>>6L9H:HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 GLN A 85 ALA A 114 1 30 ATOM 395 N GLN A 85 -6.071 22.208 -37.603 1.00 38.40 N ATOM 396 CA GLN A 85 -6.918 23.403 -37.521 1.00 37.48 C ATOM 397 C GLN A 85 -7.068 23.999 -38.924 1.00 36.78 C ATOM 398 O GLN A 85 -6.107 23.969 -39.694 1.00 36.61 O ATOM 399 CB GLN A 85 -6.310 24.428 -36.568 1.00 38.83 C ATOM 400 CG GLN A 85 -6.572 24.106 -35.111 1.00 42.59 C ATOM 401 CD GLN A 85 -6.371 25.313 -34.236 1.00 48.07 C ATOM 402 OE1 GLN A 85 -5.502 26.150 -34.500 1.00 49.94 O ATOM 403 NE2 GLN A 85 -7.178 25.438 -33.178 1.00 49.20 N ATOM 404 N SER A 86 -8.263 24.499 -39.290 1.00 36.53 N ATOM 405 CA SER A 86 -8.536 25.069 -40.619 1.00 37.34 C ATOM 406 C SER A 86 -7.436 26.070 -41.040 1.00 38.21 C ATOM 407 O SER A 86 -6.893 26.008 -42.157 1.00 38.19 O ATOM 408 CB SER A 86 -9.888 25.783 -40.593 1.00 38.94 C ATOM 409 OG SER A 86 -9.863 26.876 -39.682 1.00 41.02 O ATOM 410 N SER A 87 -7.072 26.930 -40.047 1.00 38.18 N ATOM 411 CA SER A 87 -6.071 27.988 -40.069 1.00 37.71 C ATOM 412 C SER A 87 -4.673 27.419 -40.258 1.00 36.16 C ATOM 413 O SER A 87 -3.924 28.000 -41.027 1.00 36.71 O ATOM 414 CB SER A 87 -6.134 28.791 -38.773 1.00 39.49 C ATOM 415 OG SER A 87 -6.140 27.936 -37.639 1.00 42.56 O ATOM 416 N ALA A 88 -4.318 26.306 -39.571 1.00 33.92 N ATOM 417 CA ALA A 88 -3.007 25.651 -39.687 1.00 32.54 C ATOM 418 C ALA A 88 -2.753 25.185 -41.103 1.00 31.32 C ATOM 419 O ALA A 88 -1.620 25.268 -41.573 1.00 31.28 O ATOM 420 CB ALA A 88 -2.923 24.460 -38.754 1.00 32.30 C ATOM 421 N VAL A 89 -3.791 24.685 -41.785 1.00 30.30 N ATOM 422 CA VAL A 89 -3.639 24.248 -43.168 1.00 29.96 C ATOM 423 C VAL A 89 -3.404 25.472 -44.050 1.00 30.27 C ATOM 424 O VAL A 89 -2.496 25.462 -44.881 1.00 30.40 O ATOM 425 CB VAL A 89 -4.832 23.398 -43.656 1.00 29.51 C ATOM 426 CG1 VAL A 89 -4.730 23.100 -45.149 1.00 29.18 C ATOM 427 CG2 VAL A 89 -4.942 22.114 -42.848 1.00 29.81 C ATOM 428 N MET A 90 -4.171 26.545 -43.825 1.00 29.92 N ATOM 429 CA MET A 90 -3.998 27.774 -44.584 1.00 30.33 C ATOM 430 C MET A 90 -2.617 28.400 -44.370 1.00 29.00 C ATOM 431 O MET A 90 -1.977 28.806 -45.340 1.00 29.01 O ATOM 432 CB MET A 90 -5.151 28.743 -44.305 1.00 32.51 C ATOM 433 CG MET A 90 -6.481 28.217 -44.831 1.00 38.23 C ATOM 434 SD MET A 90 -6.441 27.774 -46.612 1.00 50.90 S ATOM 435 CE MET A 90 -6.266 29.407 -47.315 1.00 46.54 C ATOM 436 N ALA A 91 -2.109 28.358 -43.127 1.00 27.57 N ATOM 437 CA ALA A 91 -0.764 28.797 -42.755 1.00 26.46 C ATOM 438 C ALA A 91 0.278 27.986 -43.543 1.00 25.47 C ATOM 439 O ALA A 91 1.281 28.542 -43.984 1.00 25.87 O ATOM 440 CB ALA A 91 -0.552 28.605 -41.267 1.00 26.47 C ATOM 441 N LEU A 92 0.023 26.685 -43.750 1.00 23.78 N ATOM 442 CA LEU A 92 0.898 25.829 -44.525 1.00 22.75 C ATOM 443 C LEU A 92 0.830 26.164 -46.009 1.00 21.45 C ATOM 444 O LEU A 92 1.857 26.139 -46.687 1.00 21.71 O ATOM 445 CB LEU A 92 0.490 24.373 -44.317 1.00 23.04 C ATOM 446 CG LEU A 92 1.297 23.663 -43.285 1.00 24.46 C ATOM 447 CD1 LEU A 92 0.563 22.496 -42.734 1.00 24.48 C ATOM 448 CD2 LEU A 92 2.620 23.280 -43.845 1.00 25.46 C ATOM 449 N GLN A 93 -0.380 26.460 -46.521 1.00 19.56 N ATOM 450 CA GLN A 93 -0.572 26.753 -47.928 1.00 18.15 C ATOM 451 C GLN A 93 0.052 28.048 -48.330 1.00 17.78 C ATOM 452 O GLN A 93 0.697 28.115 -49.381 1.00 18.00 O ATOM 453 CB GLN A 93 -2.044 26.729 -48.296 1.00 18.37 C ATOM 454 CG GLN A 93 -2.233 26.781 -49.799 1.00 19.70 C ATOM 455 CD GLN A 93 -3.638 26.465 -50.224 1.00 22.36 C ATOM 456 OE1 GLN A 93 -4.599 26.506 -49.437 1.00 23.61 O ATOM 457 NE2 GLN A 93 -3.782 26.159 -51.496 1.00 21.98 N ATOM 458 N GLU A 94 -0.096 29.083 -47.480 1.00 16.86 N ATOM 459 CA GLU A 94 0.483 30.391 -47.730 1.00 16.80 C ATOM 460 C GLU A 94 2.001 30.282 -47.816 1.00 17.29 C ATOM 461 O GLU A 94 2.598 30.709 -48.806 1.00 17.22 O ATOM 462 CB GLU A 94 0.079 31.362 -46.624 1.00 18.34 C ATOM 463 CG GLU A 94 -1.377 31.756 -46.676 1.00 22.23 C ATOM 464 CD GLU A 94 -1.754 32.810 -47.697 1.00 27.05 C ATOM 465 OE1 GLU A 94 -2.948 33.187 -47.703 1.00 28.71 O ATOM 466 OE2 GLU A 94 -0.874 33.293 -48.451 1.00 26.77 O ATOM 467 N ALA A 95 2.593 29.599 -46.820 1.00 17.64 N ATOM 468 CA ALA A 95 4.019 29.344 -46.679 1.00 18.20 C ATOM 469 C ALA A 95 4.606 28.675 -47.924 1.00 19.04 C ATOM 470 O ALA A 95 5.695 29.054 -48.376 1.00 19.06 O ATOM 471 CB ALA A 95 4.253 28.464 -45.452 1.00 17.91 C ATOM 472 N CYS A 96 3.868 27.690 -48.474 1.00 19.69 N ATOM 473 CA CYS A 96 4.261 26.868 -49.612 1.00 20.75 C ATOM 474 C CYS A 96 4.305 27.648 -50.869 1.00 20.86 C ATOM 475 O CYS A 96 5.284 27.570 -51.619 1.00 20.60 O ATOM 476 CB CYS A 96 3.340 25.662 -49.749 1.00 22.02 C ATOM 477 SG CYS A 96 3.850 24.241 -48.761 1.00 29.75 S ATOM 478 N GLU A 97 3.227 28.388 -51.120 1.00 20.97 N ATOM 479 CA GLU A 97 3.115 29.155 -52.336 1.00 21.86 C ATOM 480 C GLU A 97 4.132 30.293 -52.327 1.00 21.28 C ATOM 481 O GLU A 97 4.940 30.402 -53.254 1.00 21.57 O ATOM 482 CB GLU A 97 1.684 29.638 -52.512 1.00 25.47 C ATOM 483 CG GLU A 97 0.729 28.469 -52.539 1.00 33.81 C ATOM 484 CD GLU A 97 -0.598 28.765 -53.196 1.00 45.13 C ATOM 485 OE1 GLU A 97 -0.653 29.725 -54.001 1.00 46.78 O ATOM 486 OE2 GLU A 97 -1.585 28.044 -52.910 1.00 48.49 O ATOM 487 N ALA A 98 4.216 31.032 -51.208 1.00 19.75 N ATOM 488 CA ALA A 98 5.174 32.108 -51.071 1.00 19.09 C ATOM 489 C ALA A 98 6.605 31.617 -51.310 1.00 19.88 C ATOM 490 O ALA A 98 7.377 32.301 -51.982 1.00 21.14 O ATOM 491 CB ALA A 98 5.045 32.733 -49.701 1.00 18.41 C ATOM 492 N TYR A 99 6.916 30.406 -50.828 1.00 19.28 N ATOM 493 CA TYR A 99 8.219 29.776 -51.008 1.00 19.56 C ATOM 494 C TYR A 99 8.461 29.483 -52.480 1.00 19.45 C ATOM 495 O TYR A 99 9.537 29.817 -52.978 1.00 19.57 O ATOM 496 CB TYR A 99 8.343 28.464 -50.171 1.00 19.37 C ATOM 497 CG TYR A 99 9.468 27.551 -50.624 1.00 20.00 C ATOM 498 CD1 TYR A 99 10.795 27.937 -50.502 1.00 20.99 C ATOM 499 CD2 TYR A 99 9.201 26.319 -51.205 1.00 20.94 C ATOM 500 CE1 TYR A 99 11.829 27.117 -50.944 1.00 21.92 C ATOM 501 CE2 TYR A 99 10.227 25.489 -51.647 1.00 21.61 C ATOM 502 CZ TYR A 99 11.540 25.901 -51.534 1.00 22.66 C ATOM 503 OH TYR A 99 12.563 25.108 -51.993 1.00 24.39 O ATOM 504 N LEU A 100 7.488 28.797 -53.140 1.00 18.70 N ATOM 505 CA LEU A 100 7.562 28.341 -54.524 1.00 18.43 C ATOM 506 C LEU A 100 7.643 29.456 -55.510 1.00 19.65 C ATOM 507 O LEU A 100 8.387 29.346 -56.476 1.00 20.17 O ATOM 508 CB LEU A 100 6.402 27.418 -54.854 1.00 17.93 C ATOM 509 CG LEU A 100 6.501 25.992 -54.290 1.00 18.16 C ATOM 510 CD1 LEU A 100 5.284 25.228 -54.620 1.00 18.67 C ATOM 511 CD2 LEU A 100 7.721 25.254 -54.836 1.00 17.80 C ATOM 512 N VAL A 101 6.935 30.559 -55.247 1.00 19.85 N ATOM 513 CA VAL A 101 6.977 31.750 -56.087 1.00 20.11 C ATOM 514 C VAL A 101 8.367 32.387 -55.994 1.00 22.17 C ATOM 515 O VAL A 101 8.949 32.750 -57.013 1.00 23.13 O ATOM 516 CB VAL A 101 5.882 32.741 -55.695 1.00 19.46 C ATOM 517 CG1 VAL A 101 6.042 34.029 -56.472 1.00 19.84 C ATOM 518 CG2 VAL A 101 4.502 32.155 -55.930 1.00 19.31 C ATOM 519 N GLY A 102 8.912 32.464 -54.786 1.00 22.74 N ATOM 520 CA GLY A 102 10.264 32.957 -54.566 1.00 23.89 C ATOM 521 C GLY A 102 11.303 32.050 -55.201 1.00 25.07 C ATOM 522 O GLY A 102 12.325 32.519 -55.699 1.00 24.85 O ATOM 523 N LEU A 103 11.049 30.736 -55.190 1.00 26.16 N ATOM 524 CA LEU A 103 11.925 29.762 -55.823 1.00 27.21 C ATOM 525 C LEU A 103 11.859 29.943 -57.328 1.00 28.40 C ATOM 526 O LEU A 103 12.898 29.849 -57.978 1.00 29.27 O ATOM 527 CB LEU A 103 11.543 28.337 -55.446 1.00 27.35 C ATOM 528 CG LEU A 103 12.455 27.232 -56.007 1.00 29.27 C ATOM 529 CD1 LEU A 103 13.917 27.434 -55.608 1.00 29.97 C ATOM 530 CD2 LEU A 103 11.993 25.869 -55.558 1.00 29.82 C ATOM 531 N PHE A 104 10.664 30.251 -57.885 1.00 28.25 N ATOM 532 CA PHE A 104 10.522 30.505 -59.307 1.00 28.87 C ATOM 533 C PHE A 104 11.299 31.738 -59.703 1.00 30.38 C ATOM 534 O PHE A 104 12.054 31.683 -60.670 1.00 31.11 O ATOM 535 CB PHE A 104 9.058 30.573 -59.730 1.00 28.60 C ATOM 536 CG PHE A 104 8.501 29.184 -59.917 1.00 29.84 C ATOM 537 CD1 PHE A 104 9.246 28.195 -60.554 1.00 30.52 C ATOM 538 CD2 PHE A 104 7.247 28.847 -59.427 1.00 30.60 C ATOM 539 CE1 PHE A 104 8.744 26.912 -60.699 1.00 30.72 C ATOM 540 CE2 PHE A 104 6.746 27.561 -59.581 1.00 30.72 C ATOM 541 CZ PHE A 104 7.493 26.607 -60.223 1.00 30.42 C ATOM 542 N GLU A 105 11.242 32.805 -58.879 1.00 30.08 N ATOM 543 CA GLU A 105 12.006 34.030 -59.088 1.00 30.35 C ATOM 544 C GLU A 105 13.505 33.734 -59.296 1.00 30.52 C ATOM 545 O GLU A 105 14.055 34.096 -60.328 1.00 30.51 O ATOM 546 CB GLU A 105 11.795 35.010 -57.911 1.00 32.06 C ATOM 547 CG GLU A 105 10.411 35.631 -57.881 1.00 35.44 C ATOM 548 CD GLU A 105 10.108 36.476 -56.660 1.00 38.94 C ATOM 549 OE1 GLU A 105 11.070 36.887 -55.975 1.00 39.66 O ATOM 550 OE2 GLU A 105 8.912 36.727 -56.385 1.00 40.31 O ATOM 551 N ASP A 106 14.122 32.996 -58.368 1.00 30.66 N ATOM 552 CA ASP A 106 15.532 32.663 -58.472 1.00 31.64 C ATOM 553 C ASP A 106 15.785 31.726 -59.630 1.00 32.91 C ATOM 554 O ASP A 106 16.805 31.853 -60.297 1.00 33.20 O ATOM 555 CB ASP A 106 16.055 32.046 -57.168 1.00 33.46 C ATOM 556 CG ASP A 106 15.852 32.880 -55.920 1.00 38.79 C ATOM 557 OD1 ASP A 106 15.896 34.128 -56.018 1.00 40.73 O ATOM 558 OD2 ASP A 106 15.658 32.293 -54.850 1.00 40.68 O ATOM 559 N THR A 107 14.868 30.788 -59.881 1.00 33.68 N ATOM 560 CA THR A 107 15.006 29.822 -60.965 1.00 35.11 C ATOM 561 C THR A 107 15.065 30.531 -62.312 1.00 36.06 C ATOM 562 O THR A 107 15.916 30.213 -63.149 1.00 36.22 O ATOM 563 CB THR A 107 13.842 28.825 -60.929 1.00 37.04 C ATOM 564 OG1 THR A 107 13.784 28.243 -59.635 1.00 38.86 O ATOM 565 CG2 THR A 107 13.985 27.729 -61.953 1.00 37.27 C ATOM 566 N ASN A 108 14.185 31.530 -62.493 1.00 36.12 N ATOM 567 CA ASN A 108 14.071 32.322 -63.709 1.00 36.30 C ATOM 568 C ASN A 108 15.357 33.103 -63.939 1.00 36.07 C ATOM 569 O ASN A 108 15.840 33.132 -65.056 1.00 35.76 O ATOM 570 CB ASN A 108 12.847 33.227 -63.624 1.00 37.63 C ATOM 571 CG ASN A 108 12.259 33.638 -64.950 1.00 41.06 C ATOM 572 OD1 ASN A 108 11.731 32.832 -65.726 1.00 41.38 O ATOM 573 ND2 ASN A 108 12.298 34.933 -65.212 1.00 42.78 N ATOM 574 N LEU A 109 15.956 33.645 -62.873 1.00 36.24 N ATOM 575 CA LEU A 109 17.230 34.348 -62.924 1.00 37.24 C ATOM 576 C LEU A 109 18.366 33.416 -63.371 1.00 38.70 C ATOM 577 O LEU A 109 19.339 33.872 -63.959 1.00 38.95 O ATOM 578 CB LEU A 109 17.564 34.926 -61.537 1.00 37.30 C ATOM 579 CG LEU A 109 17.053 36.323 -61.122 1.00 38.50 C ATOM 580 CD1 LEU A 109 17.975 37.453 -61.601 1.00 38.72 C ATOM 581 CD2 LEU A 109 15.586 36.590 -61.426 1.00 39.12 C ATOM 582 N CYS A 110 18.251 32.120 -63.082 1.00 39.86 N ATOM 583 CA CYS A 110 19.224 31.113 -63.490 1.00 42.03 C ATOM 584 C CYS A 110 19.038 30.758 -64.977 1.00 43.62 C ATOM 585 O CYS A 110 20.022 30.538 -65.688 1.00 43.54 O ATOM 586 CB CYS A 110 19.112 29.874 -62.608 1.00 42.96 C ATOM 587 SG CYS A 110 19.362 30.207 -60.855 1.00 46.25 S ATOM 588 N ALA A 111 17.781 30.712 -65.460 1.00 44.45 N ATOM 589 CA ALA A 111 17.511 30.453 -66.867 1.00 45.10 C ATOM 590 C ALA A 111 18.050 31.674 -67.668 1.00 46.32 C ATOM 591 O ALA A 111 18.874 31.499 -68.563 1.00 47.00 O ATOM 592 CB ALA A 111 16.013 30.259 -67.084 1.00 44.76 C ATOM 593 N ILE A 112 17.723 32.901 -67.237 1.00 46.41 N ATOM 594 CA ILE A 112 18.219 34.101 -67.896 1.00 47.02 C ATOM 595 C ILE A 112 19.746 34.170 -67.853 1.00 47.94 C ATOM 596 O ILE A 112 20.354 34.661 -68.799 1.00 47.92 O ATOM 597 CB ILE A 112 17.553 35.351 -67.287 1.00 47.70 C ATOM 598 CG1 ILE A 112 16.027 35.252 -67.388 1.00 48.71 C ATOM 599 CG2 ILE A 112 18.051 36.629 -67.940 1.00 48.21 C ATOM 600 CD1 ILE A 112 15.274 36.345 -66.643 1.00 50.17 C ATOM 601 N HIS A 113 20.370 33.647 -66.789 1.00 48.68 N ATOM 602 CA HIS A 113 21.823 33.658 -66.672 1.00 50.20 C ATOM 603 C HIS A 113 22.476 32.825 -67.768 1.00 52.26 C ATOM 604 O HIS A 113 23.528 33.209 -68.293 1.00 52.44 O ATOM 605 CB HIS A 113 22.272 33.152 -65.301 1.00 50.63 C ATOM 606 CG HIS A 113 23.750 33.242 -65.120 1.00 52.46 C ATOM 607 ND1 HIS A 113 24.361 34.436 -64.798 1.00 54.36 N ATOM 608 CD2 HIS A 113 24.702 32.298 -65.293 1.00 53.51 C ATOM 609 CE1 HIS A 113 25.658 34.176 -64.750 1.00 54.86 C ATOM 610 NE2 HIS A 113 25.909 32.903 -65.041 1.00 54.74 N ATOM 611 N ALA A 114 21.855 31.669 -68.098 1.00 53.45 N ATOM 612 CA ALA A 114 22.341 30.753 -69.137 1.00 54.54 C ATOM 613 C ALA A 114 21.637 31.012 -70.472 1.00 55.36 C ATOM 614 O ALA A 114 21.320 30.078 -71.198 1.00 55.41 O ATOM 615 CB ALA A 114 22.159 29.301 -68.704 1.00 54.70 C