>>6LXT:HELIX   16 AB7 ASN F  914  GLU F  988  1                                  75    
NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 AB7 ASN F 914 GLU F 988 1 75 ATOM 4361 N ASN F 914 -16.129 17.156 -63.789 1.00129.92 N ANISOU 4361 N ASN F 914 19543 16681 13139 1282 1938 422 N ATOM 4362 CA ASN F 914 -15.291 16.567 -62.709 1.00129.24 C ANISOU 4362 CA ASN F 914 19028 16844 13235 1239 2074 522 C ATOM 4363 C ASN F 914 -15.647 17.209 -61.362 1.00127.17 C ANISOU 4363 C ASN F 914 18606 16471 13240 950 1865 511 C ATOM 4364 O ASN F 914 -15.285 16.632 -60.315 1.00131.10 O ANISOU 4364 O ASN F 914 18792 17090 13930 950 1905 521 O ATOM 4365 CB ASN F 914 -13.799 16.766 -62.988 1.00133.16 C ANISOU 4365 CB ASN F 914 19281 17741 13572 1146 2379 809 C ATOM 4366 CG ASN F 914 -13.250 15.809 -64.023 1.00141.05 C ANISOU 4366 CG ASN F 914 20306 18934 14352 1475 2619 814 C ATOM 4367 OD1 ASN F 914 -13.588 14.627 -64.024 1.00141.05 O ANISOU 4367 OD1 ASN F 914 20314 18873 14404 1790 2618 639 O ATOM 4368 ND2 ASN F 914 -12.383 16.309 -64.889 1.00146.82 N ANISOU 4368 ND2 ASN F 914 21050 19903 14831 1395 2833 1012 N ATOM 4369 N VAL F 915 -16.298 18.375 -61.397 1.00119.61 N ANISOU 4369 N VAL F 915 17868 15301 12279 726 1649 495 N ATOM 4370 CA VAL F 915 -16.807 19.117 -60.206 1.00119.65 C ANISOU 4370 CA VAL F 915 17777 15163 12521 454 1402 456 C ATOM 4371 C VAL F 915 -17.698 18.177 -59.385 1.00123.45 C ANISOU 4371 C VAL F 915 18187 15481 13238 608 1248 187 C ATOM 4372 O VAL F 915 -17.558 18.176 -58.146 1.00123.77 O ANISOU 4372 O VAL F 915 17949 15572 13505 458 1194 213 O ATOM 4373 CB VAL F 915 -17.556 20.398 -60.629 1.00126.19 C ANISOU 4373 CB VAL F 915 18954 15739 13254 283 1165 422 C ATOM 4374 CG1 VAL F 915 -18.199 21.110 -59.447 1.00123.96 C ANISOU 4374 CG1 VAL F 915 18595 15295 13209 43 881 341 C ATOM 4375 CG2 VAL F 915 -16.650 21.356 -61.391 1.00131.94 C ANISOU 4375 CG2 VAL F 915 19785 16608 13740 91 1334 702 C ATOM 4376 N LEU F 916 -18.565 17.400 -60.049 1.00130.82 N ANISOU 4376 N LEU F 916 19362 16231 14113 888 1189 -65 N ATOM 4377 CA LEU F 916 -19.515 16.455 -59.394 1.00119.28 C ANISOU 4377 CA LEU F 916 17882 14589 12849 1025 1056 -356 C ATOM 4378 C LEU F 916 -18.732 15.402 -58.603 1.00112.10 C ANISOU 4378 C LEU F 916 16656 13873 12065 1111 1254 -272 C ATOM 4379 O LEU F 916 -19.029 15.243 -57.410 1.00 99.04 O ANISOU 4379 O LEU F 916 14831 12160 10639 1001 1148 -343 O ATOM 4380 CB LEU F 916 -20.430 15.803 -60.439 1.00114.45 C ANISOU 4380 CB LEU F 916 17589 13787 12108 1315 1005 -630 C ATOM 4381 CG LEU F 916 -21.652 16.623 -60.870 1.00107.70 C ANISOU 4381 CG LEU F 916 17048 12669 11204 1275 711 -858 C ATOM 4382 CD1 LEU F 916 -22.449 15.886 -61.932 1.00104.43 C ANISOU 4382 CD1 LEU F 916 16916 12111 10653 1589 687 -1136 C ATOM 4383 CD2 LEU F 916 -22.562 16.955 -59.695 1.00102.39 C ANISOU 4383 CD2 LEU F 916 16292 11835 10777 1086 440 -1051 C ATOM 4384 N TYR F 917 -17.770 14.724 -59.239 1.00114.78 N ANISOU 4384 N TYR F 917 16927 14436 12247 1311 1524 -132 N ATOM 4385 CA TYR F 917 -16.908 13.697 -58.593 1.00114.81 C ANISOU 4385 CA TYR F 917 16649 14651 12321 1447 1722 -46 C ATOM 4386 C TYR F 917 -16.176 14.334 -57.410 1.00113.47 C ANISOU 4386 C TYR F 917 16141 14666 12305 1177 1725 152 C ATOM 4387 O TYR F 917 -16.218 13.746 -56.313 1.00113.45 O ANISOU 4387 O TYR F 917 15964 14650 12490 1193 1696 98 O ATOM 4388 CB TYR F 917 -15.860 13.111 -59.544 1.00121.97 C ANISOU 4388 CB TYR F 917 17520 15826 12997 1685 2005 96 C ATOM 4389 CG TYR F 917 -16.345 12.088 -60.542 1.00130.14 C ANISOU 4389 CG TYR F 917 18814 16736 13898 2029 2056 -93 C ATOM 4390 CD1 TYR F 917 -16.506 10.756 -60.188 1.00126.98 C ANISOU 4390 CD1 TYR F 917 18404 16270 13573 2280 2105 -242 C ATOM 4391 CD2 TYR F 917 -16.579 12.440 -61.864 1.00139.12 C ANISOU 4391 CD2 TYR F 917 20217 17826 14815 2112 2068 -115 C ATOM 4392 CE1 TYR F 917 -16.923 9.810 -61.112 1.00128.09 C ANISOU 4392 CE1 TYR F 917 18783 16296 13588 2590 2156 -420 C ATOM 4393 CE2 TYR F 917 -16.995 11.506 -62.802 1.00138.01 C ANISOU 4393 CE2 TYR F 917 20303 17586 14547 2437 2116 -294 C ATOM 4394 CZ TYR F 917 -17.167 10.185 -62.423 1.00129.56 C ANISOU 4394 CZ TYR F 917 19207 16451 13569 2672 2160 -450 C ATOM 4395 OH TYR F 917 -17.569 9.248 -63.330 1.00118.80 O ANISOU 4395 OH TYR F 917 18068 14985 12085 2987 2207 -634 O ATOM 4396 N GLU F 918 -15.530 15.487 -57.639 1.00112.06 N ANISOU 4396 N GLU F 918 15889 14650 12040 936 1763 368 N ATOM 4397 CA GLU F 918 -14.694 16.208 -56.634 1.00112.10 C ANISOU 4397 CA GLU F 918 15555 14874 12164 658 1789 574 C ATOM 4398 C GLU F 918 -15.564 16.612 -55.433 1.00105.32 C ANISOU 4398 C GLU F 918 14657 13792 11568 462 1518 452 C ATOM 4399 O GLU F 918 -15.050 16.591 -54.299 1.00100.53 O ANISOU 4399 O GLU F 918 13742 13331 11125 359 1533 536 O ATOM 4400 CB GLU F 918 -14.009 17.435 -57.251 1.00109.40 C ANISOU 4400 CB GLU F 918 15218 14690 11658 405 1870 796 C ATOM 4401 CG GLU F 918 -12.932 17.108 -58.275 1.00107.53 C ANISOU 4401 CG GLU F 918 14934 14758 11166 547 2172 947 C ATOM 4402 CD GLU F 918 -11.589 16.679 -57.707 1.00111.83 C ANISOU 4402 CD GLU F 918 15052 15716 11723 572 2405 1101 C ATOM 4403 OE1 GLU F 918 -11.578 15.989 -56.669 1.00114.69 O ANISOU 4403 OE1 GLU F 918 15207 16099 12271 674 2365 1032 O ATOM 4404 OE2 GLU F 918 -10.553 17.034 -58.307 1.00109.11 O ANISOU 4404 OE2 GLU F 918 14586 15680 11190 493 2628 1278 O ATOM 4405 N ASN F 919 -16.826 16.971 -55.675 1.00 99.90 N ANISOU 4405 N ASN F 919 14265 12783 10910 425 1277 250 N ATOM 4406 CA ASN F 919 -17.812 17.285 -54.611 1.00 96.45 C ANISOU 4406 CA ASN F 919 13815 12124 10708 266 1002 82 C ATOM 4407 C ASN F 919 -18.125 16.004 -53.830 1.00 91.88 C ANISOU 4407 C ASN F 919 13138 11488 10285 447 1022 -80 C ATOM 4408 O ASN F 919 -18.121 16.061 -52.591 1.00 90.32 O ANISOU 4408 O ASN F 919 12722 11305 10289 311 943 -71 O ATOM 4409 CB ASN F 919 -19.075 17.937 -55.188 1.00105.97 C ANISOU 4409 CB ASN F 919 15367 13030 11867 224 743 -127 C ATOM 4410 CG ASN F 919 -18.870 19.388 -55.573 1.00106.53 C ANISOU 4410 CG ASN F 919 15541 13104 11830 -21 657 33 C ATOM 4411 OD1 ASN F 919 -17.878 20.005 -55.186 1.00105.00 O ANISOU 4411 OD1 ASN F 919 15126 13120 11649 -228 762 287 O ATOM 4412 ND2 ASN F 919 -19.814 19.947 -56.314 1.00104.57 N ANISOU 4412 ND2 ASN F 919 15639 12622 11470 1 460 -127 N ATOM 4413 N GLN F 920 -18.387 14.898 -54.533 1.00 86.59 N ANISOU 4413 N GLN F 920 12641 10745 9515 741 1127 -221 N ATOM 4414 CA GLN F 920 -18.865 13.631 -53.921 1.00 90.71 C ANISOU 4414 CA GLN F 920 13165 11142 10158 915 1138 -414 C ATOM 4415 C GLN F 920 -17.785 13.085 -52.983 1.00 99.61 C ANISOU 4415 C GLN F 920 13982 12503 11362 958 1308 -231 C ATOM 4416 O GLN F 920 -18.120 12.805 -51.819 1.00103.15 O ANISOU 4416 O GLN F 920 14325 12867 12001 886 1219 -308 O ATOM 4417 CB GLN F 920 -19.259 12.616 -54.992 1.00 83.91 C ANISOU 4417 CB GLN F 920 12568 10167 9146 1218 1232 -586 C ATOM 4418 CG GLN F 920 -20.544 12.985 -55.716 1.00 88.04 C ANISOU 4418 CG GLN F 920 13397 10427 9628 1203 1028 -848 C ATOM 4419 CD GLN F 920 -21.325 11.778 -56.177 1.00 94.53 C ANISOU 4419 CD GLN F 920 14438 11059 10420 1450 1052 -1131 C ATOM 4420 OE1 GLN F 920 -20.764 10.733 -56.494 1.00 87.19 O ANISOU 4420 OE1 GLN F 920 13514 10207 9408 1693 1260 -1090 O ATOM 4421 NE2 GLN F 920 -22.642 11.918 -56.220 1.00 98.12 N ANISOU 4421 NE2 GLN F 920 15076 11268 10937 1392 834 -1441 N ATOM 4422 N LYS F 921 -16.542 12.959 -53.461 1.00 92.81 N ANISOU 4422 N LYS F 921 12978 11939 10348 1075 1537 -11 N ATOM 4423 CA LYS F 921 -15.378 12.552 -52.628 1.00 90.06 C ANISOU 4423 CA LYS F 921 12303 11874 10040 1135 1697 165 C ATOM 4424 C LYS F 921 -15.358 13.415 -51.365 1.00 92.35 C ANISOU 4424 C LYS F 921 12355 12196 10539 833 1550 238 C ATOM 4425 O LYS F 921 -15.244 12.827 -50.275 1.00 96.34 O ANISOU 4425 O LYS F 921 12712 12713 11181 886 1547 218 O ATOM 4426 CB LYS F 921 -14.052 12.711 -53.376 1.00 88.26 C ANISOU 4426 CB LYS F 921 11915 12011 9607 1214 1933 389 C ATOM 4427 CG LYS F 921 -13.844 11.766 -54.550 1.00 88.43 C ANISOU 4427 CG LYS F 921 12116 12071 9412 1550 2108 343 C ATOM 4428 CD LYS F 921 -12.845 12.292 -55.560 1.00 92.79 C ANISOU 4428 CD LYS F 921 12585 12932 9739 1539 2294 534 C ATOM 4429 CE LYS F 921 -12.766 11.452 -56.819 1.00 93.49 C ANISOU 4429 CE LYS F 921 12880 13038 9604 1864 2443 472 C ATOM 4430 NZ LYS F 921 -11.485 11.659 -57.536 1.00 91.85 N ANISOU 4430 NZ LYS F 921 12489 13232 9177 1908 2683 670 N ATOM 4431 N LEU F 922 -15.467 14.744 -51.511 1.00 88.91 N ANISOU 4431 N LEU F 922 11904 11763 10114 541 1429 318 N ATOM 4432 CA LEU F 922 -15.413 15.704 -50.377 1.00 79.78 C ANISOU 4432 CA LEU F 922 10520 10646 9147 235 1278 397 C ATOM 4433 C LEU F 922 -16.502 15.314 -49.376 1.00 88.64 C ANISOU 4433 C LEU F 922 11701 11499 10478 212 1077 183 C ATOM 4434 O LEU F 922 -16.145 14.981 -48.231 1.00 92.48 O ANISOU 4434 O LEU F 922 11957 12077 11105 210 1091 223 O ATOM 4435 CB LEU F 922 -15.595 17.140 -50.878 1.00 79.55 C ANISOU 4435 CB LEU F 922 10580 10575 9069 -52 1154 471 C ATOM 4436 CG LEU F 922 -15.560 18.223 -49.798 1.00 83.88 C ANISOU 4436 CG LEU F 922 10920 11150 9799 -377 984 550 C ATOM 4437 CD1 LEU F 922 -14.187 18.307 -49.145 1.00 85.85 C ANISOU 4437 CD1 LEU F 922 10773 11768 10078 -439 1162 770 C ATOM 4438 CD2 LEU F 922 -15.960 19.575 -50.369 1.00 84.14 C ANISOU 4438 CD2 LEU F 922 11144 11058 9766 -632 826 582 C ATOM 4439 N ILE F 923 -17.762 15.300 -49.820 1.00 89.72 N ANISOU 4439 N ILE F 923 12137 11333 10619 213 910 -49 N ATOM 4440 CA ILE F 923 -18.958 14.956 -48.991 1.00 76.32 C ANISOU 4440 CA ILE F 923 10525 9371 9103 165 714 -301 C ATOM 4441 C ILE F 923 -18.659 13.692 -48.168 1.00 75.51 C ANISOU 4441 C ILE F 923 10320 9296 9074 347 850 -320 C ATOM 4442 O ILE F 923 -18.780 13.747 -46.929 1.00 78.33 O ANISOU 4442 O ILE F 923 10512 9639 9609 223 759 -331 O ATOM 4443 CB ILE F 923 -20.207 14.789 -49.883 1.00 86.78 C ANISOU 4443 CB ILE F 923 12197 10420 10357 236 591 -578 C ATOM 4444 CG1 ILE F 923 -20.654 16.121 -50.490 1.00 87.68 C ANISOU 4444 CG1 ILE F 923 12437 10467 10410 53 399 -589 C ATOM 4445 CG2 ILE F 923 -21.341 14.129 -49.113 1.00 85.30 C ANISOU 4445 CG2 ILE F 923 12087 9997 10326 225 459 -864 C ATOM 4446 CD1 ILE F 923 -21.591 15.973 -51.665 1.00 84.88 C ANISOU 4446 CD1 ILE F 923 12425 9913 9914 191 324 -821 C ATOM 4447 N ALA F 924 -18.270 12.602 -48.835 1.00 72.82 N ANISOU 4447 N ALA F 924 10089 8989 8589 640 1055 -324 N ATOM 4448 CA ALA F 924 -17.970 11.281 -48.229 1.00 76.80 C ANISOU 4448 CA ALA F 924 10576 9491 9112 870 1198 -349 C ATOM 4449 C ALA F 924 -16.890 11.408 -47.143 1.00 83.26 C ANISOU 4449 C ALA F 924 11056 10570 10008 844 1266 -135 C ATOM 4450 O ALA F 924 -17.089 10.831 -46.052 1.00 89.17 O ANISOU 4450 O ALA F 924 11768 11232 10880 864 1238 -195 O ATOM 4451 CB ALA F 924 -17.550 10.309 -49.305 1.00 71.32 C ANISOU 4451 CB ALA F 924 10046 8839 8214 1193 1404 -350 C ATOM 4452 N ASN F 925 -15.791 12.124 -47.423 1.00 81.80 N ANISOU 4452 N ASN F 925 10636 10699 9744 797 1358 94 N ATOM 4453 CA ASN F 925 -14.633 12.293 -46.497 1.00 77.43 C ANISOU 4453 CA ASN F 925 9721 10456 9241 786 1438 291 C ATOM 4454 C ASN F 925 -15.071 13.111 -45.276 1.00 70.86 C ANISOU 4454 C ASN F 925 8731 9557 8636 491 1229 281 C ATOM 4455 O ASN F 925 -14.787 12.674 -44.144 1.00 70.94 O ANISOU 4455 O ASN F 925 8584 9622 8749 550 1234 300 O ATOM 4456 CB ASN F 925 -13.417 12.923 -47.191 1.00 73.07 C ANISOU 4456 CB ASN F 925 8956 10267 8540 766 1593 505 C ATOM 4457 CG ASN F 925 -12.737 11.996 -48.182 1.00 87.50 C ANISOU 4457 CG ASN F 925 10860 12245 10141 1100 1825 533 C ATOM 4458 OD1 ASN F 925 -12.601 10.798 -47.938 1.00 89.23 O ANISOU 4458 OD1 ASN F 925 11142 12438 10322 1398 1914 468 O ATOM 4459 ND2 ASN F 925 -12.308 12.536 -49.311 1.00 93.93 N ANISOU 4459 ND2 ASN F 925 11688 13212 10790 1057 1923 627 N ATOM 4460 N GLN F 926 -15.760 14.234 -45.502 1.00 78.85 N ANISOU 4460 N GLN F 926 9803 10446 9710 207 1044 242 N ATOM 4461 CA GLN F 926 -16.349 15.090 -44.433 1.00 80.14 C ANISOU 4461 CA GLN F 926 9852 10513 10085 -82 808 200 C ATOM 4462 C GLN F 926 -17.320 14.265 -43.581 1.00 72.57 C ANISOU 4462 C GLN F 926 9018 9298 9258 -29 710 -10 C ATOM 4463 O GLN F 926 -17.273 14.416 -42.341 1.00 69.98 O ANISOU 4463 O GLN F 926 8495 9005 9090 -133 626 12 O ATOM 4464 CB GLN F 926 -17.102 16.298 -45.005 1.00 81.76 C ANISOU 4464 CB GLN F 926 10196 10575 10295 -338 608 145 C ATOM 4465 CG GLN F 926 -16.243 17.302 -45.777 1.00 87.96 C ANISOU 4465 CG GLN F 926 10894 11572 10953 -465 683 354 C ATOM 4466 CD GLN F 926 -14.906 17.608 -45.142 1.00 88.54 C ANISOU 4466 CD GLN F 926 10589 11997 11054 -529 815 585 C ATOM 4467 OE1 GLN F 926 -14.801 17.838 -43.940 1.00 87.33 O ANISOU 4467 OE1 GLN F 926 10206 11901 11075 -641 722 607 O ATOM 4468 NE2 GLN F 926 -13.863 17.627 -45.955 1.00 89.34 N ANISOU 4468 NE2 GLN F 926 10612 12356 10978 -459 1036 746 N ATOM 4469 N PHE F 927 -18.176 13.457 -44.221 1.00 64.56 N ANISOU 4469 N PHE F 927 8315 8038 8176 110 723 -213 N ATOM 4470 CA PHE F 927 -19.170 12.577 -43.550 1.00 70.22 C ANISOU 4470 CA PHE F 927 9198 8490 8991 144 661 -443 C ATOM 4471 C PHE F 927 -18.437 11.551 -42.688 1.00 69.99 C ANISOU 4471 C PHE F 927 9072 8550 8970 347 822 -354 C ATOM 4472 O PHE F 927 -18.789 11.420 -41.507 1.00 71.91 O ANISOU 4472 O PHE F 927 9252 8712 9360 253 737 -411 O ATOM 4473 CB PHE F 927 -20.075 11.875 -44.562 1.00 64.32 C ANISOU 4473 CB PHE F 927 8798 7501 8140 268 682 -674 C ATOM 4474 CG PHE F 927 -21.081 10.940 -43.945 1.00 62.42 C ANISOU 4474 CG PHE F 927 8739 6993 7983 276 647 -926 C ATOM 4475 CD1 PHE F 927 -22.048 11.420 -43.079 1.00 63.50 C ANISOU 4475 CD1 PHE F 927 8843 6995 8290 22 436 -1093 C ATOM 4476 CD2 PHE F 927 -21.074 9.586 -44.234 1.00 64.59 C ANISOU 4476 CD2 PHE F 927 9230 7153 8160 526 826 -1006 C ATOM 4477 CE1 PHE F 927 -22.986 10.572 -42.508 1.00 61.86 C ANISOU 4477 CE1 PHE F 927 8801 6553 8151 -6 420 -1337 C ATOM 4478 CE2 PHE F 927 -22.018 8.741 -43.669 1.00 67.51 C ANISOU 4478 CE2 PHE F 927 9790 7262 8598 495 808 -1244 C ATOM 4479 CZ PHE F 927 -22.978 9.235 -42.813 1.00 59.88 C ANISOU 4479 CZ PHE F 927 8779 6174 7800 218 612 -1412 C ATOM 4480 N ASN F 928 -17.447 10.864 -43.270 1.00 70.96 N ANISOU 4480 N ASN F 928 9191 8841 8928 627 1043 -224 N ATOM 4481 CA ASN F 928 -16.657 9.795 -42.598 1.00 65.66 C ANISOU 4481 CA ASN F 928 8467 8266 8215 895 1205 -144 C ATOM 4482 C ASN F 928 -15.901 10.423 -41.423 1.00 76.33 C ANISOU 4482 C ASN F 928 9460 9857 9684 789 1158 22 C ATOM 4483 O ASN F 928 -15.827 9.783 -40.357 1.00 81.28 O ANISOU 4483 O ASN F 928 10070 10441 10371 884 1170 11 O ATOM 4484 CB ASN F 928 -15.725 9.062 -43.574 1.00 67.56 C ANISOU 4484 CB ASN F 928 8758 8677 8235 1226 1430 -50 C ATOM 4485 CG ASN F 928 -16.414 7.971 -44.375 1.00 69.33 C ANISOU 4485 CG ASN F 928 9363 8631 8348 1422 1504 -234 C ATOM 4486 OD1 ASN F 928 -17.550 7.591 -44.098 1.00 74.04 O ANISOU 4486 OD1 ASN F 928 10191 8911 9031 1329 1413 -442 O ATOM 4487 ND2 ASN F 928 -15.719 7.426 -45.358 1.00 66.77 N ANISOU 4487 ND2 ASN F 928 9099 8443 7828 1697 1676 -172 N ATOM 4488 N SER F 929 -15.378 11.637 -41.619 1.00 73.95 N ANISOU 4488 N SER F 929 8902 9788 9407 595 1106 165 N ATOM 4489 CA SER F 929 -14.741 12.471 -40.569 1.00 71.87 C ANISOU 4489 CA SER F 929 8276 9756 9274 430 1031 307 C ATOM 4490 C SER F 929 -15.726 12.654 -39.407 1.00 73.00 C ANISOU 4490 C SER F 929 8443 9672 9621 233 827 180 C ATOM 4491 O SER F 929 -15.426 12.183 -38.296 1.00 74.35 O ANISOU 4491 O SER F 929 8503 9888 9858 326 842 206 O ATOM 4492 CB SER F 929 -14.279 13.789 -41.157 1.00 79.63 C ANISOU 4492 CB SER F 929 9069 10944 10242 197 996 441 C ATOM 4493 OG SER F 929 -14.024 14.764 -40.150 1.00 78.68 O ANISOU 4493 OG SER F 929 8650 10961 10285 -45 864 527 O ATOM 4494 N ALA F 930 -16.885 13.255 -39.677 1.00 70.90 N ANISOU 4494 N ALA F 930 8334 9170 9434 -6 645 29 N ATOM 4495 CA ALA F 930 -17.920 13.605 -38.675 1.00 60.43 C ANISOU 4495 CA ALA F 930 7015 7647 8298 -234 425 -120 C ATOM 4496 C ALA F 930 -18.338 12.374 -37.861 1.00 70.97 C ANISOU 4496 C ALA F 930 8503 8800 9662 -88 483 -242 C ATOM 4497 O ALA F 930 -18.379 12.469 -36.614 1.00 68.99 O ANISOU 4497 O ALA F 930 8105 8563 9544 -172 400 -232 O ATOM 4498 CB ALA F 930 -19.108 14.224 -39.365 1.00 59.95 C ANISOU 4498 CB ALA F 930 7155 7367 8258 -433 247 -306 C ATOM 4499 N ILE F 931 -18.673 11.269 -38.531 1.00 66.21 N ANISOU 4499 N ILE F 931 8204 8018 8933 113 617 -359 N ATOM 4500 CA ILE F 931 -19.089 10.008 -37.853 1.00 67.62 C ANISOU 4500 CA ILE F 931 8599 7984 9110 250 696 -482 C ATOM 4501 C ILE F 931 -17.966 9.556 -36.922 1.00 71.42 C ANISOU 4501 C ILE F 931 8903 8660 9572 455 810 -293 C ATOM 4502 O ILE F 931 -18.279 9.192 -35.772 1.00 78.04 O ANISOU 4502 O ILE F 931 9764 9388 10498 421 770 -343 O ATOM 4503 CB ILE F 931 -19.436 8.909 -38.862 1.00 65.38 C ANISOU 4503 CB ILE F 931 8668 7505 8670 456 845 -613 C ATOM 4504 CG1 ILE F 931 -20.739 9.236 -39.593 1.00 66.29 C ANISOU 4504 CG1 ILE F 931 8978 7394 8814 255 713 -862 C ATOM 4505 CG2 ILE F 931 -19.482 7.555 -38.167 1.00 67.41 C ANISOU 4505 CG2 ILE F 931 9144 7587 8883 647 976 -670 C ATOM 4506 CD1 ILE F 931 -21.143 8.189 -40.601 1.00 71.36 C ANISOU 4506 CD1 ILE F 931 9960 7843 9312 443 849 -1016 C ATOM 4507 N GLY F 932 -16.722 9.557 -37.417 1.00 66.99 N ANISOU 4507 N GLY F 932 8179 8386 8887 669 948 -102 N ATOM 4508 CA GLY F 932 -15.535 9.173 -36.633 1.00 77.10 C ANISOU 4508 CA GLY F 932 9258 9914 10124 906 1052 65 C ATOM 4509 C GLY F 932 -15.540 9.898 -35.307 1.00 77.11 C ANISOU 4509 C GLY F 932 8994 9996 10308 707 899 110 C ATOM 4510 O GLY F 932 -15.534 9.215 -34.263 1.00 80.91 O ANISOU 4510 O GLY F 932 9533 10399 10810 826 916 94 O ATOM 4511 N LYS F 933 -15.625 11.231 -35.368 1.00 74.41 N ANISOU 4511 N LYS F 933 8408 9777 10087 408 749 154 N ATOM 4512 CA LYS F 933 -15.650 12.141 -34.197 1.00 71.01 C ANISOU 4512 CA LYS F 933 7693 9442 9844 179 574 196 C ATOM 4513 C LYS F 933 -16.845 11.799 -33.308 1.00 70.63 C ANISOU 4513 C LYS F 933 7835 9085 9917 49 451 17 C ATOM 4514 O LYS F 933 -16.680 11.757 -32.077 1.00 77.52 O ANISOU 4514 O LYS F 933 8570 10005 10879 52 401 50 O ATOM 4515 CB LYS F 933 -15.739 13.595 -34.658 1.00 71.74 C ANISOU 4515 CB LYS F 933 7593 9644 10022 -133 427 240 C ATOM 4516 CG LYS F 933 -14.565 14.083 -35.490 1.00 72.78 C ANISOU 4516 CG LYS F 933 7519 10095 10039 -76 553 418 C ATOM 4517 CD LYS F 933 -14.722 15.514 -35.930 1.00 86.02 C ANISOU 4517 CD LYS F 933 9071 11828 11786 -405 408 460 C ATOM 4518 CE LYS F 933 -13.551 16.017 -36.747 1.00 93.85 C ANISOU 4518 CE LYS F 933 9868 13137 12652 -390 554 637 C ATOM 4519 NZ LYS F 933 -13.824 17.357 -37.319 1.00 93.06 N ANISOU 4519 NZ LYS F 933 9749 13021 12588 -716 422 669 N ATOM 4520 N ILE F 934 -18.009 11.554 -33.903 1.00 77.61 N ANISOU 4520 N ILE F 934 9019 9674 10794 -60 407 -179 N ATOM 4521 CA ILE F 934 -19.258 11.279 -33.135 1.00 72.90 C ANISOU 4521 CA ILE F 934 8599 8792 10307 -232 291 -390 C ATOM 4522 C ILE F 934 -19.111 9.957 -32.387 1.00 59.42 C ANISOU 4522 C ILE F 934 7085 6962 8531 -2 443 -400 C ATOM 4523 O ILE F 934 -19.536 9.911 -31.234 1.00 58.18 O ANISOU 4523 O ILE F 934 6907 6722 8478 -112 362 -455 O ATOM 4524 CB ILE F 934 -20.484 11.323 -34.057 1.00 68.96 C ANISOU 4524 CB ILE F 934 8358 8047 9797 -389 218 -624 C ATOM 4525 CG1 ILE F 934 -20.789 12.780 -34.427 1.00 59.36 C ANISOU 4525 CG1 ILE F 934 6957 6923 8675 -653 2 -634 C ATOM 4526 CG2 ILE F 934 -21.668 10.611 -33.418 1.00 65.35 C ANISOU 4526 CG2 ILE F 934 8143 7296 9391 -496 187 -868 C ATOM 4527 CD1 ILE F 934 -21.575 12.951 -35.706 1.00 54.23 C ANISOU 4527 CD1 ILE F 934 6528 6126 7952 -712 -43 -801 C ATOM 4528 N GLN F 935 -18.501 8.948 -33.010 1.00 67.30 N ANISOU 4528 N GLN F 935 8269 7954 9349 314 651 -344 N ATOM 4529 CA GLN F 935 -18.173 7.647 -32.361 1.00 75.78 C ANISOU 4529 CA GLN F 935 9560 8919 10315 595 808 -325 C ATOM 4530 C GLN F 935 -17.341 7.905 -31.093 1.00 78.20 C ANISOU 4530 C GLN F 935 9584 9448 10680 675 771 -165 C ATOM 4531 O GLN F 935 -17.698 7.396 -30.008 1.00 72.72 O ANISOU 4531 O GLN F 935 9016 8595 10018 673 761 -215 O ATOM 4532 CB GLN F 935 -17.413 6.736 -33.328 1.00 73.73 C ANISOU 4532 CB GLN F 935 9473 8700 9840 955 1013 -258 C ATOM 4533 CG GLN F 935 -18.265 6.170 -34.456 1.00 84.89 C ANISOU 4533 CG GLN F 935 11235 9845 11173 934 1076 -437 C ATOM 4534 CD GLN F 935 -17.454 5.279 -35.367 1.00 97.17 C ANISOU 4534 CD GLN F 935 12947 11461 12514 1310 1271 -364 C ATOM 4535 OE1 GLN F 935 -17.940 4.267 -35.869 1.00102.77 O ANISOU 4535 OE1 GLN F 935 14027 11907 13114 1427 1377 -495 O ATOM 4536 NE2 GLN F 935 -16.199 5.651 -35.583 1.00100.31 N ANISOU 4536 NE2 GLN F 935 13052 12218 12843 1499 1321 -166 N ATOM 4537 N ASP F 936 -16.267 8.684 -31.216 1.00 85.65 N ANISOU 4537 N ASP F 936 10158 10753 11631 735 756 12 N ATOM 4538 CA ASP F 936 -15.393 9.045 -30.069 1.00 87.78 C ANISOU 4538 CA ASP F 936 10103 11289 11961 812 711 154 C ATOM 4539 C ASP F 936 -16.275 9.725 -29.007 1.00 78.24 C ANISOU 4539 C ASP F 936 8803 9965 10959 485 511 72 C ATOM 4540 O ASP F 936 -16.136 9.376 -27.820 1.00 77.63 O ANISOU 4540 O ASP F 936 8709 9879 10906 574 498 95 O ATOM 4541 CB ASP F 936 -14.172 9.876 -30.514 1.00 93.84 C ANISOU 4541 CB ASP F 936 10470 12477 12709 866 730 325 C ATOM 4542 CG ASP F 936 -12.914 9.085 -30.893 1.00 97.50 C ANISOU 4542 CG ASP F 936 10910 13175 12962 1289 928 431 C ATOM 4543 OD1 ASP F 936 -12.557 8.128 -30.158 1.00104.84 O ANISOU 4543 OD1 ASP F 936 11967 14072 13797 1592 1002 439 O ATOM 4544 OD2 ASP F 936 -12.270 9.442 -31.916 1.00 84.07 O ANISOU 4544 OD2 ASP F 936 9064 11701 11179 1324 1005 502 O ATOM 4545 N SER F 937 -17.187 10.620 -29.415 1.00 76.23 N ANISOU 4545 N SER F 937 8514 9617 10832 139 355 -34 N ATOM 4546 CA SER F 937 -18.055 11.414 -28.502 1.00 69.27 C ANISOU 4546 CA SER F 937 7513 8659 10148 -187 136 -130 C ATOM 4547 C SER F 937 -19.056 10.504 -27.779 1.00 62.22 C ANISOU 4547 C SER F 937 6936 7446 9258 -224 152 -303 C ATOM 4548 O SER F 937 -19.273 10.687 -26.568 1.00 52.76 O ANISOU 4548 O SER F 937 5634 6247 8167 -322 53 -316 O ATOM 4549 CB SER F 937 -18.769 12.502 -29.243 1.00 67.15 C ANISOU 4549 CB SER F 937 7177 8363 9973 -495 -32 -221 C ATOM 4550 OG SER F 937 -19.932 11.986 -29.868 1.00 79.60 O ANISOU 4550 OG SER F 937 9097 9636 11510 -582 -24 -440 O ATOM 4551 N LEU F 938 -19.660 9.559 -28.494 1.00 58.33 N ANISOU 4551 N LEU F 938 6823 6691 8650 -162 278 -439 N ATOM 4552 CA LEU F 938 -20.593 8.585 -27.881 1.00 62.71 C ANISOU 4552 CA LEU F 938 7720 6924 9182 -211 334 -613 C ATOM 4553 C LEU F 938 -19.838 7.738 -26.855 1.00 71.21 C ANISOU 4553 C LEU F 938 8870 8015 10172 66 457 -482 C ATOM 4554 O LEU F 938 -20.382 7.529 -25.760 1.00 76.07 O ANISOU 4554 O LEU F 938 9563 8495 10845 -50 415 -553 O ATOM 4555 CB LEU F 938 -21.211 7.707 -28.967 1.00 63.60 C ANISOU 4555 CB LEU F 938 8219 6779 9169 -167 468 -773 C ATOM 4556 CG LEU F 938 -22.150 8.426 -29.926 1.00 55.94 C ANISOU 4556 CG LEU F 938 7237 5750 8267 -432 339 -956 C ATOM 4557 CD1 LEU F 938 -22.669 7.451 -30.962 1.00 68.60 C ANISOU 4557 CD1 LEU F 938 9221 7111 9733 -347 489 -1114 C ATOM 4558 CD2 LEU F 938 -23.300 9.082 -29.180 1.00 55.25 C ANISOU 4558 CD2 LEU F 938 7067 5580 8347 -792 136 -1153 C ATOM 4559 N SER F 939 -18.634 7.272 -27.193 1.00 72.84 N ANISOU 4559 N SER F 939 9056 8388 10233 429 598 -306 N ATOM 4560 CA SER F 939 -17.802 6.411 -26.308 1.00 75.38 C ANISOU 4560 CA SER F 939 9468 8741 10432 770 714 -184 C ATOM 4561 C SER F 939 -17.505 7.162 -25.000 1.00 71.16 C ANISOU 4561 C SER F 939 8597 8404 10038 689 567 -100 C ATOM 4562 O SER F 939 -17.655 6.550 -23.920 1.00 74.56 O ANISOU 4562 O SER F 939 9200 8693 10436 763 594 -111 O ATOM 4563 CB SER F 939 -16.538 5.955 -27.017 1.00 75.29 C ANISOU 4563 CB SER F 939 9426 8941 10241 1173 860 -35 C ATOM 4564 OG SER F 939 -15.929 4.859 -26.344 1.00 75.17 O ANISOU 4564 OG SER F 939 9635 8869 10056 1545 986 29 O ATOM 4565 N SER F 940 -17.129 8.439 -25.100 1.00 63.49 N ANISOU 4565 N SER F 940 7184 7731 9208 533 420 -23 N ATOM 4566 CA SER F 940 -16.780 9.315 -23.956 1.00 63.81 C ANISOU 4566 CA SER F 940 6846 8000 9398 441 262 58 C ATOM 4567 C SER F 940 -18.017 9.514 -23.084 1.00 68.25 C ANISOU 4567 C SER F 940 7499 8332 10100 124 126 -95 C ATOM 4568 O SER F 940 -17.890 9.434 -21.849 1.00 57.99 O ANISOU 4568 O SER F 940 6136 7062 8837 171 82 -60 O ATOM 4569 CB SER F 940 -16.222 10.622 -24.436 1.00 65.95 C ANISOU 4569 CB SER F 940 6683 8594 9781 300 146 150 C ATOM 4570 OG SER F 940 -15.133 10.395 -25.322 1.00 75.32 O ANISOU 4570 OG SER F 940 7798 9997 10822 569 293 270 O ATOM 4571 N THR F 941 -19.175 9.743 -23.707 1.00 65.10 N ANISOU 4571 N THR F 941 7245 7725 9766 -176 62 -274 N ATOM 4572 CA THR F 941 -20.469 9.927 -23.000 1.00 60.18 C ANISOU 4572 CA THR F 941 6708 6894 9263 -504 -67 -468 C ATOM 4573 C THR F 941 -20.748 8.681 -22.143 1.00 61.44 C ANISOU 4573 C THR F 941 7229 6804 9312 -383 78 -516 C ATOM 4574 O THR F 941 -21.017 8.849 -20.928 1.00 56.50 O ANISOU 4574 O THR F 941 6525 6175 8766 -487 -9 -533 O ATOM 4575 CB THR F 941 -21.615 10.226 -23.975 1.00 53.58 C ANISOU 4575 CB THR F 941 5999 5888 8471 -786 -137 -683 C ATOM 4576 OG1 THR F 941 -21.286 11.367 -24.771 1.00 51.89 O ANISOU 4576 OG1 THR F 941 5495 5890 8332 -871 -265 -618 O ATOM 4577 CG2 THR F 941 -22.926 10.464 -23.260 1.00 49.55 C ANISOU 4577 CG2 THR F 941 5533 5214 8078 -1122 -279 -912 C ATOM 4578 N ALA F 942 -20.679 7.489 -22.752 1.00 53.62 N ANISOU 4578 N ALA F 942 6630 5607 8136 -172 291 -534 N ATOM 4579 CA ALA F 942 -20.869 6.165 -22.101 1.00 57.85 C ANISOU 4579 CA ALA F 942 7602 5861 8519 -24 465 -568 C ATOM 4580 C ALA F 942 -19.879 5.960 -20.935 1.00 66.29 C ANISOU 4580 C ALA F 942 8576 7077 9533 267 482 -380 C ATOM 4581 O ALA F 942 -20.291 5.396 -19.892 1.00 74.68 O ANISOU 4581 O ALA F 942 9869 7948 10557 238 520 -423 O ATOM 4582 CB ALA F 942 -20.738 5.069 -23.132 1.00 61.42 C ANISOU 4582 CB ALA F 942 8441 6118 8776 198 673 -590 C ATOM 4583 N SER F 943 -18.615 6.373 -21.090 1.00 58.80 N ANISOU 4583 N SER F 943 7311 6463 8567 542 462 -189 N ATOM 4584 CA SER F 943 -17.609 6.427 -19.990 1.00 64.88 C ANISOU 4584 CA SER F 943 7879 7460 9311 814 434 -27 C ATOM 4585 C SER F 943 -18.185 7.236 -18.819 1.00 64.85 C ANISOU 4585 C SER F 943 7643 7499 9498 521 249 -72 C ATOM 4586 O SER F 943 -18.367 6.673 -17.716 1.00 55.98 O ANISOU 4586 O SER F 943 6719 6233 8319 586 279 -78 O ATOM 4587 CB SER F 943 -16.296 7.047 -20.439 1.00 68.94 C ANISOU 4587 CB SER F 943 7980 8389 9825 1044 407 136 C ATOM 4588 OG SER F 943 -15.376 6.088 -20.929 1.00 83.52 O ANISOU 4588 OG SER F 943 10020 10269 11443 1480 585 219 O ATOM 4589 N ALA F 944 -18.463 8.517 -19.071 1.00 52.46 N ANISOU 4589 N ALA F 944 5685 6114 8134 216 60 -104 N ATOM 4590 CA ALA F 944 -18.904 9.495 -18.057 1.00 47.35 C ANISOU 4590 CA ALA F 944 4735 5571 7685 -56 -152 -142 C ATOM 4591 C ALA F 944 -20.141 8.981 -17.325 1.00 62.97 C ANISOU 4591 C ALA F 944 7027 7230 9669 -285 -146 -315 C ATOM 4592 O ALA F 944 -20.190 9.111 -16.100 1.00 46.19 O ANISOU 4592 O ALA F 944 4816 5141 7593 -306 -221 -298 O ATOM 4593 CB ALA F 944 -19.179 10.821 -18.709 1.00 45.37 C ANISOU 4593 CB ALA F 944 4135 5486 7618 -357 -341 -183 C ATOM 4594 N LEU F 945 -21.118 8.427 -18.050 1.00 61.51 N ANISOU 4594 N LEU F 945 7186 6754 9432 -461 -57 -490 N ATOM 4595 CA LEU F 945 -22.370 7.890 -17.443 1.00 54.94 C ANISOU 4595 CA LEU F 945 6667 5617 8592 -724 -24 -692 C ATOM 4596 C LEU F 945 -22.050 6.632 -16.626 1.00 61.45 C ANISOU 4596 C LEU F 945 7883 6242 9222 -462 172 -617 C ATOM 4597 O LEU F 945 -22.723 6.388 -15.587 1.00 61.15 O ANISOU 4597 O LEU F 945 7991 6055 9190 -628 170 -705 O ATOM 4598 CB LEU F 945 -23.396 7.610 -18.544 1.00 53.51 C ANISOU 4598 CB LEU F 945 6733 5206 8392 -957 32 -911 C ATOM 4599 CG LEU F 945 -23.984 8.855 -19.206 1.00 49.68 C ANISOU 4599 CG LEU F 945 5921 4868 8088 -1256 -188 -1037 C ATOM 4600 CD1 LEU F 945 -24.734 8.506 -20.484 1.00 45.03 C ANISOU 4600 CD1 LEU F 945 5577 4090 7444 -1376 -114 -1227 C ATOM 4601 CD2 LEU F 945 -24.896 9.585 -18.233 1.00 44.51 C ANISOU 4601 CD2 LEU F 945 5137 4342 7434 -1504 -370 -1100 C ATOM 4602 N GLY F 946 -21.058 5.852 -17.055 1.00 56.63 N ANISOU 4602 N GLY F 946 7455 5630 8431 -58 334 -466 N ATOM 4603 CA GLY F 946 -20.588 4.711 -16.253 1.00 58.91 C ANISOU 4603 CA GLY F 946 8118 5754 8513 263 498 -371 C ATOM 4604 C GLY F 946 -20.063 5.171 -14.905 1.00 53.00 C ANISOU 4604 C GLY F 946 7107 5210 7819 371 379 -254 C ATOM 4605 O GLY F 946 -20.565 4.678 -13.857 1.00 58.18 O ANISOU 4605 O GLY F 946 8023 5665 8418 302 422 -298 O ATOM 4606 N LYS F 947 -19.107 6.104 -14.931 1.00 51.41 N ANISOU 4606 N LYS F 947 6407 5402 7724 514 238 -118 N ATOM 4607 CA LYS F 947 -18.396 6.567 -13.715 1.00 51.35 C ANISOU 4607 CA LYS F 947 6099 5647 7763 683 121 3 C ATOM 4608 C LYS F 947 -19.420 7.180 -12.758 1.00 49.11 C ANISOU 4608 C LYS F 947 5704 5307 7649 292 -28 -114 C ATOM 4609 O LYS F 947 -19.409 6.806 -11.573 1.00 49.77 O ANISOU 4609 O LYS F 947 5920 5324 7667 390 -15 -84 O ATOM 4610 CB LYS F 947 -17.253 7.511 -14.097 1.00 51.13 C ANISOU 4610 CB LYS F 947 5540 6058 7830 846 8 135 C ATOM 4611 CG LYS F 947 -16.077 6.829 -14.796 1.00 63.78 C ANISOU 4611 CG LYS F 947 7229 7774 9232 1302 160 255 C ATOM 4612 CD LYS F 947 -14.963 7.786 -15.170 1.00 67.49 C ANISOU 4612 CD LYS F 947 7151 8700 9791 1418 64 364 C ATOM 4613 CE LYS F 947 -13.766 7.142 -15.837 1.00 64.28 C ANISOU 4613 CE LYS F 947 6786 8459 9179 1874 210 460 C ATOM 4614 NZ LYS F 947 -13.018 8.138 -16.640 1.00 59.08 N ANISOU 4614 NZ LYS F 947 5636 8185 8625 1823 147 518 N ATOM 4615 N LEU F 948 -20.312 8.029 -13.272 1.00 51.94 N ANISOU 4615 N LEU F 948 5865 5676 8195 -124 -160 -257 N ATOM 4616 CA LEU F 948 -21.404 8.645 -12.477 1.00 49.30 C ANISOU 4616 CA LEU F 948 5415 5297 8021 -521 -317 -410 C ATOM 4617 C LEU F 948 -22.267 7.534 -11.866 1.00 56.85 C ANISOU 4617 C LEU F 948 6885 5885 8832 -616 -151 -528 C ATOM 4618 O LEU F 948 -22.509 7.606 -10.642 1.00 57.89 O ANISOU 4618 O LEU F 948 6994 6016 8984 -680 -207 -537 O ATOM 4619 CB LEU F 948 -22.205 9.630 -13.341 1.00 44.62 C ANISOU 4619 CB LEU F 948 4583 4759 7611 -901 -477 -567 C ATOM 4620 CG LEU F 948 -21.493 10.962 -13.606 1.00 43.21 C ANISOU 4620 CG LEU F 948 3866 4946 7604 -897 -686 -460 C ATOM 4621 CD1 LEU F 948 -22.235 11.815 -14.616 1.00 38.45 C ANISOU 4621 CD1 LEU F 948 3244 4399 6966 -1144 -767 -562 C ATOM 4622 CD2 LEU F 948 -21.295 11.738 -12.318 1.00 40.43 C ANISOU 4622 CD2 LEU F 948 3182 4812 7368 -926 -868 -406 C ATOM 4623 N GLN F 949 -22.663 6.517 -12.641 1.00 56.96 N ANISOU 4623 N GLN F 949 7356 5597 8690 -613 56 -609 N ATOM 4624 CA GLN F 949 -23.529 5.421 -12.126 1.00 65.91 C ANISOU 4624 CA GLN F 949 9021 6350 9672 -748 240 -737 C ATOM 4625 C GLN F 949 -22.805 4.713 -10.972 1.00 74.98 C ANISOU 4625 C GLN F 949 10395 7445 10650 -406 335 -567 C ATOM 4626 O GLN F 949 -23.403 4.568 -9.881 1.00 83.75 O ANISOU 4626 O GLN F 949 11636 8438 11747 -578 338 -631 O ATOM 4627 CB GLN F 949 -23.904 4.427 -13.226 1.00 63.42 C ANISOU 4627 CB GLN F 949 9158 5732 9208 -755 452 -836 C ATOM 4628 CG GLN F 949 -24.768 3.272 -12.713 1.00 71.45 C ANISOU 4628 CG GLN F 949 10749 6343 10057 -916 662 -971 C ATOM 4629 CD GLN F 949 -25.291 2.339 -13.782 1.00 72.70 C ANISOU 4629 CD GLN F 949 11346 6190 10087 -990 863 -1110 C ATOM 4630 OE1 GLN F 949 -24.625 2.053 -14.777 1.00 68.52 O ANISOU 4630 OE1 GLN F 949 10873 5677 9485 -717 926 -1020 O ATOM 4631 NE2 GLN F 949 -26.497 1.835 -13.568 1.00 70.19 N ANISOU 4631 NE2 GLN F 949 11197 5773 9700 -1284 898 -1269 N ATOM 4632 N ASP F 950 -21.557 4.300 -11.189 1.00 68.56 N ANISOU 4632 N ASP F 950 9623 6726 9699 73 405 -367 N ATOM 4633 CA ASP F 950 -20.762 3.581 -10.160 1.00 73.45 C ANISOU 4633 CA ASP F 950 10480 7304 10122 478 488 -208 C ATOM 4634 C ASP F 950 -20.757 4.417 -8.876 1.00 75.57 C ANISOU 4634 C ASP F 950 10387 7795 10530 394 301 -178 C ATOM 4635 O ASP F 950 -21.247 3.896 -7.853 1.00 78.05 O ANISOU 4635 O ASP F 950 11012 7896 10746 326 369 -210 O ATOM 4636 CB ASP F 950 -19.351 3.245 -10.661 1.00 78.87 C ANISOU 4636 CB ASP F 950 11134 8165 10667 1019 538 -25 C ATOM 4637 CG ASP F 950 -19.306 2.171 -11.744 1.00 90.83 C ANISOU 4637 CG ASP F 950 13115 9412 11984 1178 747 -45 C ATOM 4638 OD1 ASP F 950 -20.281 1.395 -11.856 1.00 94.73 O ANISOU 4638 OD1 ASP F 950 14091 9513 12388 942 897 -177 O ATOM 4639 OD2 ASP F 950 -18.296 2.119 -12.474 1.00 96.64 O ANISOU 4639 OD2 ASP F 950 13722 10342 12653 1529 762 62 O ATOM 4640 N VAL F 951 -20.284 5.672 -8.955 1.00 73.85 N ANISOU 4640 N VAL F 951 9551 7975 10532 367 79 -129 N ATOM 4641 CA VAL F 951 -20.031 6.565 -7.780 1.00 66.57 C ANISOU 4641 CA VAL F 951 8210 7332 9753 360 -124 -76 C ATOM 4642 C VAL F 951 -21.352 6.922 -7.092 1.00 63.02 C ANISOU 4642 C VAL F 951 7767 6752 9426 -114 -204 -252 C ATOM 4643 O VAL F 951 -21.390 6.868 -5.842 1.00 74.52 O ANISOU 4643 O VAL F 951 9251 8212 10851 -71 -238 -224 O ATOM 4644 CB VAL F 951 -19.237 7.827 -8.165 1.00 56.38 C ANISOU 4644 CB VAL F 951 6277 6478 8667 407 -330 2 C ATOM 4645 CG1 VAL F 951 -19.183 8.832 -7.018 1.00 53.24 C ANISOU 4645 CG1 VAL F 951 5439 6342 8446 314 -556 17 C ATOM 4646 CG2 VAL F 951 -17.834 7.458 -8.636 1.00 60.19 C ANISOU 4646 CG2 VAL F 951 6718 7144 9008 902 -247 168 C ATOM 4647 N VAL F 952 -22.395 7.272 -7.847 1.00 62.03 N ANISOU 4647 N VAL F 952 7612 6532 9423 -535 -238 -439 N ATOM 4648 CA VAL F 952 -23.722 7.591 -7.241 1.00 64.97 C ANISOU 4648 CA VAL F 952 7984 6802 9899 -998 -315 -650 C ATOM 4649 C VAL F 952 -24.193 6.420 -6.364 1.00 66.51 C ANISOU 4649 C VAL F 952 8727 6663 9879 -1003 -104 -684 C ATOM 4650 O VAL F 952 -24.672 6.681 -5.250 1.00 68.41 O ANISOU 4650 O VAL F 952 8898 6930 10163 -1172 -180 -739 O ATOM 4651 CB VAL F 952 -24.786 7.940 -8.291 1.00 60.05 C ANISOU 4651 CB VAL F 952 7326 6100 9389 -1404 -354 -878 C ATOM 4652 CG1 VAL F 952 -26.164 7.916 -7.658 1.00 61.57 C ANISOU 4652 CG1 VAL F 952 7703 6282 9407 -1723 -363 -1002 C ATOM 4653 CG2 VAL F 952 -24.535 9.290 -8.941 1.00 48.01 C ANISOU 4653 CG2 VAL F 952 5268 4917 8057 -1464 -596 -857 C ATOM 4654 N ASN F 953 -24.066 5.185 -6.851 1.00 64.78 N ANISOU 4654 N ASN F 953 9047 6137 9431 -830 152 -653 N ATOM 4655 CA ASN F 953 -24.530 3.947 -6.165 1.00 57.66 C ANISOU 4655 CA ASN F 953 8770 4850 8287 -847 391 -687 C ATOM 4656 C ASN F 953 -23.675 3.647 -4.920 1.00 72.20 C ANISOU 4656 C ASN F 953 10706 6736 9989 -459 398 -487 C ATOM 4657 O ASN F 953 -24.259 3.228 -3.881 1.00 77.72 O ANISOU 4657 O ASN F 953 11694 7248 10588 -608 478 -537 O ATOM 4658 CB ASN F 953 -24.547 2.775 -7.146 1.00 59.18 C ANISOU 4658 CB ASN F 953 9499 4709 8277 -745 643 -705 C ATOM 4659 CG ASN F 953 -25.628 2.920 -8.193 1.00 65.55 C ANISOU 4659 CG ASN F 953 10301 5414 9192 -1179 663 -951 C ATOM 4660 OD1 ASN F 953 -26.642 3.583 -7.971 1.00 65.83 O ANISOU 4660 OD1 ASN F 953 10090 5538 9385 -1601 539 -1145 O ATOM 4661 ND2 ASN F 953 -25.416 2.297 -9.339 1.00 69.70 N ANISOU 4661 ND2 ASN F 953 11076 5788 9619 -1045 800 -948 N ATOM 4662 N GLN F 954 -22.348 3.812 -5.016 1.00 68.05 N ANISOU 4662 N GLN F 954 9967 6450 9437 24 330 -281 N ATOM 4663 CA GLN F 954 -21.398 3.655 -3.878 1.00 70.76 C ANISOU 4663 CA GLN F 954 10315 6912 9658 456 297 -100 C ATOM 4664 C GLN F 954 -21.795 4.622 -2.765 1.00 68.76 C ANISOU 4664 C GLN F 954 9658 6876 9591 222 93 -145 C ATOM 4665 O GLN F 954 -21.860 4.178 -1.608 1.00 74.43 O ANISOU 4665 O GLN F 954 10636 7474 10169 313 146 -105 O ATOM 4666 CB GLN F 954 -19.954 3.947 -4.292 1.00 81.95 C ANISOU 4666 CB GLN F 954 11406 8657 11076 950 211 75 C ATOM 4667 CG GLN F 954 -19.290 2.824 -5.088 1.00 92.47 C ANISOU 4667 CG GLN F 954 13186 9796 12152 1342 414 156 C ATOM 4668 CD GLN F 954 -18.920 1.617 -4.251 1.00101.38 C ANISOU 4668 CD GLN F 954 14914 10651 12955 1729 578 250 C ATOM 4669 OE1 GLN F 954 -18.644 1.714 -3.053 1.00106.91 O ANISOU 4669 OE1 GLN F 954 15580 11434 13607 1896 509 317 O ATOM 4670 NE2 GLN F 954 -18.897 0.455 -4.887 1.00 98.75 N ANISOU 4670 NE2 GLN F 954 15159 9981 12381 1895 794 255 N ATOM 4671 N ASN F 955 -22.058 5.882 -3.132 1.00 63.17 N ANISOU 4671 N ASN F 955 8363 6463 9174 -61 -131 -226 N ATOM 4672 CA ASN F 955 -22.456 6.978 -2.209 1.00 70.04 C ANISOU 4672 CA ASN F 955 8772 7581 10259 -305 -367 -288 C ATOM 4673 C ASN F 955 -23.844 6.706 -1.626 1.00 70.97 C ANISOU 4673 C ASN F 955 9163 7447 10356 -756 -299 -483 C ATOM 4674 O ASN F 955 -24.062 7.041 -0.444 1.00 66.31 O ANISOU 4674 O ASN F 955 8448 6946 9799 -823 -397 -493 O ATOM 4675 CB ASN F 955 -22.405 8.340 -2.899 1.00 57.53 C ANISOU 4675 CB ASN F 955 6559 6333 8965 -493 -615 -334 C ATOM 4676 CG ASN F 955 -20.988 8.789 -3.187 1.00 63.89 C ANISOU 4676 CG ASN F 955 7005 7461 9811 -81 -706 -145 C ATOM 4677 OD1 ASN F 955 -20.029 8.049 -2.964 1.00 66.54 O ANISOU 4677 OD1 ASN F 955 7550 7783 9951 370 -585 6 O ATOM 4678 ND2 ASN F 955 -20.847 10.005 -3.684 1.00 57.50 N ANISOU 4678 ND2 ASN F 955 5660 6947 9242 -234 -919 -164 N ATOM 4679 N ALA F 956 -24.749 6.125 -2.410 1.00 62.83 N ANISOU 4679 N ALA F 956 8477 6128 9266 -1058 -136 -645 N ATOM 4680 CA ALA F 956 -26.089 5.718 -1.937 1.00 63.58 C ANISOU 4680 CA ALA F 956 8881 5969 9308 -1505 -25 -861 C ATOM 4681 C ALA F 956 -25.938 4.607 -0.890 1.00 72.76 C ANISOU 4681 C ALA F 956 10600 6854 10191 -1314 190 -760 C ATOM 4682 O ALA F 956 -26.622 4.674 0.155 1.00 77.13 O ANISOU 4682 O ALA F 956 11197 7375 10733 -1558 183 -849 O ATOM 4683 CB ALA F 956 -26.944 5.282 -3.094 1.00 65.95 C ANISOU 4683 CB ALA F 956 9429 6037 9592 -1817 115 -1058 C ATOM 4684 N GLN F 957 -25.064 3.630 -1.136 1.00 80.19 N ANISOU 4684 N GLN F 957 11961 7607 10902 -881 370 -582 N ATOM 4685 CA GLN F 957 -24.891 2.486 -0.203 1.00 87.04 C ANISOU 4685 CA GLN F 957 13447 8163 11461 -660 584 -479 C ATOM 4686 C GLN F 957 -24.218 2.985 1.085 1.00 81.73 C ANISOU 4686 C GLN F 957 12510 7742 10801 -374 421 -332 C ATOM 4687 O GLN F 957 -24.665 2.588 2.182 1.00 86.33 O ANISOU 4687 O GLN F 957 13397 8159 11247 -471 507 -348 O ATOM 4688 CB GLN F 957 -24.121 1.336 -0.858 1.00 99.13 C ANISOU 4688 CB GLN F 957 15501 9432 12732 -239 794 -341 C ATOM 4689 CG GLN F 957 -24.260 0.014 -0.104 1.00106.50 C ANISOU 4689 CG GLN F 957 17219 9927 13319 -126 1058 -290 C ATOM 4690 CD GLN F 957 -25.700 -0.414 0.073 1.00101.04 C ANISOU 4690 CD GLN F 957 16890 8915 12586 -720 1237 -512 C ATOM 4691 OE1 GLN F 957 -26.220 -0.499 1.187 1.00 90.14 O ANISOU 4691 OE1 GLN F 957 15666 7449 11134 -910 1279 -548 O ATOM 4692 NE2 GLN F 957 -26.367 -0.669 -1.040 1.00104.50 N ANISOU 4692 NE2 GLN F 957 17425 9214 13067 -1024 1339 -676 N ATOM 4693 N ALA F 958 -23.197 3.833 0.964 1.00 78.23 N ANISOU 4693 N ALA F 958 11520 7691 10513 -51 200 -205 N ATOM 4694 CA ALA F 958 -22.518 4.460 2.119 1.00 68.51 C ANISOU 4694 CA ALA F 958 9936 6762 9334 218 10 -87 C ATOM 4695 C ALA F 958 -23.580 5.108 3.013 1.00 60.67 C ANISOU 4695 C ALA F 958 8737 5829 8485 -241 -101 -239 C ATOM 4696 O ALA F 958 -23.599 4.834 4.206 1.00 74.00 O ANISOU 4696 O ALA F 958 10616 7457 10042 -147 -73 -191 O ATOM 4697 CB ALA F 958 -21.481 5.447 1.645 1.00 61.86 C ANISOU 4697 CB ALA F 958 8455 6355 8695 482 -218 7 C ATOM 4698 N LEU F 959 -24.481 5.901 2.442 1.00 70.38 N ANISOU 4698 N LEU F 959 9620 7163 9958 -723 -218 -431 N ATOM 4699 CA LEU F 959 -25.520 6.624 3.216 1.00 66.36 C ANISOU 4699 CA LEU F 959 8849 6762 9603 -1167 -356 -608 C ATOM 4700 C LEU F 959 -26.475 5.630 3.880 1.00 67.19 C ANISOU 4700 C LEU F 959 9551 6496 9481 -1432 -107 -715 C ATOM 4701 O LEU F 959 -26.849 5.854 5.039 1.00 60.14 O ANISOU 4701 O LEU F 959 8603 5665 8581 -1549 -163 -750 O ATOM 4702 CB LEU F 959 -26.283 7.538 2.262 1.00 61.48 C ANISOU 4702 CB LEU F 959 7816 6294 9248 -1590 -515 -812 C ATOM 4703 CG LEU F 959 -27.374 8.390 2.901 1.00 59.24 C ANISOU 4703 CG LEU F 959 7281 6280 8948 -1947 -651 -932 C ATOM 4704 CD1 LEU F 959 -26.905 8.972 4.226 1.00 58.95 C ANISOU 4704 CD1 LEU F 959 6915 6439 9046 -1801 -829 -879 C ATOM 4705 CD2 LEU F 959 -27.786 9.497 1.943 1.00 59.85 C ANISOU 4705 CD2 LEU F 959 7145 6835 8759 -1933 -716 -801 C ATOM 4706 N ASN F 960 -26.870 4.578 3.164 1.00 70.19 N ANISOU 4706 N ASN F 960 10485 6505 9680 -1541 165 -773 N ATOM 4707 CA ASN F 960 -27.771 3.527 3.708 1.00 74.57 C ANISOU 4707 CA ASN F 960 11678 6664 9992 -1822 446 -879 C ATOM 4708 C ASN F 960 -27.074 2.795 4.862 1.00 87.11 C ANISOU 4708 C ASN F 960 13687 8101 11309 -1417 560 -665 C ATOM 4709 O ASN F 960 -27.745 2.592 5.891 1.00 97.89 O ANISOU 4709 O ASN F 960 15261 9357 12574 -1655 639 -736 O ATOM 4710 CB ASN F 960 -28.267 2.575 2.619 1.00 68.85 C ANISOU 4710 CB ASN F 960 11384 5644 9132 -1963 688 -967 C ATOM 4711 CG ASN F 960 -29.215 3.253 1.652 1.00 68.27 C ANISOU 4711 CG ASN F 960 10682 5990 9266 -2156 494 -1099 C ATOM 4712 OD1 ASN F 960 -30.124 3.973 2.062 1.00 66.20 O ANISOU 4712 OD1 ASN F 960 9949 6076 9129 -2270 295 -1160 O ATOM 4713 ND2 ASN F 960 -29.020 3.022 0.364 1.00 74.53 N ANISOU 4713 ND2 ASN F 960 11521 6724 10073 -2089 538 -1104 N ATOM 4714 N THR F 961 -25.788 2.442 4.729 1.00 69.52 N ANISOU 4714 N THR F 961 11567 5886 8960 -823 561 -426 N ATOM 4715 CA THR F 961 -25.017 1.766 5.813 1.00 77.49 C ANISOU 4715 CA THR F 961 12975 6775 9694 -352 642 -222 C ATOM 4716 C THR F 961 -24.954 2.715 7.016 1.00 77.44 C ANISOU 4716 C THR F 961 12487 7108 9829 -342 407 -205 C ATOM 4717 O THR F 961 -25.294 2.267 8.125 1.00 82.69 O ANISOU 4717 O THR F 961 13509 7602 10306 -385 512 -192 O ATOM 4718 CB THR F 961 -23.633 1.260 5.366 1.00 78.84 C ANISOU 4718 CB THR F 961 13299 6946 9709 308 661 -5 C ATOM 4719 OG1 THR F 961 -22.805 2.367 5.017 1.00 89.17 O ANISOU 4719 OG1 THR F 961 13869 8730 11281 534 381 54 O ATOM 4720 CG2 THR F 961 -23.695 0.288 4.206 1.00 72.41 C ANISOU 4720 CG2 THR F 961 12983 5789 8741 316 891 -23 C ATOM 4721 N LEU F 962 -24.575 3.978 6.786 1.00 68.46 N ANISOU 4721 N LEU F 962 10585 6421 9005 -311 106 -213 N ATOM 4722 CA LEU F 962 -24.533 5.055 7.815 1.00 64.63 C ANISOU 4722 CA LEU F 962 9544 6305 8709 -331 -160 -219 C ATOM 4723 C LEU F 962 -25.873 5.099 8.555 1.00 63.12 C ANISOU 4723 C LEU F 962 9465 6000 8519 -871 -107 -411 C ATOM 4724 O LEU F 962 -25.866 5.037 9.799 1.00 67.12 O ANISOU 4724 O LEU F 962 10066 6520 8915 -779 -118 -360 O ATOM 4725 CB LEU F 962 -24.223 6.399 7.140 1.00 54.57 C ANISOU 4725 CB LEU F 962 7481 5463 7792 -383 -461 -257 C ATOM 4726 CG LEU F 962 -24.318 7.649 8.020 1.00 55.63 C ANISOU 4726 CG LEU F 962 6986 5984 8167 -488 -762 -304 C ATOM 4727 CD1 LEU F 962 -23.369 7.577 9.203 1.00 57.45 C ANISOU 4727 CD1 LEU F 962 7203 6349 8275 4 -826 -126 C ATOM 4728 CD2 LEU F 962 -24.021 8.888 7.203 1.00 58.96 C ANISOU 4728 CD2 LEU F 962 6721 6768 8915 -557 -1030 -340 C ATOM 4729 N VAL F 963 -26.985 5.181 7.824 1.00 69.43 N ANISOU 4729 N VAL F 963 10259 6699 9424 -1408 -47 -637 N ATOM 4730 CA VAL F 963 -28.333 5.305 8.446 1.00 68.48 C ANISOU 4730 CA VAL F 963 10172 6525 9321 -1970 -8 -870 C ATOM 4731 C VAL F 963 -28.545 4.147 9.426 1.00 68.61 C ANISOU 4731 C VAL F 963 10902 6178 8990 -1942 279 -809 C ATOM 4732 O VAL F 963 -28.891 4.434 10.584 1.00 69.57 O ANISOU 4732 O VAL F 963 10936 6402 9095 -2052 219 -842 O ATOM 4733 CB VAL F 963 -29.455 5.385 7.397 1.00 66.50 C ANISOU 4733 CB VAL F 963 9795 6288 9185 -2378 25 -1089 C ATOM 4734 CG1 VAL F 963 -30.811 5.061 8.010 1.00 72.93 C ANISOU 4734 CG1 VAL F 963 10609 7214 9887 -2512 106 -1154 C ATOM 4735 CG2 VAL F 963 -29.489 6.755 6.740 1.00 55.40 C ANISOU 4735 CG2 VAL F 963 7592 5346 8112 -2274 -343 -1083 C ATOM 4736 N LYS F 964 -28.328 2.901 8.981 1.00 70.90 N ANISOU 4736 N LYS F 964 11878 6055 9004 -1791 575 -721 N ATOM 4737 CA LYS F 964 -28.537 1.667 9.792 1.00 74.82 C ANISOU 4737 CA LYS F 964 13177 6126 9127 -1773 886 -657 C ATOM 4738 C LYS F 964 -27.679 1.737 11.055 1.00 76.80 C ANISOU 4738 C LYS F 964 13438 6491 9252 -1290 788 -441 C ATOM 4739 O LYS F 964 -28.268 1.611 12.138 1.00 89.79 O ANISOU 4739 O LYS F 964 15273 8065 10779 -1502 861 -490 O ATOM 4740 CB LYS F 964 -28.237 0.401 8.981 1.00 85.88 C ANISOU 4740 CB LYS F 964 15277 7086 10267 -1593 1173 -573 C ATOM 4741 CG LYS F 964 -29.320 0.055 7.969 1.00 92.56 C ANISOU 4741 CG LYS F 964 16082 7945 11143 -2039 1301 -773 C ATOM 4742 CD LYS F 964 -29.030 -1.139 7.089 1.00101.90 C ANISOU 4742 CD LYS F 964 17797 8837 12084 -1839 1535 -688 C ATOM 4743 CE LYS F 964 -29.886 -1.150 5.837 1.00104.51 C ANISOU 4743 CE LYS F 964 17775 9398 12536 -2127 1531 -849 C ATOM 4744 NZ LYS F 964 -29.282 -1.975 4.764 1.00106.15 N ANISOU 4744 NZ LYS F 964 18365 9360 12609 -1874 1671 -763 N ATOM 4745 N GLN F 965 -26.365 1.965 10.918 1.00 69.59 N ANISOU 4745 N GLN F 965 12300 5774 8366 -679 624 -232 N ATOM 4746 CA GLN F 965 -25.405 2.034 12.054 1.00 70.01 C ANISOU 4746 CA GLN F 965 12333 5971 8296 -135 510 -32 C ATOM 4747 C GLN F 965 -25.750 3.217 12.964 1.00 75.26 C ANISOU 4747 C GLN F 965 12358 7034 9204 -333 246 -116 C ATOM 4748 O GLN F 965 -25.519 3.084 14.177 1.00 74.91 O ANISOU 4748 O GLN F 965 12468 6995 8999 -110 237 -23 O ATOM 4749 CB GLN F 965 -23.959 2.108 11.568 1.00 70.03 C ANISOU 4749 CB GLN F 965 12142 6159 8306 521 379 158 C ATOM 4750 CG GLN F 965 -23.477 0.798 10.961 1.00 87.71 C ANISOU 4750 CG GLN F 965 15113 7989 10225 846 640 271 C ATOM 4751 CD GLN F 965 -22.014 0.799 10.581 1.00 91.92 C ANISOU 4751 CD GLN F 965 15480 8724 10722 1535 518 443 C ATOM 4752 OE1 GLN F 965 -21.148 1.214 11.352 1.00 92.13 O ANISOU 4752 OE1 GLN F 965 15219 9039 10746 1981 335 551 O ATOM 4753 NE2 GLN F 965 -21.717 0.296 9.392 1.00 86.44 N ANISOU 4753 NE2 GLN F 965 14974 7887 9984 1639 624 458 N ATOM 4754 N LEU F 966 -26.296 4.311 12.422 1.00 74.69 N ANISOU 4754 N LEU F 966 11623 7269 9485 -725 36 -290 N ATOM 4755 CA LEU F 966 -26.742 5.479 13.234 1.00 72.22 C ANISOU 4755 CA LEU F 966 10695 7331 9414 -959 -230 -402 C ATOM 4756 C LEU F 966 -27.944 5.086 14.091 1.00 67.42 C ANISOU 4756 C LEU F 966 10436 6522 8657 -1426 -57 -554 C ATOM 4757 O LEU F 966 -27.968 5.451 15.276 1.00 61.63 O ANISOU 4757 O LEU F 966 9557 5951 7909 -1370 -166 -533 O ATOM 4758 CB LEU F 966 -27.115 6.661 12.336 1.00 68.14 C ANISOU 4758 CB LEU F 966 9475 7137 9279 -1282 -480 -569 C ATOM 4759 CG LEU F 966 -25.953 7.458 11.754 1.00 65.08 C ANISOU 4759 CG LEU F 966 8540 7083 9106 -879 -732 -438 C ATOM 4760 CD1 LEU F 966 -26.475 8.537 10.824 1.00 66.92 C ANISOU 4760 CD1 LEU F 966 8191 7559 9676 -1257 -945 -615 C ATOM 4761 CD2 LEU F 966 -25.101 8.066 12.851 1.00 63.63 C ANISOU 4761 CD2 LEU F 966 7995 7214 8968 -474 -955 -302 C ATOM 4762 N SER F 967 -28.917 4.401 13.499 1.00 61.31 N ANISOU 4762 N SER F 967 10082 5429 7784 -1885 199 -717 N ATOM 4763 CA SER F 967 -30.146 3.963 14.206 1.00 66.44 C ANISOU 4763 CA SER F 967 11087 5878 8279 -2404 405 -899 C ATOM 4764 C SER F 967 -29.765 2.975 15.321 1.00 80.42 C ANISOU 4764 C SER F 967 13537 7348 9671 -2106 626 -706 C ATOM 4765 O SER F 967 -30.351 3.094 16.423 1.00 84.65 O ANISOU 4765 O SER F 967 14099 7929 10134 -2328 643 -776 O ATOM 4766 CB SER F 967 -31.176 3.410 13.252 1.00 59.56 C ANISOU 4766 CB SER F 967 10381 4873 7375 -2799 616 -1071 C ATOM 4767 OG SER F 967 -32.380 4.162 13.337 1.00 65.57 O ANISOU 4767 OG SER F 967 10444 6139 8329 -2961 450 -1205 O ATOM 4768 N SER F 968 -28.791 2.085 15.079 1.00 63.74 N ANISOU 4768 N SER F 968 11934 4963 7321 -1593 769 -474 N ATOM 4769 CA SER F 968 -28.233 1.149 16.099 1.00 70.54 C ANISOU 4769 CA SER F 968 13468 5537 7798 -1181 946 -262 C ATOM 4770 C SER F 968 -27.627 1.923 17.278 1.00 78.96 C ANISOU 4770 C SER F 968 14104 6967 8931 -819 679 -152 C ATOM 4771 O SER F 968 -27.862 1.515 18.439 1.00 87.18 O ANISOU 4771 O SER F 968 15534 7863 9729 -817 797 -109 O ATOM 4772 CB SER F 968 -27.206 0.221 15.510 1.00 72.54 C ANISOU 4772 CB SER F 968 14231 5508 7822 -632 1076 -53 C ATOM 4773 OG SER F 968 -27.814 -0.982 15.082 1.00 74.09 O ANISOU 4773 OG SER F 968 15221 5182 7746 -908 1441 -101 O ATOM 4774 N ASN F 969 -26.847 2.971 16.987 1.00 75.69 N ANISOU 4774 N ASN F 969 12942 6998 8820 -517 342 -107 N ATOM 4775 CA ASN F 969 -26.192 3.838 18.002 1.00 72.52 C ANISOU 4775 CA ASN F 969 12025 6998 8532 -159 48 -20 C ATOM 4776 C ASN F 969 -27.253 4.576 18.823 1.00 78.88 C ANISOU 4776 C ASN F 969 12484 8005 9483 -665 -54 -207 C ATOM 4777 O ASN F 969 -27.140 4.559 20.059 1.00 84.19 O ANISOU 4777 O ASN F 969 13255 8722 10011 -489 -79 -138 O ATOM 4778 CB ASN F 969 -25.224 4.837 17.373 1.00 70.28 C ANISOU 4778 CB ASN F 969 10995 7144 8563 176 -273 33 C ATOM 4779 CG ASN F 969 -24.010 4.159 16.790 1.00 80.56 C ANISOU 4779 CG ASN F 969 12588 8324 9697 776 -203 226 C ATOM 4780 OD1 ASN F 969 -23.901 2.934 16.837 1.00 88.83 O ANISOU 4780 OD1 ASN F 969 14413 8949 10389 958 74 322 O ATOM 4781 ND2 ASN F 969 -23.101 4.945 16.238 1.00 81.69 N ANISOU 4781 ND2 ASN F 969 12122 8836 10082 1078 -450 274 N ATOM 4782 N PHE F 970 -28.242 5.204 18.180 1.00 71.89 N ANISOU 4782 N PHE F 970 11207 7249 8860 -1249 -120 -446 N ATOM 4783 CA PHE F 970 -29.269 6.005 18.896 1.00 76.09 C ANISOU 4783 CA PHE F 970 11333 8029 9550 -1729 -255 -660 C ATOM 4784 C PHE F 970 -30.076 5.071 19.789 1.00 76.25 C ANISOU 4784 C PHE F 970 12026 7712 9233 -2012 61 -706 C ATOM 4785 O PHE F 970 -30.251 5.405 20.976 1.00 76.73 O ANISOU 4785 O PHE F 970 11966 7933 9254 -2013 -24 -712 O ATOM 4786 CB PHE F 970 -30.171 6.808 17.956 1.00 78.64 C ANISOU 4786 CB PHE F 970 11142 8546 10191 -2269 -389 -930 C ATOM 4787 CG PHE F 970 -29.484 8.006 17.355 1.00 74.41 C ANISOU 4787 CG PHE F 970 9841 8417 10013 -2046 -758 -904 C ATOM 4788 CD1 PHE F 970 -28.818 8.911 18.166 1.00 76.68 C ANISOU 4788 CD1 PHE F 970 9611 9075 10449 -1721 -1062 -813 C ATOM 4789 CD2 PHE F 970 -29.466 8.205 15.984 1.00 64.70 C ANISOU 4789 CD2 PHE F 970 8436 7190 8956 -2151 -792 -966 C ATOM 4790 CE1 PHE F 970 -28.144 9.991 17.619 1.00 72.51 C ANISOU 4790 CE1 PHE F 970 8412 8903 10235 -1528 -1383 -784 C ATOM 4791 CE2 PHE F 970 -28.796 9.287 15.439 1.00 67.94 C ANISOU 4791 CE2 PHE F 970 8187 7954 9672 -1951 -1113 -928 C ATOM 4792 CZ PHE F 970 -28.135 10.177 16.256 1.00 70.65 C ANISOU 4792 CZ PHE F 970 8030 8654 10159 -1651 -1402 -838 C ATOM 4793 N GLY F 971 -30.515 3.935 19.242 1.00 74.27 N ANISOU 4793 N GLY F 971 12473 7006 8739 -2236 418 -732 N ATOM 4794 CA GLY F 971 -31.195 2.878 20.014 1.00 80.98 C ANISOU 4794 CA GLY F 971 14092 7459 9217 -2495 776 -751 C ATOM 4795 C GLY F 971 -30.453 2.604 21.307 1.00 80.02 C ANISOU 4795 C GLY F 971 14255 7302 8848 -1994 770 -518 C ATOM 4796 O GLY F 971 -31.049 2.797 22.386 1.00 82.19 O ANISOU 4796 O GLY F 971 14512 7663 9052 -2226 779 -595 O ATOM 4797 N ALA F 972 -29.176 2.223 21.198 1.00 83.59 N ANISOU 4797 N ALA F 972 14917 7666 9177 -1308 734 -257 N ATOM 4798 CA ALA F 972 -28.268 1.967 22.340 1.00 87.53 C ANISOU 4798 CA ALA F 972 15670 8153 9434 -699 693 -25 C ATOM 4799 C ALA F 972 -28.249 3.183 23.287 1.00 77.96 C ANISOU 4799 C ALA F 972 13713 7447 8461 -659 357 -75 C ATOM 4800 O ALA F 972 -28.452 2.981 24.499 1.00 79.20 O ANISOU 4800 O ALA F 972 14135 7552 8405 -632 423 -37 O ATOM 4801 CB ALA F 972 -26.893 1.610 21.824 1.00 89.31 C ANISOU 4801 CB ALA F 972 16025 8328 9580 18 632 199 C ATOM 4802 N ILE F 973 -28.064 4.403 22.767 1.00 68.85 N ANISOU 4802 N ILE F 973 11682 6752 7727 -682 16 -164 N ATOM 4803 CA ILE F 973 -27.923 5.636 23.604 1.00 75.28 C ANISOU 4803 CA ILE F 973 11742 8067 8794 -591 -343 -205 C ATOM 4804 C ILE F 973 -29.198 5.820 24.428 1.00 78.37 C ANISOU 4804 C ILE F 973 12131 8488 9159 -1169 -277 -403 C ATOM 4805 O ILE F 973 -29.100 5.907 25.665 1.00 80.60 O ANISOU 4805 O ILE F 973 12451 8863 9311 -991 -326 -342 O ATOM 4806 CB ILE F 973 -27.595 6.885 22.758 1.00 71.07 C ANISOU 4806 CB ILE F 973 10322 7970 8710 -589 -696 -284 C ATOM 4807 CG1 ILE F 973 -26.171 6.822 22.205 1.00 67.80 C ANISOU 4807 CG1 ILE F 973 9827 7619 8314 59 -796 -78 C ATOM 4808 CG2 ILE F 973 -27.805 8.165 23.553 1.00 59.02 C ANISOU 4808 CG2 ILE F 973 8050 6919 7456 -682 -1039 -392 C ATOM 4809 CD1 ILE F 973 -25.905 7.771 21.065 1.00 64.17 C ANISOU 4809 CD1 ILE F 973 8685 7460 8236 -11 -1038 -148 C ATOM 4810 N SER F 974 -30.352 5.870 23.770 1.00 78.71 N ANISOU 4810 N SER F 974 12127 8470 9309 -1828 -169 -646 N ATOM 4811 CA SER F 974 -31.652 6.103 24.440 1.00 74.06 C ANISOU 4811 CA SER F 974 11466 7960 8714 -2437 -113 -890 C ATOM 4812 C SER F 974 -31.857 5.040 25.528 1.00 77.78 C ANISOU 4812 C SER F 974 12732 8074 8746 -2426 215 -789 C ATOM 4813 O SER F 974 -32.249 5.427 26.641 1.00 85.04 O ANISOU 4813 O SER F 974 13491 9187 9634 -2535 140 -849 O ATOM 4814 CB SER F 974 -32.790 6.163 23.456 1.00 63.98 C ANISOU 4814 CB SER F 974 10091 6642 7578 -3102 -15 -1177 C ATOM 4815 OG SER F 974 -33.359 4.883 23.267 1.00 75.62 O ANISOU 4815 OG SER F 974 12385 7624 8722 -3402 421 -1204 O ATOM 4816 N SER F 975 -31.557 3.765 25.250 1.00 75.27 N ANISOU 4816 N SER F 975 13253 7256 8091 -2268 555 -632 N ATOM 4817 CA SER F 975 -31.611 2.676 26.266 1.00 87.98 C ANISOU 4817 CA SER F 975 15723 8468 9239 -2182 877 -496 C ATOM 4818 C SER F 975 -30.850 3.143 27.509 1.00 81.04 C ANISOU 4818 C SER F 975 14631 7846 8316 -1645 646 -329 C ATOM 4819 O SER F 975 -31.482 3.334 28.563 1.00 86.31 O ANISOU 4819 O SER F 975 15282 8615 8898 -1894 667 -413 O ATOM 4820 CB SER F 975 -31.053 1.356 25.759 1.00 93.04 C ANISOU 4820 CB SER F 975 17243 8567 9542 -1889 1187 -299 C ATOM 4821 OG SER F 975 -31.507 1.064 24.447 1.00 99.68 O ANISOU 4821 OG SER F 975 18152 9233 10487 -2259 1326 -433 O ATOM 4822 N VAL F 976 -29.548 3.380 27.344 1.00 80.70 N ANISOU 4822 N VAL F 976 14370 7943 8349 -946 420 -124 N ATOM 4823 CA VAL F 976 -28.605 3.736 28.442 1.00 84.09 C ANISOU 4823 CA VAL F 976 14627 8606 8717 -311 195 52 C ATOM 4824 C VAL F 976 -29.184 4.939 29.191 1.00 77.80 C ANISOU 4824 C VAL F 976 13075 8290 8197 -595 -83 -121 C ATOM 4825 O VAL F 976 -29.280 4.861 30.421 1.00 84.10 O ANISOU 4825 O VAL F 976 14051 9107 8795 -497 -61 -76 O ATOM 4826 CB VAL F 976 -27.185 3.987 27.896 1.00 85.79 C ANISOU 4826 CB VAL F 976 14546 8991 9059 396 -39 225 C ATOM 4827 CG1 VAL F 976 -26.221 4.464 28.977 1.00 88.20 C ANISOU 4827 CG1 VAL F 976 14569 9603 9341 1036 -302 362 C ATOM 4828 CG2 VAL F 976 -26.652 2.737 27.210 1.00 83.86 C ANISOU 4828 CG2 VAL F 976 15094 8265 8505 688 242 383 C ATOM 4829 N LEU F 977 -29.615 5.971 28.468 1.00 74.57 N ANISOU 4829 N LEU F 977 11898 8230 8206 -954 -322 -320 N ATOM 4830 CA LEU F 977 -30.117 7.230 29.076 1.00 82.36 C ANISOU 4830 CA LEU F 977 12095 9708 9491 -1193 -640 -499 C ATOM 4831 C LEU F 977 -31.328 6.933 29.965 1.00 84.79 C ANISOU 4831 C LEU F 977 12705 9918 9595 -1726 -430 -657 C ATOM 4832 O LEU F 977 -31.379 7.460 31.084 1.00 86.75 O ANISOU 4832 O LEU F 977 12686 10428 9846 -1635 -593 -669 O ATOM 4833 CB LEU F 977 -30.475 8.236 27.979 1.00 81.84 C ANISOU 4833 CB LEU F 977 11290 9945 9862 -1532 -886 -700 C ATOM 4834 CG LEU F 977 -29.297 8.970 27.338 1.00 69.88 C ANISOU 4834 CG LEU F 977 9218 8701 8632 -1036 -1202 -579 C ATOM 4835 CD1 LEU F 977 -29.793 9.914 26.253 1.00 68.65 C ANISOU 4835 CD1 LEU F 977 8420 8792 8870 -1437 -1413 -789 C ATOM 4836 CD2 LEU F 977 -28.480 9.729 28.376 1.00 60.82 C ANISOU 4836 CD2 LEU F 977 7614 7922 7573 -540 -1515 -474 C ATOM 4837 N ASN F 978 -32.262 6.115 29.491 1.00 80.72 N ANISOU 4837 N ASN F 978 12721 9046 8903 -2266 -75 -781 N ATOM 4838 CA ASN F 978 -33.507 5.793 30.236 1.00 93.17 C ANISOU 4838 CA ASN F 978 14592 10530 10279 -2863 166 -970 C ATOM 4839 C ASN F 978 -33.140 5.032 31.514 1.00 99.82 C ANISOU 4839 C ASN F 978 16092 11131 10704 -2530 358 -756 C ATOM 4840 O ASN F 978 -33.767 5.319 32.559 1.00102.90 O ANISOU 4840 O ASN F 978 16379 11694 11025 -2769 348 -862 O ATOM 4841 CB ASN F 978 -34.503 5.023 29.365 1.00100.92 C ANISOU 4841 CB ASN F 978 16022 11170 11154 -3498 522 -1156 C ATOM 4842 CG ASN F 978 -35.003 5.836 28.184 1.00 93.40 C ANISOU 4842 CG ASN F 978 14398 10487 10601 -3862 318 -1408 C ATOM 4843 OD1 ASN F 978 -35.284 7.027 28.311 1.00 87.87 O ANISOU 4843 OD1 ASN F 978 12872 10283 10231 -3900 -23 -1544 O ATOM 4844 ND2 ASN F 978 -35.102 5.210 27.020 1.00 80.38 N ANISOU 4844 ND2 ASN F 978 13072 8537 8931 -4022 520 -1433 N ATOM 4845 N ASP F 979 -32.163 4.116 31.421 1.00100.05 N ANISOU 4845 N ASP F 979 16767 10786 10460 -1984 516 -475 N ATOM 4846 CA ASP F 979 -31.593 3.356 32.568 1.00107.19 C ANISOU 4846 CA ASP F 979 18351 11433 10942 -1516 670 -233 C ATOM 4847 C ASP F 979 -31.066 4.374 33.587 1.00111.36 C ANISOU 4847 C ASP F 979 18233 12447 11633 -1104 289 -191 C ATOM 4848 O ASP F 979 -31.541 4.340 34.745 1.00115.97 O ANISOU 4848 O ASP F 979 18977 13062 12024 -1235 359 -217 O ATOM 4849 CB ASP F 979 -30.526 2.358 32.096 1.00105.39 C ANISOU 4849 CB ASP F 979 18798 10790 10455 -926 822 34 C ATOM 4850 CG ASP F 979 -29.944 1.466 33.182 1.00112.45 C ANISOU 4850 CG ASP F 979 20497 11361 10869 -419 998 278 C ATOM 4851 OD1 ASP F 979 -30.697 1.103 34.120 1.00121.53 O ANISOU 4851 OD1 ASP F 979 22067 12357 11751 -749 1217 237 O ATOM 4852 OD2 ASP F 979 -28.745 1.123 33.066 1.00109.12 O ANISOU 4852 OD2 ASP F 979 20293 10841 10327 306 919 498 O ATOM 4853 N ILE F 980 -30.180 5.282 33.148 1.00116.67 N ANISOU 4853 N ILE F 980 18176 13496 12657 -675 -97 -149 N ATOM 4854 CA ILE F 980 -29.495 6.294 34.012 1.00108.36 C ANISOU 4854 CA ILE F 980 16459 12921 11790 -207 -494 -100 C ATOM 4855 C ILE F 980 -30.555 7.146 34.723 1.00100.92 C ANISOU 4855 C ILE F 980 15004 12326 11016 -729 -628 -337 C ATOM 4856 O ILE F 980 -30.378 7.397 35.931 1.00101.31 O ANISOU 4856 O ILE F 980 14983 12551 10961 -474 -739 -283 O ATOM 4857 CB ILE F 980 -28.479 7.134 33.207 1.00101.29 C ANISOU 4857 CB ILE F 980 14853 12361 11273 212 -854 -56 C ATOM 4858 CG1 ILE F 980 -27.254 6.291 32.831 1.00103.71 C ANISOU 4858 CG1 ILE F 980 15666 12386 11352 879 -751 194 C ATOM 4859 CG2 ILE F 980 -28.086 8.395 33.967 1.00 89.14 C ANISOU 4859 CG2 ILE F 980 12480 11373 10017 473 -1281 -96 C ATOM 4860 CD1 ILE F 980 -26.350 6.901 31.776 1.00 99.85 C ANISOU 4860 CD1 ILE F 980 14598 12146 11196 1185 -1009 221 C ATOM 4861 N LEU F 981 -31.624 7.540 34.020 1.00 97.12 N ANISOU 4861 N LEU F 981 14200 11940 10763 -1417 -614 -599 N ATOM 4862 CA LEU F 981 -32.718 8.382 34.579 1.00 98.87 C ANISOU 4862 CA LEU F 981 13891 12519 11155 -1952 -754 -872 C ATOM 4863 C LEU F 981 -33.455 7.617 35.687 1.00107.75 C ANISOU 4863 C LEU F 981 15653 13415 11873 -2224 -427 -889 C ATOM 4864 O LEU F 981 -33.772 8.241 36.723 1.00117.87 O ANISOU 4864 O LEU F 981 16583 15016 13185 -2270 -594 -974 O ATOM 4865 CB LEU F 981 -33.683 8.794 33.462 1.00 85.85 C ANISOU 4865 CB LEU F 981 11871 10965 9784 -2601 -771 -1159 C ATOM 4866 CG LEU F 981 -33.160 9.841 32.478 1.00 88.94 C ANISOU 4866 CG LEU F 981 11487 11682 10626 -2433 -1155 -1200 C ATOM 4867 CD1 LEU F 981 -34.180 10.084 31.375 1.00 77.90 C ANISOU 4867 CD1 LEU F 981 9856 10310 9431 -3074 -1124 -1486 C ATOM 4868 CD2 LEU F 981 -32.791 11.152 33.173 1.00 79.64 C ANISOU 4868 CD2 LEU F 981 9488 11032 9738 -2165 -1616 -1231 C ATOM 4869 N SER F 982 -33.725 6.324 35.478 1.00104.61 N ANISOU 4869 N SER F 982 16163 12483 11102 -2410 24 -814 N ATOM 4870 CA SER F 982 -34.349 5.425 36.485 1.00111.11 C ANISOU 4870 CA SER F 982 17745 12997 11474 -2661 400 -795 C ATOM 4871 C SER F 982 -33.427 5.297 37.701 1.00116.28 C ANISOU 4871 C SER F 982 18638 13653 11890 -1974 316 -532 C ATOM 4872 O SER F 982 -33.941 5.369 38.832 1.00122.04 O ANISOU 4872 O SER F 982 19437 14483 12448 -2134 367 -585 O ATOM 4873 CB SER F 982 -34.670 4.074 35.907 1.00107.71 C ANISOU 4873 CB SER F 982 18255 11964 10704 -2939 882 -745 C ATOM 4874 OG SER F 982 -35.667 4.182 34.909 1.00 99.95 O ANISOU 4874 OG SER F 982 17057 11002 9916 -3633 978 -1030 O ATOM 4875 N ARG F 983 -32.120 5.119 37.477 1.00117.12 N ANISOU 4875 N ARG F 983 18852 13671 11978 -1231 190 -275 N ATOM 4876 CA ARG F 983 -31.108 4.995 38.560 1.00117.87 C ANISOU 4876 CA ARG F 983 19156 13783 11845 -480 80 -30 C ATOM 4877 C ARG F 983 -31.061 6.298 39.366 1.00116.46 C ANISOU 4877 C ARG F 983 18077 14205 11966 -358 -340 -133 C ATOM 4878 O ARG F 983 -30.991 6.206 40.601 1.00118.88 O ANISOU 4878 O ARG F 983 18592 14547 12031 -133 -330 -56 O ATOM 4879 CB ARG F 983 -29.723 4.634 38.009 1.00116.60 C ANISOU 4879 CB ARG F 983 19180 13475 11648 277 -5 212 C ATOM 4880 CG ARG F 983 -29.537 3.147 37.742 1.00118.32 C ANISOU 4880 CG ARG F 983 20513 13042 11401 397 418 392 C ATOM 4881 CD ARG F 983 -28.213 2.784 37.087 1.00121.09 C ANISOU 4881 CD ARG F 983 21022 13267 11720 1124 330 597 C ATOM 4882 NE ARG F 983 -28.264 1.449 36.493 1.00133.53 N ANISOU 4882 NE ARG F 983 23576 14224 12934 1066 731 705 N ATOM 4883 CZ ARG F 983 -27.241 0.812 35.919 1.00136.62 C ANISOU 4883 CZ ARG F 983 24357 14374 13179 1651 756 885 C ATOM 4884 NH1 ARG F 983 -26.047 1.377 35.852 1.00134.74 N ANISOU 4884 NH1 ARG F 983 23599 14477 13120 2349 411 974 N ATOM 4885 NH2 ARG F 983 -27.420 -0.396 35.408 1.00138.92 N ANISOU 4885 NH2 ARG F 983 25556 14089 13137 1530 1129 962 N ATOM 4886 N LEU F 984 -31.109 7.459 38.703 1.00121.53 N ANISOU 4886 N LEU F 984 17784 15290 13102 -500 -694 -301 N ATOM 4887 CA LEU F 984 -31.057 8.796 39.363 1.00112.76 C ANISOU 4887 CA LEU F 984 15758 14765 12320 -396 -1131 -417 C ATOM 4888 C LEU F 984 -32.285 9.010 40.252 1.00115.72 C ANISOU 4888 C LEU F 984 16077 15280 12611 -964 -1053 -623 C ATOM 4889 O LEU F 984 -32.112 9.570 41.352 1.00112.76 O ANISOU 4889 O LEU F 984 15394 15210 12240 -707 -1269 -613 O ATOM 4890 CB LEU F 984 -30.987 9.898 38.306 1.00103.45 C ANISOU 4890 CB LEU F 984 13696 13950 11659 -530 -1476 -569 C ATOM 4891 CG LEU F 984 -29.584 10.348 37.919 1.00104.99 C ANISOU 4891 CG LEU F 984 13507 14323 12063 166 -1773 -399 C ATOM 4892 CD1 LEU F 984 -29.658 11.334 36.769 1.00103.81 C ANISOU 4892 CD1 LEU F 984 12595 14460 12388 -76 -2048 -556 C ATOM 4893 CD2 LEU F 984 -28.850 10.967 39.100 1.00103.50 C ANISOU 4893 CD2 LEU F 984 12951 14480 11896 723 -2072 -316 C ATOM 4894 N ASP F 985 -33.470 8.610 39.776 1.00117.81 N ANISOU 4894 N ASP F 985 16591 15359 12812 -1703 -766 -821 N ATOM 4895 CA ASP F 985 -34.752 8.682 40.533 1.00121.14 C ANISOU 4895 CA ASP F 985 17023 15891 13115 -2331 -627 -1055 C ATOM 4896 C ASP F 985 -34.657 7.842 41.814 1.00125.26 C ANISOU 4896 C ASP F 985 18295 16150 13149 -2123 -355 -875 C ATOM 4897 O ASP F 985 -35.116 8.323 42.874 1.00131.43 O ANISOU 4897 O ASP F 985 18818 17223 13897 -2236 -456 -979 O ATOM 4898 CB ASP F 985 -35.935 8.203 39.687 1.00129.56 C ANISOU 4898 CB ASP F 985 18335 16743 14148 -3127 -309 -1292 C ATOM 4899 CG ASP F 985 -36.391 9.184 38.617 1.00134.92 C ANISOU 4899 CG ASP F 985 18199 17766 15297 -3477 -592 -1560 C ATOM 4900 OD1 ASP F 985 -35.881 10.324 38.602 1.00133.86 O ANISOU 4900 OD1 ASP F 985 17274 18061 15524 -3159 -1045 -1577 O ATOM 4901 OD2 ASP F 985 -37.259 8.799 37.804 1.00139.02 O ANISOU 4901 OD2 ASP F 985 18895 18117 15808 -4067 -356 -1759 O ATOM 4902 N LYS F 986 -34.090 6.635 41.717 1.00119.90 N ANISOU 4902 N LYS F 986 18527 14935 12094 -1823 -28 -620 N ATOM 4903 CA LYS F 986 -33.956 5.687 42.853 1.00119.79 C ANISOU 4903 CA LYS F 986 19382 14576 11557 -1598 271 -423 C ATOM 4904 C LYS F 986 -32.912 6.230 43.840 1.00127.09 C ANISOU 4904 C LYS F 986 20006 15787 12494 -808 -70 -246 C ATOM 4905 O LYS F 986 -33.152 6.085 45.052 1.00133.90 O ANISOU 4905 O LYS F 986 21132 16665 13079 -773 14 -214 O ATOM 4906 CB LYS F 986 -33.708 4.272 42.315 1.00116.20 C ANISOU 4906 CB LYS F 986 19981 13453 10716 -1540 703 -231 C ATOM 4907 CG LYS F 986 -34.955 3.681 41.670 1.00113.82 C ANISOU 4907 CG LYS F 986 20047 12874 10325 -2418 1095 -442 C ATOM 4908 CD LYS F 986 -34.864 2.277 41.116 1.00113.12 C ANISOU 4908 CD LYS F 986 21015 12109 9856 -2466 1546 -286 C ATOM 4909 CE LYS F 986 -36.050 1.998 40.213 1.00113.30 C ANISOU 4909 CE LYS F 986 21105 11995 9950 -3342 1824 -557 C ATOM 4910 NZ LYS F 986 -36.124 0.583 39.785 1.00115.91 N ANISOU 4910 NZ LYS F 986 22523 11643 9873 -3489 2306 -433 N ATOM 4911 N VAL F 987 -31.850 6.897 43.361 1.00129.58 N ANISOU 4911 N VAL F 987 19742 16361 13133 -236 -447 -162 N ATOM 4912 CA VAL F 987 -30.796 7.515 44.228 1.00129.58 C ANISOU 4912 CA VAL F 987 19348 16693 13195 532 -810 -27 C ATOM 4913 C VAL F 987 -31.407 8.733 44.931 1.00124.02 C ANISOU 4913 C VAL F 987 17793 16549 12781 266 -1127 -249 C ATOM 4914 O VAL F 987 -31.173 8.880 46.144 1.00130.31 O ANISOU 4914 O VAL F 987 18604 17497 13412 607 -1222 -181 O ATOM 4915 CB VAL F 987 -29.510 7.871 43.449 1.00124.47 C ANISOU 4915 CB VAL F 987 18309 16173 12811 1164 -1100 96 C ATOM 4916 CG1 VAL F 987 -28.609 8.829 44.220 1.00120.96 C ANISOU 4916 CG1 VAL F 987 17185 16212 12563 1798 -1542 136 C ATOM 4917 CG2 VAL F 987 -28.730 6.622 43.058 1.00122.72 C ANISOU 4917 CG2 VAL F 987 18985 15422 12222 1607 -818 343 C ATOM 4918 N GLU F 988 -32.160 9.562 44.199 1.00116.48 N ATOM 4919 CA GLU F 988 -33.028 10.627 44.773 1.00118.16 C ATOM 4920 C GLU F 988 -34.227 9.962 45.466 1.00126.31 C ATOM 4921 O GLU F 988 -34.226 9.903 46.713 1.00125.22 O ATOM 4922 CB GLU F 988 -33.547 11.568 43.686 1.00112.35 C ATOM 4923 CG GLU F 988 -32.466 12.350 42.963 1.00105.61 C ATOM 4924 CD GLU F 988 -33.016 13.283 41.898 1.00122.39 C ATOM 4925 OE1 GLU F 988 -34.043 13.940 42.164 1.00129.90 O ATOM 4926 OE2 GLU F 988 -32.426 13.341 40.801 1.00123.86 O