>>6L9H:HELIX   34 AD7 SER H   52  ASN H   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 AD7 SER H 52 ASN H 81 1 30 ATOM 5456 N SER H 52 -8.014 46.169 -42.523 1.00 39.09 N ATOM 5457 CA SER H 52 -8.674 44.854 -42.590 1.00 39.16 C ATOM 5458 C SER H 52 -8.297 43.939 -41.408 1.00 38.51 C ATOM 5459 O SER H 52 -7.293 44.186 -40.746 1.00 38.22 O ATOM 5460 CB SER H 52 -8.433 44.184 -43.945 1.00 40.85 C ATOM 5461 OG SER H 52 -7.328 43.295 -43.989 1.00 43.65 O ATOM 5462 N SER H 53 -9.113 42.908 -41.117 1.00 38.40 N ATOM 5463 CA SER H 53 -8.826 41.998 -39.997 1.00 38.40 C ATOM 5464 C SER H 53 -7.553 41.213 -40.238 1.00 37.02 C ATOM 5465 O SER H 53 -6.782 40.992 -39.293 1.00 37.05 O ATOM 5466 CB SER H 53 -9.985 41.040 -39.752 1.00 40.66 C ATOM 5467 OG SER H 53 -9.722 40.255 -38.600 1.00 43.60 O ATOM 5468 N LYS H 54 -7.331 40.799 -41.508 1.00 35.37 N ATOM 5469 CA LYS H 54 -6.116 40.089 -41.881 1.00 34.12 C ATOM 5470 C LYS H 54 -4.903 41.024 -41.800 1.00 31.39 C ATOM 5471 O LYS H 54 -3.907 40.661 -41.176 1.00 31.06 O ATOM 5472 CB LYS H 54 -6.254 39.416 -43.263 1.00 36.26 C ATOM 5473 CG LYS H 54 -7.379 38.403 -43.257 1.00 39.99 C ATOM 5474 CD LYS H 54 -7.586 37.702 -44.596 1.00 44.16 C ATOM 5475 CE LYS H 54 -8.750 36.724 -44.540 1.00 46.80 C ATOM 5476 NZ LYS H 54 -10.057 37.409 -44.309 1.00 48.26 N ATOM 5477 N ALA H 55 -5.017 42.260 -42.309 1.00 29.37 N ATOM 5478 CA ALA H 55 -3.916 43.220 -42.231 1.00 28.04 C ATOM 5479 C ALA H 55 -3.569 43.572 -40.792 1.00 26.88 C ATOM 5480 O ALA H 55 -2.399 43.730 -40.480 1.00 26.91 O ATOM 5481 CB ALA H 55 -4.235 44.463 -43.021 1.00 27.88 C ATOM 5482 N MET H 56 -4.557 43.619 -39.902 1.00 26.04 N ATOM 5483 CA MET H 56 -4.302 43.859 -38.482 1.00 25.93 C ATOM 5484 C MET H 56 -3.517 42.684 -37.880 1.00 25.20 C ATOM 5485 O MET H 56 -2.678 42.894 -37.006 1.00 25.66 O ATOM 5486 CB MET H 56 -5.616 44.076 -37.728 1.00 27.47 C ATOM 5487 CG MET H 56 -5.440 44.289 -36.239 1.00 30.65 C ATOM 5488 SD MET H 56 -4.497 45.766 -35.833 1.00 37.35 S ATOM 5489 CE MET H 56 -5.717 46.998 -36.059 1.00 38.99 C ATOM 5490 N GLY H 57 -3.776 41.463 -38.363 1.00 23.95 N ATOM 5491 CA GLY H 57 -3.046 40.274 -37.953 1.00 22.64 C ATOM 5492 C GLY H 57 -1.601 40.382 -38.392 1.00 21.08 C ATOM 5493 O GLY H 57 -0.702 40.171 -37.580 1.00 21.58 O ATOM 5494 N ILE H 58 -1.361 40.801 -39.652 1.00 19.26 N ATOM 5495 CA ILE H 58 -0.010 41.032 -40.170 1.00 18.11 C ATOM 5496 C ILE H 58 0.707 42.104 -39.311 1.00 17.25 C ATOM 5497 O ILE H 58 1.871 41.925 -38.965 1.00 17.42 O ATOM 5498 CB ILE H 58 0.023 41.313 -41.712 1.00 18.15 C ATOM 5499 CG1 ILE H 58 0.021 40.002 -42.502 1.00 19.63 C ATOM 5500 CG2 ILE H 58 1.263 42.100 -42.124 1.00 18.07 C ATOM 5501 CD1 ILE H 58 -1.260 39.319 -42.677 1.00 21.68 C ATOM 5502 N MET H 59 -0.002 43.161 -38.899 1.00 16.40 N ATOM 5503 CA MET H 59 0.599 44.191 -38.045 1.00 16.12 C ATOM 5504 C MET H 59 0.909 43.653 -36.650 1.00 16.90 C ATOM 5505 O MET H 59 1.911 44.019 -36.067 1.00 17.08 O ATOM 5506 CB MET H 59 -0.266 45.453 -37.966 1.00 15.26 C ATOM 5507 CG MET H 59 -0.349 46.215 -39.260 1.00 15.60 C ATOM 5508 SD MET H 59 1.232 46.826 -39.899 1.00 16.31 S ATOM 5509 CE MET H 59 1.831 47.748 -38.467 1.00 11.70 C ATOM 5510 N ASN H 60 0.080 42.763 -36.136 1.00 17.50 N ATOM 5511 CA ASN H 60 0.293 42.161 -34.827 1.00 18.91 C ATOM 5512 C ASN H 60 1.483 41.199 -34.823 1.00 18.88 C ATOM 5513 O ASN H 60 2.226 41.111 -33.845 1.00 18.69 O ATOM 5514 CB ASN H 60 -0.953 41.453 -34.385 1.00 21.63 C ATOM 5515 CG ASN H 60 -1.576 42.191 -33.257 1.00 28.13 C ATOM 5516 OD1 ASN H 60 -0.887 42.645 -32.332 1.00 29.91 O ATOM 5517 ND2 ASN H 60 -2.888 42.346 -33.321 1.00 30.30 N ATOM 5518 N SER H 61 1.644 40.462 -35.921 1.00 18.49 N ATOM 5519 CA SER H 61 2.766 39.572 -36.104 1.00 18.56 C ATOM 5520 C SER H 61 4.053 40.411 -36.227 1.00 18.62 C ATOM 5521 O SER H 61 5.079 40.025 -35.675 1.00 19.39 O ATOM 5522 CB SER H 61 2.548 38.703 -37.339 1.00 20.29 C ATOM 5523 OG SER H 61 1.425 37.853 -37.144 1.00 23.60 O ATOM 5524 N PHE H 62 3.981 41.598 -36.885 1.00 17.54 N ATOM 5525 CA PHE H 62 5.116 42.480 -37.053 1.00 16.64 C ATOM 5526 C PHE H 62 5.595 43.002 -35.726 1.00 16.88 C ATOM 5527 O PHE H 62 6.790 42.994 -35.475 1.00 16.90 O ATOM 5528 CB PHE H 62 4.796 43.607 -38.039 1.00 16.15 C ATOM 5529 CG PHE H 62 5.838 44.706 -38.064 1.00 16.83 C ATOM 5530 CD1 PHE H 62 7.072 44.502 -38.655 1.00 18.05 C ATOM 5531 CD2 PHE H 62 5.614 45.913 -37.427 1.00 17.08 C ATOM 5532 CE1 PHE H 62 8.047 45.502 -38.639 1.00 18.29 C ATOM 5533 CE2 PHE H 62 6.603 46.888 -37.380 1.00 17.59 C ATOM 5534 CZ PHE H 62 7.812 46.677 -37.985 1.00 17.50 C ATOM 5535 N VAL H 63 4.679 43.473 -34.879 1.00 17.10 N ATOM 5536 CA VAL H 63 5.043 44.031 -33.576 1.00 17.43 C ATOM 5537 C VAL H 63 5.642 42.961 -32.685 1.00 19.07 C ATOM 5538 O VAL H 63 6.645 43.205 -32.027 1.00 19.67 O ATOM 5539 CB VAL H 63 3.824 44.690 -32.905 1.00 17.11 C ATOM 5540 CG1 VAL H 63 4.182 45.206 -31.528 1.00 17.62 C ATOM 5541 CG2 VAL H 63 3.274 45.810 -33.766 1.00 17.17 C ATOM 5542 N ASN H 64 5.052 41.761 -32.694 1.00 19.48 N ATOM 5543 CA ASN H 64 5.531 40.661 -31.873 1.00 20.31 C ATOM 5544 C ASN H 64 6.890 40.157 -32.299 1.00 19.30 C ATOM 5545 O ASN H 64 7.708 39.802 -31.448 1.00 19.03 O ATOM 5546 CB ASN H 64 4.518 39.524 -31.844 1.00 22.66 C ATOM 5547 CG ASN H 64 3.397 39.821 -30.888 1.00 28.91 C ATOM 5548 OD1 ASN H 64 3.620 40.210 -29.727 1.00 31.26 O ATOM 5549 ND2 ASN H 64 2.167 39.680 -31.355 1.00 30.45 N ATOM 5550 N ASP H 65 7.138 40.128 -33.606 1.00 18.43 N ATOM 5551 CA ASP H 65 8.405 39.655 -34.127 1.00 18.45 C ATOM 5552 C ASP H 65 9.514 40.615 -33.720 1.00 19.19 C ATOM 5553 O ASP H 65 10.523 40.183 -33.175 1.00 19.57 O ATOM 5554 CB ASP H 65 8.319 39.506 -35.650 1.00 19.91 C ATOM 5555 CG ASP H 65 9.634 39.222 -36.329 1.00 26.55 C ATOM 5556 OD1 ASP H 65 10.528 38.629 -35.669 1.00 28.71 O ATOM 5557 OD2 ASP H 65 9.771 39.577 -37.523 1.00 28.63 O ATOM 5558 N ILE H 66 9.325 41.919 -33.983 1.00 19.11 N ATOM 5559 CA ILE H 66 10.312 42.934 -33.664 1.00 18.76 C ATOM 5560 C ILE H 66 10.484 43.047 -32.160 1.00 19.57 C ATOM 5561 O ILE H 66 11.606 43.235 -31.705 1.00 19.80 O ATOM 5562 CB ILE H 66 9.983 44.279 -34.336 1.00 18.40 C ATOM 5563 CG1 ILE H 66 9.720 44.122 -35.829 1.00 18.61 C ATOM 5564 CG2 ILE H 66 11.074 45.304 -34.070 1.00 18.79 C ATOM 5565 CD1 ILE H 66 10.849 43.626 -36.607 1.00 19.88 C ATOM 5566 N PHE H 67 9.415 42.818 -31.357 1.00 19.84 N ATOM 5567 CA PHE H 67 9.545 42.842 -29.900 1.00 20.44 C ATOM 5568 C PHE H 67 10.561 41.790 -29.459 1.00 19.46 C ATOM 5569 O PHE H 67 11.540 42.142 -28.826 1.00 19.33 O ATOM 5570 CB PHE H 67 8.184 42.687 -29.161 1.00 21.54 C ATOM 5571 CG PHE H 67 8.351 42.374 -27.682 1.00 23.46 C ATOM 5572 CD1 PHE H 67 8.805 43.334 -26.799 1.00 24.36 C ATOM 5573 CD2 PHE H 67 8.178 41.087 -27.206 1.00 25.32 C ATOM 5574 CE1 PHE H 67 9.053 43.021 -25.467 1.00 25.24 C ATOM 5575 CE2 PHE H 67 8.425 40.781 -25.874 1.00 26.13 C ATOM 5576 CZ PHE H 67 8.868 41.753 -25.014 1.00 25.50 C ATOM 5577 N GLU H 68 10.381 40.530 -29.896 1.00 18.61 N ATOM 5578 CA GLU H 68 11.285 39.467 -29.516 1.00 18.32 C ATOM 5579 C GLU H 68 12.643 39.580 -30.179 1.00 17.20 C ATOM 5580 O GLU H 68 13.603 39.119 -29.593 1.00 17.14 O ATOM 5581 CB GLU H 68 10.661 38.085 -29.715 1.00 22.38 C ATOM 5582 CG GLU H 68 10.564 37.646 -31.163 1.00 31.72 C ATOM 5583 CD GLU H 68 9.494 36.605 -31.469 1.00 42.93 C ATOM 5584 OE1 GLU H 68 9.420 36.151 -32.640 1.00 44.34 O ATOM 5585 OE2 GLU H 68 8.721 36.256 -30.541 1.00 46.25 O ATOM 5586 N ARG H 69 12.759 40.228 -31.340 1.00 16.68 N ATOM 5587 CA ARG H 69 14.055 40.434 -31.977 1.00 17.23 C ATOM 5588 C ARG H 69 14.924 41.375 -31.119 1.00 19.37 C ATOM 5589 O ARG H 69 16.085 41.069 -30.830 1.00 19.95 O ATOM 5590 CB ARG H 69 13.866 41.037 -33.362 1.00 16.81 C ATOM 5591 CG ARG H 69 13.478 40.038 -34.409 1.00 16.78 C ATOM 5592 CD ARG H 69 13.797 40.628 -35.744 1.00 19.39 C ATOM 5593 NE ARG H 69 12.826 40.280 -36.779 1.00 21.03 N ATOM 5594 CZ ARG H 69 12.945 40.617 -38.062 1.00 22.84 C ATOM 5595 NH1 ARG H 69 14.012 41.280 -38.485 1.00 21.91 N ATOM 5596 NH2 ARG H 69 12.030 40.239 -38.941 1.00 23.57 N ATOM 5597 N ILE H 70 14.334 42.490 -30.662 1.00 20.18 N ATOM 5598 CA ILE H 70 15.028 43.470 -29.843 1.00 21.63 C ATOM 5599 C ILE H 70 15.270 42.938 -28.448 1.00 22.99 C ATOM 5600 O ILE H 70 16.414 42.915 -28.009 1.00 23.23 O ATOM 5601 CB ILE H 70 14.318 44.857 -29.859 1.00 22.37 C ATOM 5602 CG1 ILE H 70 14.152 45.373 -31.307 1.00 22.89 C ATOM 5603 CG2 ILE H 70 15.068 45.887 -29.000 1.00 23.04 C ATOM 5604 CD1 ILE H 70 13.390 46.617 -31.412 1.00 23.93 C ATOM 5605 N ALA H 71 14.219 42.430 -27.783 1.00 23.79 N ATOM 5606 CA ALA H 71 14.314 41.884 -26.425 1.00 24.56 C ATOM 5607 C ALA H 71 15.364 40.805 -26.305 1.00 25.19 C ATOM 5608 O ALA H 71 16.127 40.817 -25.350 1.00 25.67 O ATOM 5609 CB ALA H 71 12.963 41.363 -25.947 1.00 24.70 C ATOM 5610 N GLY H 72 15.431 39.919 -27.285 1.00 25.42 N ATOM 5611 CA GLY H 72 16.394 38.829 -27.296 1.00 26.08 C ATOM 5612 C GLY H 72 17.809 39.324 -27.463 1.00 26.79 C ATOM 5613 O GLY H 72 18.704 38.856 -26.766 1.00 26.48 O ATOM 5614 N GLU H 73 18.018 40.305 -28.352 1.00 27.74 N ATOM 5615 CA GLU H 73 19.347 40.879 -28.579 1.00 29.17 C ATOM 5616 C GLU H 73 19.841 41.630 -27.327 1.00 30.63 C ATOM 5617 O GLU H 73 21.022 41.570 -26.979 1.00 30.85 O ATOM 5618 CB GLU H 73 19.330 41.807 -29.802 1.00 30.88 C ATOM 5619 CG GLU H 73 20.695 42.367 -30.162 1.00 34.36 C ATOM 5620 CD GLU H 73 21.755 41.332 -30.487 1.00 38.79 C ATOM 5621 OE1 GLU H 73 22.729 41.221 -29.708 1.00 38.56 O ATOM 5622 OE2 GLU H 73 21.611 40.635 -31.519 1.00 40.54 O ATOM 5623 N ALA H 74 18.925 42.315 -26.643 1.00 31.16 N ATOM 5624 CA ALA H 74 19.228 43.017 -25.406 1.00 32.04 C ATOM 5625 C ALA H 74 19.506 42.021 -24.280 1.00 33.08 C ATOM 5626 O ALA H 74 20.341 42.292 -23.425 1.00 33.86 O ATOM 5627 CB ALA H 74 18.064 43.902 -25.028 1.00 32.29 C ATOM 5628 N SER H 75 18.814 40.879 -24.276 1.00 33.05 N ATOM 5629 CA SER H 75 19.018 39.800 -23.313 1.00 34.00 C ATOM 5630 C SER H 75 20.443 39.242 -23.425 1.00 34.67 C ATOM 5631 O SER H 75 21.036 38.853 -22.421 1.00 35.02 O ATOM 5632 CB SER H 75 18.009 38.678 -23.562 1.00 35.22 C ATOM 5633 OG SER H 75 18.312 37.498 -22.834 1.00 37.21 O ATOM 5634 N ARG H 76 20.966 39.178 -24.653 1.00 34.68 N ATOM 5635 CA ARG H 76 22.285 38.678 -24.960 1.00 35.11 C ATOM 5636 C ARG H 76 23.309 39.697 -24.556 1.00 36.71 C ATOM 5637 O ARG H 76 24.268 39.319 -23.926 1.00 36.84 O ATOM 5638 CB ARG H 76 22.388 38.404 -26.448 1.00 35.70 C ATOM 5639 CG ARG H 76 22.756 36.996 -26.767 1.00 37.90 C ATOM 5640 CD ARG H 76 22.486 36.732 -28.220 1.00 39.46 C ATOM 5641 NE ARG H 76 21.069 36.465 -28.440 1.00 40.22 N ATOM 5642 CZ ARG H 76 20.351 36.996 -29.417 1.00 41.23 C ATOM 5643 NH1 ARG H 76 20.908 37.847 -30.273 1.00 40.97 N ATOM 5644 NH2 ARG H 76 19.069 36.683 -29.549 1.00 40.81 N ATOM 5645 N LEU H 77 23.097 40.989 -24.877 1.00 37.90 N ATOM 5646 CA LEU H 77 23.991 42.100 -24.513 1.00 39.44 C ATOM 5647 C LEU H 77 24.218 42.146 -22.997 1.00 40.91 C ATOM 5648 O LEU H 77 25.361 42.190 -22.540 1.00 40.55 O ATOM 5649 CB LEU H 77 23.371 43.428 -24.974 1.00 39.50 C ATOM 5650 CG LEU H 77 23.519 43.734 -26.432 1.00 40.72 C ATOM 5651 CD1 LEU H 77 22.621 44.872 -26.831 1.00 41.54 C ATOM 5652 CD2 LEU H 77 24.935 44.080 -26.741 1.00 40.85 C ATOM 5653 N ALA H 78 23.120 42.074 -22.218 1.00 42.27 N ATOM 5654 CA ALA H 78 23.164 42.078 -20.767 1.00 44.28 C ATOM 5655 C ALA H 78 24.007 40.896 -20.273 1.00 46.87 C ATOM 5656 O ALA H 78 24.931 41.107 -19.496 1.00 46.88 O ATOM 5657 CB ALA H 78 21.757 42.028 -20.204 1.00 44.31 C ATOM 5658 N HIS H 79 23.784 39.691 -20.853 1.00 48.97 N ATOM 5659 CA HIS H 79 24.528 38.458 -20.568 1.00 51.30 C ATOM 5660 C HIS H 79 26.017 38.604 -20.882 1.00 51.55 C ATOM 5661 O HIS H 79 26.842 38.300 -20.034 1.00 51.67 O ATOM 5662 CB HIS H 79 23.974 37.276 -21.388 1.00 54.55 C ATOM 5663 CG HIS H 79 22.809 36.558 -20.775 1.00 61.29 C ATOM 5664 ND1 HIS H 79 21.626 36.353 -21.487 1.00 64.30 N ATOM 5665 CD2 HIS H 79 22.701 35.951 -19.568 1.00 63.39 C ATOM 5666 CE1 HIS H 79 20.834 35.670 -20.680 1.00 65.02 C ATOM 5667 NE2 HIS H 79 21.437 35.400 -19.514 1.00 64.91 N ATOM 5668 N TYR H 80 26.366 39.082 -22.087 1.00 51.73 N ATOM 5669 CA TYR H 80 27.753 39.233 -22.524 1.00 52.55 C ATOM 5670 C TYR H 80 28.537 40.104 -21.571 1.00 53.35 C ATOM 5671 O TYR H 80 29.704 39.829 -21.321 1.00 53.84 O ATOM 5672 CB TYR H 80 27.839 39.895 -23.906 1.00 52.72 C ATOM 5673 CG TYR H 80 27.268 39.117 -25.066 1.00 53.52 C ATOM 5674 CD1 TYR H 80 27.120 37.738 -25.003 1.00 54.28 C ATOM 5675 CD2 TYR H 80 26.841 39.765 -26.214 1.00 54.46 C ATOM 5676 CE1 TYR H 80 26.594 37.020 -26.071 1.00 55.15 C ATOM 5677 CE2 TYR H 80 26.333 39.059 -27.294 1.00 55.47 C ATOM 5678 CZ TYR H 80 26.217 37.685 -27.225 1.00 56.33 C ATOM 5679 OH TYR H 80 25.720 37.005 -28.316 1.00 57.88 O ATOM 5680 N ASN H 81 27.911 41.171 -21.060 1.00 53.41 N ATOM 5681 CA ASN H 81 28.591 42.102 -20.174 1.00 54.07 C ATOM 5682 C ASN H 81 28.337 41.811 -18.690 1.00 54.33 C ATOM 5683 O ASN H 81 28.349 42.726 -17.872 1.00 54.36 O ATOM 5684 CB ASN H 81 28.240 43.548 -20.549 1.00 55.36 C ATOM 5685 CG ASN H 81 28.421 43.853 -22.026 1.00 58.96 C ATOM 5686 OD1 ASN H 81 29.507 43.725 -22.611 1.00 59.98 O ATOM 5687 ND2 ASN H 81 27.351 44.261 -22.670 1.00 60.25 N