999 OD1 ASN V 64 190.475 236.206 113.208 1.00999.99 O ATOM 34000 ND2 ASN V 64 191.737 237.570 114.468 1.00999.99 N ATOM 34001 N ASP V 65 188.633 235.685 118.326 1.00999.99 N ATOM 34002 CA ASP V 65 187.993 234.817 119.310 1.00999.99 C ATOM 34003 C ASP V 65 186.537 235.203 119.542 1.00999.99 C ATOM 34004 O ASP V 65 185.665 234.325 119.602 1.00999.99 O ATOM 34005 CB ASP V 65 188.777 234.853 120.622 1.00999.99 C ATOM 34006 CG ASP V 65 187.976 234.328 121.799 1.00999.99 C ATOM 34007 OD1 ASP V 65 187.747 233.102 121.871 1.00999.99 O ATOM 34008 OD2 ASP V 65 187.578 235.144 122.657 1.00999.99 O ATOM 34009 N ILE V 66 186.250 236.507 119.659 1.00999.99 N ATOM 34010 CA ILE V 66 184.869 236.952 119.847 1.00999.99 C ATOM 34011 C ILE V 66 184.038 236.663 118.600 1.00999.99 C ATOM 34012 O ILE V 66 182.888 236.204 118.699 1.00999.99 O ATOM 34013 CB ILE V 66 184.822 238.455 120.182 1.00 30.00 C ATOM 34014 CG1 ILE V 66 185.464 238.718 121.546 1.00 30.00 C ATOM 34015 CG2 ILE V 66 183.389 238.962 120.156 1.00 30.00 C ATOM 34016 CD1 ILE V 66 185.698 240.183 121.838 1.00 30.00 C ATOM 34017 N PHE V 67 184.629 236.862 117.411 1.00999.99 N ATOM 34018 CA PHE V 67 183.938 236.566 116.159 1.00999.99 C ATOM 34019 C PHE V 67 183.610 235.082 116.042 1.00999.99 C ATOM 34020 O PHE V 67 182.474 234.717 115.714 1.00999.99 O ATOM 34021 CB PHE V 67 184.792 237.033 114.976 1.00999.99 C ATOM 34022 CG PHE V 67 184.574 236.246 113.710 1.00999.99 C ATOM 34023 CD1 PHE V 67 183.419 236.417 112.955 1.00999.99 C ATOM 34024 CD2 PHE V 67 185.535 235.347 113.264 1.00999.99 C ATOM 34025 CE1 PHE V 67 183.220 235.690 111.794 1.00999.99 C ATOM 34026 CE2 PHE V 67 185.341 234.622 112.102 1.00999.99 C ATOM 34027 CZ PHE V 67 184.183 234.796 111.367 1.00999.99 C ATOM 34028 N GLU V 68 184.583 234.212 116.347 1.00999.99 N ATOM 34029 CA GLU V 68 184.360 232.772 116.252 1.00999.99 C ATOM 34030 C GLU V 68 183.346 232.291 117.285 1.00999.99 C ATOM 34031 O GLU V 68 182.493 231.450 116.972 1.00999.99 O ATOM 34032 CB GLU V 68 185.685 232.026 116.412 1.00999.99 C ATOM 34033 CG GLU V 68 186.540 231.999 115.153 1.00999.99 C ATOM 34034 CD GLU V 68 187.993 231.655 115.434 1.00999.99 C ATOM 34035 OE1 GLU V 68 188.344 231.444 116.614 1.00999.99 O ATOM 34036 OE2 GLU V 68 188.784 231.594 114.470 1.00999.99 O ATOM 34037 N ARG V 69 183.389 232.855 118.500 1.00999.99 N ATOM 34038 CA ARG V 69 182.464 232.448 119.555 1.00999.99 C ATOM 34039 C ARG V 69 181.027 232.836 119.225 1.00999.99 C ATOM 34040 O ARG V 69 180.116 232.000 119.311 1.00999.99 O ATOM 34041 CB ARG V 69 182.890 233.069 120.886 1.00999.99 C ATOM 34042 CG ARG V 69 183.795 232.194 121.730 1.00999.99 C ATOM 34043 CD ARG V 69 183.881 232.728 123.150 1.00999.99 C ATOM 34044 NE ARG V 69 184.515 234.042 123.203 1.00999.99 N ATOM 34045 CZ ARG V 69 184.710 234.731 124.322 1.00999.99 C ATOM 34046 NH1 ARG V 69 184.318 234.233 125.486 1.00999.99 N ATOM 34047 NH2 ARG V 69 185.297 235.919 124.278 1.00999.99 N ATOM 34048 N ILE V 70 180.806 234.092 118.818 1.00999.99 N ATOM 34049 CA ILE V 70 179.445 234.533 118.517 1.00999.99 C ATOM 34050 C ILE V 70 178.940 233.882 117.229 1.00999.99 C ATOM 34051 O ILE V 70 177.752 233.543 117.124 1.00999.99 O ATOM 34052 CB ILE V 70 179.384 236.076 118.467 1.00999.99 C ATOM 34053 CG1 ILE V 70 179.835 236.665 119.806 1.00999.99 C ATOM 34054 CG2 ILE V 70 177.969 236.578 118.176 1.00999.99 C ATOM 34055 CD1 ILE V 70 179.733 238.184 119.896 1.00999.99 C ATOM 34056 N ALA V 71 179.835 233.617 116.266 1.00999.99 N ATOM 34057 CA ALA V 71 179.421 232.975 115.022 1.00999.99 C ATOM 34058 C ALA V 71 179.017 231.523 115.247 1.00999.99 C ATOM 34059 O ALA V 71 177.997 231.071 114.713 1.00999.99 O ATOM 34060 CB ALA V 71 180.544 233.067 113.988 1.00999.99 C ATOM 34061 N GLY V 72 179.785 230.783 116.054 1.00999.99 N ATOM 34062 CA GLY V 72 179.398 229.422 116.385 1.00999.99 C ATOM 34063 C GLY V 72 178.156 229.345 117.249 1.00999.99 C ATOM 34064 O GLY V 72 177.339 228.429 117.084 1.00999.99 O ATOM 34065 N GLU V 73 177.984 230.311 118.163 1.00999.99 N ATOM 34066 CA GLU V 73 176.773 230.366 118.978 1.00999.99 C ATOM 34067 C GLU V 73 175.540 230.617 118.122 1.00999.99 C ATOM 34068 O GLU V 73 174.514 229.949 118.292 1.00999.99 O ATOM 34069 CB GLU V 73 176.910 231.450 120.045 1.00999.99 C ATOM 34070 CG GLU V 73 177.473 230.963 121.366 1.00999.99 C ATOM 34071 CD GLU V 73 176.431 230.286 122.238 1.00999.99 C ATOM 34072 OE1 GLU V 73 175.224 230.564 122.063 1.00999.99 O ATOM 34073 OE2 GLU V 73 176.821 229.486 123.114 1.00999.99 O ATOM 34074 N ALA V 74 175.633 231.550 117.169 1.00999.99 N ATOM 34075 CA ALA V 74 174.506 231.817 116.284 1.00999.99 C ATOM 34076 C ALA V 74 174.259 230.672 115.311 1.00999.99 C ATOM 34077 O ALA V 74 173.107 230.417 114.945 1.00999.99 O ATOM 34078 CB ALA V 74 174.737 233.112 115.519 1.00999.99 C ATOM 34079 N SER V 75 175.315 229.965 114.897 1.00999.99 N ATOM 34080 CA SER V 75 175.136 228.816 114.014 1.00999.99 C ATOM 34081 C SER V 75 174.445 227.668 114.733 1.00999.99 C ATOM 34082 O SER V 75 173.584 226.994 114.155 1.00999.99 O ATOM 34083 CB SER V 75 176.487 228.371 113.460 1.00999.99 C ATOM 34084 OG SER V 75 177.085 229.423 112.731 1.00999.99 O ATOM 34085 N ARG V 76 174.778 227.455 116.008 1.00999.99 N ATOM 34086 CA ARG V 76 174.087 226.428 116.778 1.00999.99 C ATOM 34087 C ARG V 76 172.662 226.860 117.119 1.00999.99 C ATOM 34088 O ARG V 76 171.760 226.019 117.209 1.00999.99 O ATOM 34089 CB ARG V 76 174.885 226.106 118.039 1.00999.99 C ATOM 34090 CG ARG V 76 174.589 224.742 118.625 1.00999.99 C ATOM 34091 CD ARG V 76 175.439 224.485 119.856 1.00999.99 C ATOM 34092 NE ARG V 76 176.870 224.544 119.564 1.00999.99 N ATOM 34093 CZ ARG V 76 177.707 225.429 120.100 1.00999.99 C ATOM 34094 NH1 ARG V 76 177.258 226.327 120.968 1.00999.99 N ATOM 34095 NH2 ARG V 76 178.993 225.416 119.776 1.00999.99 N ATOM 34096 N LEU V 77 172.442 228.167 117.304 1.00999.99 N ATOM 34097 CA LEU V 77 171.092 228.705 117.472 1.00999.99 C ATOM 34098 C LEU V 77 170.239 228.492 116.230 1.00999.99 C ATOM 34099 O LEU V 77 169.041 228.198 116.327 1.00999.99 O ATOM 34100 CB LEU V 77 171.175 230.191 117.807 1.00999.99 C ATOM 34101 CG LEU V 77 171.397 230.493 119.276 1.00999.99 C ATOM 34102 CD1 LEU V 77 172.048 231.842 119.431 1.00999.99 C ATOM 34103 CD2 LEU V 77 170.019 230.519 119.899 1.00999.99 C ATOM 34104 N ALA V 78 170.835 228.669 115.053 1.00999.99 N ATOM 34105 CA ALA V 78 170.113 228.420 113.812 1.00999.99 C ATOM 34106 C ALA V 78 169.867 226.929 113.610 1.00999.99 C ATOM 34107 O ALA V 78 168.791 226.528 113.152 1.00999.99 O ATOM 34108 CB ALA V 78 170.884 229.013 112.634 1.00999.99 C ATOM 34109 N HIS V 79 170.845 226.090 113.969 1.00999.99 N ATOM 34110 CA HIS V 79 170.686 224.646 113.818 1.00999.99 C ATOM 34111 C HIS V 79 169.672 224.075 114.802 1.00999.99 C ATOM 34112 O HIS V 79 169.047 223.046 114.518 1.00999.99 O ATOM 34113 CB HIS V 79 172.037 223.952 113.992 1.00999.99 C ATOM 34114 CG HIS V 79 172.838 223.860 112.731 1.00999.99 C ATOM 34115 ND1 HIS V 79 172.434 223.114 111.645 1.00999.99 N ATOM 34116 CD2 HIS V 79 174.020 224.421 112.382 1.00999.99 C ATOM 34117 CE1 HIS V 79 173.333 223.217 110.683 1.00999.99 C ATOM 34118 NE2 HIS V 79 174.306 224.006 111.104 1.00999.99 N ATOM 34119 N TYR V 80 169.497 224.719 115.957 1.00999.99 N ATOM 34120 CA TYR V 80 168.552 224.237 116.956 1.00999.99 C ATOM 34121 C TYR V 80 167.100 224.509 116.586 1.00999.99 C ATOM 34122 O TYR V 80 166.218 223.758 117.014 1.00999.99 O ATOM 34123 CB TYR V 80 168.859 224.867 118.316 1.00999.99 C ATOM 34124 CG TYR V 80 169.987 224.195 119.066 1.00999.99 C ATOM 34125 CD1 TYR V 80 170.338 222.876 118.798 1.00999.99 C ATOM 34126 CD2 TYR V 80 170.692 224.875 120.053 1.00999.99 C ATOM 34127 CE1 TYR V 80 171.366 222.255 119.486 1.00999.99 C ATOM 34128 CE2 TYR V 80 171.719 224.263 120.749 1.00999.99 C ATOM 34129 CZ TYR V 80 172.051 222.953 120.460 1.00999.99 C ATOM 34130 OH TYR V 80 173.073 222.340 121.148 1.00999.99 O ATOM 34131 N ASN V 81 166.830 225.557 115.812 1.00999.99 N ATOM 34132 CA ASN V 81 165.469 225.923 115.450 1.00999.99 C ATOM 34133 C ASN V 81 165.083 225.468 114.049 1.00999.99 C ATOM 34134 O ASN V 81 164.128 226.015 113.484 1.00999.99 O ATOM 34135 CB ASN V 81 165.282 227.436 115.575 1.00999.99 C ATOM 34136 CG ASN V 81 165.443 227.920 116.999 1.00999.99 C ATOM 34137 OD1 ASN V 81 165.045 227.242 117.945 1.00999.99 O ATOM 34138 ND2 ASN V 81 166.030 229.097 117.160 1.00999.99 N