>>6L49:HELIX   99 AK9 SER Z   52  ASN Z   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 99 AK9 SER Z 52 ASN Z 81 1 30 ATOM 36875 N SER Z 52 165.567 201.276 130.674 1.00999.99 N ATOM 36876 CA SER Z 52 164.394 202.127 130.811 1.00999.99 C ATOM 36877 C SER Z 52 164.346 203.178 129.705 1.00999.99 C ATOM 36878 O SER Z 52 165.329 203.428 129.004 1.00999.99 O ATOM 36879 CB SER Z 52 164.378 202.810 132.179 1.00999.99 C ATOM 36880 OG SER Z 52 164.693 201.893 133.212 1.00999.99 O ATOM 36881 N SER Z 53 163.171 203.803 129.561 1.00999.99 N ATOM 36882 CA SER Z 53 162.996 204.826 128.533 1.00999.99 C ATOM 36883 C SER Z 53 163.664 206.136 128.931 1.00999.99 C ATOM 36884 O SER Z 53 164.146 206.878 128.067 1.00999.99 O ATOM 36885 CB SER Z 53 161.510 205.049 128.253 1.00999.99 C ATOM 36886 OG SER Z 53 160.974 203.990 127.480 1.00999.99 O ATOM 36887 N LYS Z 54 163.686 206.449 130.230 1.00999.99 N ATOM 36888 CA LYS Z 54 164.475 207.586 130.698 1.00999.99 C ATOM 36889 C LYS Z 54 165.963 207.314 130.525 1.00999.99 C ATOM 36890 O LYS Z 54 166.721 208.198 130.105 1.00999.99 O ATOM 36891 CB LYS Z 54 164.149 207.890 132.159 1.00999.99 C ATOM 36892 CG LYS Z 54 162.732 208.386 132.392 1.00999.99 C ATOM 36893 CD LYS Z 54 162.515 208.763 133.849 1.00999.99 C ATOM 36894 CE LYS Z 54 161.116 209.312 134.075 1.00999.99 C ATOM 36895 NZ LYS Z 54 160.900 209.713 135.493 1.00999.99 N ATOM 36896 N ALA Z 55 166.390 206.083 130.817 1.00999.99 N ATOM 36897 CA ALA Z 55 167.755 205.673 130.518 1.00999.99 C ATOM 36898 C ALA Z 55 168.009 205.625 129.016 1.00999.99 C ATOM 36899 O ALA Z 55 169.136 205.872 128.577 1.00999.99 O ATOM 36900 CB ALA Z 55 168.047 204.317 131.157 1.00999.99 C ATOM 36901 N MET Z 56 166.975 205.340 128.216 1.00999.99 N ATOM 36902 CA MET Z 56 167.113 205.411 126.763 1.00999.99 C ATOM 36903 C MET Z 56 167.325 206.847 126.296 1.00999.99 C ATOM 36904 O MET Z 56 168.131 207.097 125.393 1.00999.99 O ATOM 36905 CB MET Z 56 165.884 204.804 126.085 1.00999.99 C ATOM 36906 CG MET Z 56 166.014 204.635 124.581 1.00999.99 C ATOM 36907 SD MET Z 56 167.336 203.501 124.123 1.00999.99 S ATOM 36908 CE MET Z 56 168.456 204.622 123.292 1.00999.99 C ATOM 36909 N GLY Z 57 166.622 207.804 126.908 1.00999.99 N ATOM 36910 CA GLY Z 57 166.833 209.211 126.576 1.00999.99 C ATOM 36911 C GLY Z 57 168.215 209.679 127.016 1.00999.99 C ATOM 36912 O GLY Z 57 168.860 210.471 126.316 1.00999.99 O ATOM 36913 N ILE Z 58 168.691 209.175 128.160 1.00999.99 N ATOM 36914 CA ILE Z 58 170.042 209.483 128.628 1.00999.99 C ATOM 36915 C ILE Z 58 171.089 208.921 127.667 1.00999.99 C ATOM 36916 O ILE Z 58 172.054 209.610 127.310 1.00999.99 O ATOM 36917 CB ILE Z 58 170.231 208.957 130.065 1.00999.99 C ATOM 36918 CG1 ILE Z 58 169.438 209.817 131.052 1.00999.99 C ATOM 36919 CG2 ILE Z 58 171.700 208.936 130.470 1.00999.99 C ATOM 36920 CD1 ILE Z 58 169.113 209.112 132.348 1.00999.99 C ATOM 36921 N MET Z 59 170.887 207.686 127.194 1.00999.99 N ATOM 36922 CA MET Z 59 171.823 207.069 126.256 1.00999.99 C ATOM 36923 C MET Z 59 171.802 207.767 124.899 1.00999.99 C ATOM 36924 O MET Z 59 172.852 207.938 124.267 1.00999.99 O ATOM 36925 CB MET Z 59 171.496 205.584 126.095 1.00999.99 C ATOM 36926 CG MET Z 59 171.919 204.723 127.271 1.00999.99 C ATOM 36927 SD MET Z 59 173.688 204.407 127.294 1.00999.99 S ATOM 36928 CE MET Z 59 173.847 203.342 125.865 1.00999.99 C ATOM 36929 N ASN Z 60 170.619 208.191 124.444 1.00999.99 N ATOM 36930 CA ASN Z 60 170.519 208.900 123.172 1.00999.99 C ATOM 36931 C ASN Z 60 171.152 210.284 123.245 1.00999.99 C ATOM 36932 O ASN Z 60 171.827 210.703 122.295 1.00999.99 O ATOM 36933 CB ASN Z 60 169.055 209.006 122.744 1.00999.99 C ATOM 36934 CG ASN Z 60 168.891 209.654 121.383 1.00999.99 C ATOM 36935 OD1 ASN Z 60 168.704 210.867 121.278 1.00999.99 O ATOM 36936 ND2 ASN Z 60 168.961 208.847 120.331 1.00999.99 N ATOM 36937 N SER Z 61 170.969 210.995 124.364 1.00999.99 N ATOM 36938 CA SER Z 61 171.637 212.280 124.536 1.00999.99 C ATOM 36939 C SER Z 61 173.143 212.114 124.692 1.00999.99 C ATOM 36940 O SER Z 61 173.903 212.975 124.240 1.00999.99 O ATOM 36941 CB SER Z 61 171.054 213.024 125.737 1.00999.99 C ATOM 36942 OG SER Z 61 170.906 212.160 126.848 1.00999.99 O ATOM 36943 N PHE Z 62 173.588 211.006 125.297 1.00999.99 N ATOM 36944 CA PHE Z 62 175.016 210.708 125.379 1.00999.99 C ATOM 36945 C PHE Z 62 175.610 210.457 123.998 1.00999.99 C ATOM 36946 O PHE Z 62 176.691 210.971 123.680 1.00999.99 O ATOM 36947 CB PHE Z 62 175.235 209.499 126.293 1.00999.99 C ATOM 36948 CG PHE Z 62 176.627 208.931 126.242 1.00999.99 C ATOM 36949 CD1 PHE Z 62 177.688 209.607 126.825 1.00999.99 C ATOM 36950 CD2 PHE Z 62 176.869 207.708 125.629 1.00999.99 C ATOM 36951 CE1 PHE Z 62 178.970 209.081 126.787 1.00999.99 C ATOM 36952 CE2 PHE Z 62 178.148 207.177 125.586 1.00999.99 C ATOM 36953 CZ PHE Z 62 179.199 207.865 126.166 1.00999.99 C ATOM 36954 N VAL Z 63 174.898 209.688 123.166 1.00999.99 N ATOM 36955 CA VAL Z 63 175.343 209.401 121.801 1.00999.99 C ATOM 36956 C VAL Z 63 175.406 210.683 120.978 1.00999.99 C ATOM 36957 O VAL Z 63 176.402 210.953 120.291 1.00999.99 O ATOM 36958 CB VAL Z 63 174.417 208.350 121.155 1.00999.99 C ATOM 36959 CG1 VAL Z 63 174.520 208.365 119.632 1.00999.99 C ATOM 36960 CG2 VAL Z 63 174.736 206.967 121.691 1.00999.99 C ATOM 36961 N ASN Z 64 174.360 211.514 121.075 1.00999.99 N ATOM 36962 CA ASN Z 64 174.316 212.762 120.318 1.00999.99 C ATOM 36963 C ASN Z 64 175.370 213.759 120.790 1.00999.99 C ATOM 36964 O ASN Z 64 175.991 214.431 119.959 1.00999.99 O ATOM 36965 CB ASN Z 64 172.920 213.379 120.408 1.00999.99 C ATOM 36966 CG ASN Z 64 171.902 212.640 119.561 1.00999.99 C ATOM 36967 OD1 ASN Z 64 171.814 212.852 118.352 1.00999.99 O ATOM 36968 ND2 ASN Z 64 171.125 211.767 120.193 1.00999.99 N ATOM 36969 N ASP Z 65 175.621 213.835 122.102 1.00999.99 N ATOM 36970 CA ASP Z 65 176.622 214.759 122.624 1.00999.99 C ATOM 36971 C ASP Z 65 178.034 214.321 122.254 1.00999.99 C ATOM 36972 O ASP Z 65 178.867 215.161 121.891 1.00999.99 O ATOM 36973 CB ASP Z 65 176.474 214.884 124.141 1.00999.99 C ATOM 36974 CG ASP Z 65 177.591 215.691 124.775 1.00999.99 C ATOM 36975 OD1 ASP Z 65 177.693 216.903 124.490 1.00999.99 O ATOM 36976 OD2 ASP Z 65 178.366 215.112 125.565 1.00999.99 O ATOM 36977 N ILE Z 66 178.313 213.013 122.318 1.00999.99 N ATOM 36978 CA ILE Z 66 179.626 212.502 121.927 1.00999.99 C ATOM 36979 C ILE Z 66 179.865 212.715 120.436 1.00999.99 C ATOM 36980 O ILE Z 66 180.945 213.173 120.027 1.00999.99 O ATOM 36981 CB ILE Z 66 179.754 211.007 122.278 1.00 30.00 C ATOM 36982 CG1 ILE Z 66 179.738 210.813 123.796 1.00 30.00 C ATOM 36983 CG2 ILE Z 66 181.023 210.425 121.676 1.00 30.00 C ATOM 36984 CD1 ILE Z 66 179.595 209.370 124.224 1.00 30.00 C ATOM 36985 N PHE Z 67 178.847 212.436 119.610 1.00999.99 N ATOM 36986 CA PHE Z 67 178.967 212.620 118.166 1.00999.99 C ATOM 36987 C PHE Z 67 179.166 214.089 117.807 1.00999.99 C ATOM 36988 O PHE Z 67 180.028 214.422 116.986 1.00999.99 O ATOM 36989 CB PHE Z 67 177.730 212.046 117.468 1.00999.99 C ATOM 36990 CG PHE Z 67 177.503 212.588 116.085 1.00999.99 C ATOM 36991 CD1 PHE Z 67 178.353 212.245 115.042 1.00999.99 C ATOM 36992 CD2 PHE Z 67 176.431 213.430 115.823 1.00999.99 C ATOM 36993 CE1 PHE Z 67 178.145 212.743 113.768 1.00999.99 C ATOM 36994 CE2 PHE Z 67 176.217 213.929 114.551 1.00999.99 C ATOM 36995 CZ PHE Z 67 177.076 213.584 113.523 1.00999.99 C ATOM 36996 N GLU Z 68 178.414 214.987 118.459 1.00999.99 N ATOM 36997 CA GLU Z 68 178.541 216.416 118.184 1.00999.99 C ATOM 36998 C GLU Z 68 179.886 216.961 118.652 1.00999.99 C ATOM 36999 O GLU Z 68 180.495 217.787 117.962 1.00999.99 O ATOM 37000 CB GLU Z 68 177.394 217.181 118.846 1.00999.99 C ATOM 37001 CG GLU Z 68 176.098 217.183 118.046 1.00999.99 C ATOM 37002 CD GLU Z 68 174.907 217.653 118.862 1.00999.99 C ATOM 37003 OE1 GLU Z 68 175.051 217.818 120.091 1.00999.99 O ATOM 37004 OE2 GLU Z 68 173.824 217.859 118.273 1.00999.99 O ATOM 37005 N ARG Z 69 180.386 216.476 119.795 1.00999.99 N ATOM 37006 CA ARG Z 69 181.668 216.941 120.316 1.00999.99 C ATOM 37007 C ARG Z 69 182.829 216.499 119.429 1.00999.99 C ATOM 37008 O ARG Z 69 183.697 217.312 119.080 1.00999.99 O ATOM 37009 CB ARG Z 69 181.863 216.433 121.745 1.00999.99 C ATOM 37010 CG ARG Z 69 181.295 217.340 122.823 1.00999.99 C ATOM 37011 CD ARG Z 69 181.812 216.925 124.187 1.00999.99 C ATOM 37012 NE ARG Z 69 181.249 215.648 124.614 1.00999.99 N ATOM 37013 CZ ARG Z 69 181.572 215.033 125.746 1.00999.99 C ATOM 37014 NH1 ARG Z 69 182.459 215.580 126.566 1.00999.99 N ATOM 37015 NH2 ARG Z 69 181.010 213.873 126.059 1.00999.99 N ATOM 37016 N ILE Z 70 182.855 215.218 119.039 1.00999.99 N ATOM 37017 CA ILE Z 70 183.951 214.737 118.197 1.00999.99 C ATOM 37018 C ILE Z 70 183.847 215.323 116.788 1.00999.99 C ATOM 37019 O ILE Z 70 184.872 215.647 116.170 1.00999.99 O ATOM 37020 CB ILE Z 70 183.994 213.194 118.193 1.00999.99 C ATOM 37021 CG1 ILE Z 70 184.161 212.673 119.620 1.00999.99 C ATOM 37022 CG2 ILE Z 70 185.167 212.672 117.370 1.00999.99 C ATOM 37023 CD1 ILE Z 70 184.201 211.159 119.742 1.00999.99 C ATOM 37024 N ALA Z 71 182.623 215.544 116.287 1.00999.99 N ATOM 37025 CA ALA Z 71 182.454 216.153 114.971 1.00999.99 C ATOM 37026 C ALA Z 71 182.887 217.615 114.967 1.00999.99 C ATOM 37027 O ALA Z 71 183.512 218.074 114.004 1.00999.99 O ATOM 37028 CB ALA Z 71 181.001 216.023 114.519 1.00999.99 C ATOM 37029 N GLY Z 72 182.590 218.355 116.040 1.00999.99 N ATOM 37030 CA GLY Z 72 183.048 219.732 116.124 1.00999.99 C ATOM 37031 C GLY Z 72 184.551 219.841 116.294 1.00999.99 C ATOM 37032 O GLY Z 72 185.185 220.734 115.720 1.00999.99 O ATOM 37033 N GLU Z 73 185.146 218.918 117.063 1.00999.99 N ATOM 37034 CA GLU Z 73 186.598 218.900 117.220 1.00999.99 C ATOM 37035 C GLU Z 73 187.296 218.568 115.906 1.00999.99 C ATOM 37036 O GLU Z 73 188.304 219.194 115.558 1.00999.99 O ATOM 37037 CB GLU Z 73 186.992 217.899 118.307 1.00999.99 C ATOM 37038 CG GLU Z 73 188.473 217.898 118.659 1.00999.99 C ATOM 37039 CD GLU Z 73 188.961 219.240 119.168 1.00999.99 C ATOM 37040 OE1 GLU Z 73 189.560 219.997 118.375 1.00999.99 O ATOM 37041 OE2 GLU Z 73 188.747 219.538 120.361 1.00999.99 O ATOM 37042 N ALA Z 74 186.752 217.615 115.144 1.00999.99 N ATOM 37043 CA ALA Z 74 187.345 217.279 113.855 1.00999.99 C ATOM 37044 C ALA Z 74 187.106 218.367 112.815 1.00999.99 C ATOM 37045 O ALA Z 74 187.950 218.564 111.935 1.00999.99 O ATOM 37046 CB ALA Z 74 186.805 215.944 113.358 1.00999.99 C ATOM 37047 N SER Z 75 185.984 219.090 112.902 1.00999.99 N ATOM 37048 CA SER Z 75 185.758 220.217 111.999 1.00999.99 C ATOM 37049 C SER Z 75 186.722 221.360 112.294 1.00999.99 C ATOM 37050 O SER Z 75 187.234 222.002 111.369 1.00999.99 O ATOM 37051 CB SER Z 75 184.309 220.695 112.102 1.00999.99 C ATOM 37052 OG SER Z 75 183.402 219.609 112.022 1.00999.99 O ATOM 37053 N ARG Z 76 187.000 221.611 113.579 1.00999.99 N ATOM 37054 CA ARG Z 76 188.005 222.606 113.940 1.00999.99 C ATOM 37055 C ARG Z 76 189.406 222.167 113.529 1.00999.99 C ATOM 37056 O ARG Z 76 190.214 223.000 113.100 1.00999.99 O ATOM 37057 CB ARG Z 76 187.952 222.879 115.443 1.00999.99 C ATOM 37058 CG ARG Z 76 188.362 224.289 115.836 1.00999.99 C ATOM 37059 CD ARG Z 76 188.455 224.442 117.347 1.00999.99 C ATOM 37060 NE ARG Z 76 187.153 224.322 117.999 1.00999.99 N ATOM 37061 CZ ARG Z 76 186.801 223.311 118.787 1.00999.99 C ATOM 37062 NH1 ARG Z 76 187.656 222.326 119.027 1.00999.99 N ATOM 37063 NH2 ARG Z 76 185.595 223.286 119.338 1.00999.99 N ATOM 37064 N LEU Z 77 189.703 220.868 113.636 1.00999.99 N ATOM 37065 CA LEU Z 77 191.006 220.357 113.221 1.00999.99 C ATOM 37066 C LEU Z 77 191.173 220.406 111.707 1.00999.99 C ATOM 37067 O LEU Z 77 192.285 220.607 111.205 1.00999.99 O ATOM 37068 CB LEU Z 77 191.187 218.931 113.738 1.00999.99 C ATOM 37069 CG LEU Z 77 191.662 218.832 115.186 1.00999.99 C ATOM 37070 CD1 LEU Z 77 191.304 217.485 115.786 1.00999.99 C ATOM 37071 CD2 LEU Z 77 193.159 219.060 115.236 1.00999.99 C ATOM 37072 N ALA Z 78 190.081 220.216 110.963 1.00999.99 N ATOM 37073 CA ALA Z 78 190.134 220.355 109.513 1.00999.99 C ATOM 37074 C ALA Z 78 190.257 221.814 109.096 1.00999.99 C ATOM 37075 O ALA Z 78 190.941 222.120 108.112 1.00999.99 O ATOM 37076 CB ALA Z 78 188.897 219.721 108.879 1.00999.99 C ATOM 37077 N HIS Z 79 189.606 222.725 109.827 1.00999.99 N ATOM 37078 CA HIS Z 79 189.764 224.149 109.549 1.00999.99 C ATOM 37079 C HIS Z 79 191.162 224.642 109.905 1.00999.99 C ATOM 37080 O HIS Z 79 191.650 225.604 109.301 1.00999.99 O ATOM 37081 CB HIS Z 79 188.709 224.953 110.309 1.00999.99 C ATOM 37082 CG HIS Z 79 187.386 225.025 109.611 1.00999.99 C ATOM 37083 ND1 HIS Z 79 186.474 223.992 109.637 1.00999.99 N ATOM 37084 CD2 HIS Z 79 186.822 226.006 108.868 1.00999.99 C ATOM 37085 CE1 HIS Z 79 185.405 224.335 108.941 1.00999.99 C ATOM 37086 NE2 HIS Z 79 185.591 225.552 108.463 1.00999.99 N ATOM 37087 N TYR Z 80 191.818 224.002 110.876 1.00999.99 N ATOM 37088 CA TYR Z 80 193.184 224.387 111.216 1.00999.99 C ATOM 37089 C TYR Z 80 194.196 223.811 110.231 1.00999.99 C ATOM 37090 O TYR Z 80 195.282 224.376 110.060 1.00999.99 O ATOM 37091 CB TYR Z 80 193.521 223.939 112.639 1.00999.99 C ATOM 37092 CG TYR Z 80 192.792 224.702 113.725 1.00999.99 C ATOM 37093 CD1 TYR Z 80 192.272 225.971 113.485 1.00999.99 C ATOM 37094 CD2 TYR Z 80 192.626 224.153 114.991 1.00999.99 C ATOM 37095 CE1 TYR Z 80 191.605 226.670 114.477 1.00999.99 C ATOM 37096 CE2 TYR Z 80 191.961 224.844 115.990 1.00999.99 C ATOM 37097 CZ TYR Z 80 191.453 226.101 115.727 1.00999.99 C ATOM 37098 OH TYR Z 80 190.792 226.791 116.717 1.00999.99 O ATOM 37099 N ASN Z 81 193.863 222.698 109.580 1.00999.99 N ATOM 37100 CA ASN Z 81 194.775 222.010 108.675 1.00999.99 C ATOM 37101 C ASN Z 81 194.644 222.468 107.227 1.00999.99 C ATOM 37102 O ASN Z 81 195.277 221.865 106.352 1.00999.99 O ATOM 37103 CB ASN Z 81 194.550 220.498 108.756 1.00999.99 C ATOM 37104 CG ASN Z 81 195.225 219.872 109.958 1.00999.99 C ATOM 37105 OD1 ASN Z 81 196.228 219.174 109.824 1.00999.99 O ATOM 37106 ND2 ASN Z 81 194.678 220.120 111.142 1.00999.99 N