>>6LXT:HELIX    1 AA1 GLN A  913  GLU A  988  1                                  76    
QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 AA1 GLN A 913 GLU A 988 1 76 ATOM 8 N GLN A 913 6.975 -5.795 -66.116 1.00134.78 N ANISOU 8 N GLN A 913 17438 20549 13224 1191 672 2092 N ATOM 9 CA GLN A 913 6.133 -5.936 -64.899 1.00127.50 C ANISOU 9 CA GLN A 913 16674 18963 12808 1103 513 1906 C ATOM 10 C GLN A 913 7.031 -6.421 -63.754 1.00125.04 C ANISOU 10 C GLN A 913 15958 19165 12388 1362 678 1943 C ATOM 11 O GLN A 913 6.487 -6.882 -62.733 1.00133.71 O ANISOU 11 O GLN A 913 17192 19806 13805 1469 602 1775 O ATOM 12 CB GLN A 913 4.986 -6.921 -65.154 1.00125.67 C ANISOU 12 CB GLN A 913 17030 17931 12788 1512 402 1612 C ATOM 13 CG GLN A 913 5.368 -8.087 -66.063 1.00131.40 C ANISOU 13 CG GLN A 913 17943 18897 13087 2225 556 1545 C ATOM 14 CD GLN A 913 4.610 -9.366 -65.790 1.00134.64 C ANISOU 14 CD GLN A 913 18813 18695 13649 2755 491 1269 C ATOM 15 OE1 GLN A 913 4.422 -9.773 -64.645 1.00138.82 O ANISOU 15 OE1 GLN A 913 19333 19007 14407 2820 465 1172 O ATOM 16 NE2 GLN A 913 4.196 -10.041 -66.851 1.00131.27 N ANISOU 16 NE2 GLN A 913 18807 17996 13072 3144 460 1148 N ATOM 17 N ASN A 914 8.355 -6.330 -63.929 1.00122.84 N ANISOU 17 N ASN A 914 15197 19818 11659 1460 893 2150 N ATOM 18 CA ASN A 914 9.371 -6.853 -62.974 1.00121.63 C ANISOU 18 CA ASN A 914 14624 20276 11315 1787 1067 2185 C ATOM 19 C ASN A 914 9.344 -6.013 -61.694 1.00117.37 C ANISOU 19 C ASN A 914 13810 19649 11136 1249 963 2262 C ATOM 20 O ASN A 914 9.371 -6.619 -60.596 1.00108.39 O ANISOU 20 O ASN A 914 12638 18408 10138 1510 978 2146 O ATOM 21 CB ASN A 914 10.775 -6.885 -63.585 1.00121.62 C ANISOU 21 CB ASN A 914 14146 21342 10723 1998 1316 2379 C ATOM 22 CG ASN A 914 10.983 -8.071 -64.501 1.00128.91 C ANISOU 22 CG ASN A 914 15291 22445 11243 2762 1446 2244 C ATOM 23 OD1 ASN A 914 10.341 -9.111 -64.346 1.00132.99 O ANISOU 23 OD1 ASN A 914 16246 22400 11883 3263 1379 2002 O ATOM 24 ND2 ASN A 914 11.871 -7.921 -65.469 1.00134.27 N ANISOU 24 ND2 ASN A 914 15682 23909 11425 2849 1621 2399 N ATOM 25 N VAL A 915 9.275 -4.682 -61.840 1.00123.79 N ANISOU 25 N VAL A 915 14471 20478 12084 534 843 2446 N ATOM 26 CA VAL A 915 9.250 -3.695 -60.715 1.00121.69 C ANISOU 26 CA VAL A 915 13950 20133 12153 -48 703 2539 C ATOM 27 C VAL A 915 8.095 -4.057 -59.775 1.00114.46 C ANISOU 27 C VAL A 915 13393 18360 11737 8 532 2280 C ATOM 28 O VAL A 915 8.314 -4.088 -58.548 1.00113.05 O ANISOU 28 O VAL A 915 12993 18240 11719 -14 534 2264 O ATOM 29 CB VAL A 915 9.110 -2.238 -61.204 1.00116.42 C ANISOU 29 CB VAL A 915 13232 19431 11572 -813 527 2739 C ATOM 30 CG1 VAL A 915 9.096 -1.255 -60.039 1.00116.16 C ANISOU 30 CG1 VAL A 915 12962 19305 11867 -1369 357 2821 C ATOM 31 CG2 VAL A 915 10.195 -1.856 -62.197 1.00115.52 C ANISOU 31 CG2 VAL A 915 12789 20157 10945 -931 695 3010 C ATOM 32 N LEU A 916 6.911 -4.307 -60.336 1.00105.81 N ANISOU 32 N LEU A 916 12818 16516 10868 64 388 2085 N ATOM 33 CA LEU A 916 5.678 -4.605 -59.565 1.00108.42 C ANISOU 33 CA LEU A 916 13511 16010 11675 62 212 1827 C ATOM 34 C LEU A 916 5.843 -5.929 -58.801 1.00117.39 C ANISOU 34 C LEU A 916 14697 17151 12754 665 350 1679 C ATOM 35 O LEU A 916 5.458 -5.962 -57.613 1.00113.21 O ANISOU 35 O LEU A 916 14155 16326 12534 565 276 1582 O ATOM 36 CB LEU A 916 4.475 -4.614 -60.514 1.00109.20 C ANISOU 36 CB LEU A 916 14129 15404 11957 16 42 1660 C ATOM 37 CG LEU A 916 3.785 -3.259 -60.685 1.00103.48 C ANISOU 37 CG LEU A 916 13478 14304 11536 -658 -223 1691 C ATOM 38 CD1 LEU A 916 4.676 -2.269 -61.425 1.00106.51 C ANISOU 38 CD1 LEU A 916 13576 15279 11615 -1030 -195 1986 C ATOM 39 CD2 LEU A 916 2.451 -3.417 -61.397 1.00 89.96 C ANISOU 39 CD2 LEU A 916 12303 11808 10070 -638 -411 1457 C ATOM 40 N TYR A 917 6.415 -6.967 -59.424 1.00108.52 N ANISOU 40 N TYR A 917 13634 16363 11234 1270 531 1662 N ATOM 41 CA TYR A 917 6.593 -8.303 -58.792 1.00109.17 C ANISOU 41 CA TYR A 917 13836 16429 11213 1896 632 1514 C ATOM 42 C TYR A 917 7.654 -8.226 -57.696 1.00109.47 C ANISOU 42 C TYR A 917 13381 17078 11135 1925 752 1634 C ATOM 43 O TYR A 917 7.458 -8.865 -56.650 1.00116.90 O ANISOU 43 O TYR A 917 14415 17772 12228 2133 736 1508 O ATOM 44 CB TYR A 917 6.987 -9.380 -59.801 1.00108.67 C ANISOU 44 CB TYR A 917 13972 16597 10720 2561 762 1459 C ATOM 45 CG TYR A 917 7.086 -10.768 -59.214 1.00112.56 C ANISOU 45 CG TYR A 917 14681 16986 11102 3213 810 1290 C ATOM 46 CD1 TYR A 917 6.047 -11.317 -58.477 1.00116.43 C ANISOU 46 CD1 TYR A 917 15575 16710 11952 3232 669 1093 C ATOM 47 CD2 TYR A 917 8.218 -11.545 -59.404 1.00115.80 C ANISOU 47 CD2 TYR A 917 14904 18071 11025 3816 984 1321 C ATOM 48 CE1 TYR A 917 6.132 -12.594 -57.940 1.00120.24 C ANISOU 48 CE1 TYR A 917 16304 17066 12314 3801 689 952 C ATOM 49 CE2 TYR A 917 8.315 -12.827 -58.884 1.00116.92 C ANISOU 49 CE2 TYR A 917 15295 18088 11043 4436 991 1159 C ATOM 50 CZ TYR A 917 7.270 -13.354 -58.146 1.00118.99 C ANISOU 50 CZ TYR A 917 15996 17546 11670 4415 838 983 C ATOM 51 OH TYR A 917 7.370 -14.610 -57.622 1.00117.84 O ANISOU 51 OH TYR A 917 16133 17254 11385 4993 822 838 O ATOM 52 N GLU A 918 8.741 -7.489 -57.936 1.00110.04 N ANISOU 52 N GLU A 918 12952 17926 10933 1720 866 1870 N ATOM 53 CA GLU A 918 9.819 -7.278 -56.931 1.00116.03 C ANISOU 53 CA GLU A 918 13183 19330 11574 1689 973 2003 C ATOM 54 C GLU A 918 9.286 -6.428 -55.766 1.00113.08 C ANISOU 54 C GLU A 918 12730 18566 11669 1126 804 2010 C ATOM 55 O GLU A 918 9.695 -6.706 -54.620 1.00112.05 O ANISOU 55 O GLU A 918 12399 18592 11582 1256 843 1992 O ATOM 56 CB GLU A 918 11.064 -6.669 -57.583 1.00116.83 C ANISOU 56 CB GLU A 918 12769 20370 11252 1561 1128 2258 C ATOM 57 CG GLU A 918 11.815 -7.643 -58.482 1.00116.03 C ANISOU 57 CG GLU A 918 12642 20821 10624 2233 1328 2232 C ATOM 58 CD GLU A 918 12.341 -8.906 -57.809 1.00114.03 C ANISOU 58 CD GLU A 918 12382 20775 10171 2961 1432 2080 C ATOM 59 OE1 GLU A 918 13.145 -8.780 -56.857 1.00110.39 O ANISOU 59 OE1 GLU A 918 11499 20790 9656 2951 1497 2153 O ATOM 60 OE2 GLU A 918 11.942 -10.021 -58.234 1.00111.79 O ANISOU 60 OE2 GLU A 918 12537 20158 9779 3542 1428 1884 O ATOM 61 N ASN A 919 8.407 -5.451 -56.035 1.00115.13 N ANISOU 61 N ASN A 919 13154 18336 12255 555 610 2021 N ATOM 62 CA ASN A 919 7.715 -4.639 -54.993 1.00108.94 C ANISOU 62 CA ASN A 919 12365 17088 11939 42 408 1981 C ATOM 63 C ASN A 919 6.825 -5.567 -54.155 1.00107.21 C ANISOU 63 C ASN A 919 12502 16236 11998 341 359 1721 C ATOM 64 O ASN A 919 6.877 -5.468 -52.917 1.00108.44 O ANISOU 64 O ASN A 919 12497 16363 12344 240 329 1700 O ATOM 65 CB ASN A 919 6.910 -3.472 -55.582 1.00109.91 C ANISOU 65 CB ASN A 919 12649 16794 12317 -558 181 2010 C ATOM 66 CG ASN A 919 7.747 -2.258 -55.936 1.00113.05 C ANISOU 66 CG ASN A 919 12654 17757 12542 -1059 158 2296 C ATOM 67 OD1 ASN A 919 8.867 -2.107 -55.451 1.00118.86 O ANISOU 67 OD1 ASN A 919 12931 19171 13060 -1072 286 2474 O ATOM 68 ND2 ASN A 919 7.202 -1.377 -56.765 1.00109.17 N ANISOU 68 ND2 ASN A 919 12351 16983 12145 -1492 -22 2342 N ATOM 69 N GLN A 920 6.053 -6.451 -54.795 1.00 84.72 N ANISOU 69 N GLN A 920 10124 12909 9156 687 350 1537 N ATOM 70 CA GLN A 920 5.166 -7.411 -54.082 1.00 84.99 C ANISOU 70 CA GLN A 920 10540 12328 9423 954 300 1295 C ATOM 71 C GLN A 920 6.008 -8.276 -53.140 1.00 94.71 C ANISOU 71 C GLN A 920 11600 13931 10453 1392 449 1303 C ATOM 72 O GLN A 920 5.592 -8.447 -51.979 1.00 97.80 O ANISOU 72 O GLN A 920 12044 14015 11099 1323 391 1205 O ATOM 73 CB GLN A 920 4.397 -8.313 -55.047 1.00 88.77 C ANISOU 73 CB GLN A 920 11538 12335 9855 1306 278 1125 C ATOM 74 CG GLN A 920 3.325 -7.580 -55.834 1.00 88.94 C ANISOU 74 CG GLN A 920 11814 11836 10145 899 94 1054 C ATOM 75 CD GLN A 920 2.401 -8.506 -56.585 1.00 98.30 C ANISOU 75 CD GLN A 920 13540 12453 11358 1219 42 852 C ATOM 76 OE1 GLN A 920 2.631 -9.709 -56.688 1.00 94.01 O ANISOU 76 OE1 GLN A 920 13204 11932 10583 1768 143 784 O ATOM 77 NE2 GLN A 920 1.333 -7.939 -57.122 1.00106.96 N ANISOU 77 NE2 GLN A 920 14884 13020 12736 879 -141 745 N ATOM 78 N LYS A 921 7.139 -8.795 -53.625 1.00 86.09 N ANISOU 78 N LYS A 921 10315 13488 8909 1834 626 1406 N ATOM 79 CA LYS A 921 8.062 -9.649 -52.834 1.00 84.05 C ANISOU 79 CA LYS A 921 9886 13653 8395 2323 759 1405 C ATOM 80 C LYS A 921 8.600 -8.862 -51.636 1.00 80.96 C ANISOU 80 C LYS A 921 9036 13580 8146 1964 755 1525 C ATOM 81 O LYS A 921 8.676 -9.442 -50.541 1.00 83.82 O ANISOU 81 O LYS A 921 9428 13854 8567 2174 763 1445 O ATOM 82 CB LYS A 921 9.238 -10.123 -53.687 1.00 92.96 C ANISOU 82 CB LYS A 921 10805 15526 8991 2812 937 1497 C ATOM 83 CG LYS A 921 8.958 -11.300 -54.608 1.00 93.10 C ANISOU 83 CG LYS A 921 11288 15315 8771 3408 958 1345 C ATOM 84 CD LYS A 921 10.239 -11.893 -55.147 1.00 91.30 C ANISOU 84 CD LYS A 921 10808 15895 7988 3990 1133 1402 C ATOM 85 CE LYS A 921 10.017 -13.141 -55.970 1.00106.04 C ANISOU 85 CE LYS A 921 13159 17540 9593 4656 1129 1232 C ATOM 86 NZ LYS A 921 11.110 -13.349 -56.951 1.00114.39 N ANISOU 86 NZ LYS A 921 13944 19405 10114 5081 1289 1307 N ATOM 87 N LEU A 922 8.971 -7.597 -51.838 1.00 89.43 N ANISOU 87 N LEU A 922 9722 14999 9259 1440 731 1716 N ATOM 88 CA LEU A 922 9.447 -6.700 -50.751 1.00 85.87 C ANISOU 88 CA LEU A 922 8837 14825 8963 1028 691 1843 C ATOM 89 C LEU A 922 8.340 -6.531 -49.709 1.00 80.02 C ANISOU 89 C LEU A 922 8340 13367 8697 750 520 1690 C ATOM 90 O LEU A 922 8.620 -6.754 -48.519 1.00 87.79 O ANISOU 90 O LEU A 922 9187 14422 9748 834 536 1667 O ATOM 91 CB LEU A 922 9.862 -5.346 -51.334 1.00 90.94 C ANISOU 91 CB LEU A 922 9128 15850 9574 462 645 2071 C ATOM 92 CG LEU A 922 11.206 -5.337 -52.060 1.00109.69 C ANISOU 92 CG LEU A 922 11090 19132 11455 641 836 2269 C ATOM 93 CD1 LEU A 922 11.543 -3.941 -52.562 1.00118.13 C ANISOU 93 CD1 LEU A 922 11845 20527 12511 -12 764 2512 C ATOM 94 CD2 LEU A 922 12.319 -5.867 -51.165 1.00107.54 C ANISOU 94 CD2 LEU A 922 10441 19469 10950 1011 981 2302 C ATOM 95 N ILE A 923 7.135 -6.159 -50.143 1.00 72.43 N ANISOU 95 N ILE A 923 7719 11763 8039 444 361 1580 N ATOM 96 CA ILE A 923 5.977 -5.916 -49.233 1.00 75.79 C ANISOU 96 CA ILE A 923 8361 11518 8918 146 187 1413 C ATOM 97 C ILE A 923 5.790 -7.169 -48.370 1.00 76.01 C ANISOU 97 C ILE A 923 8621 11317 8941 593 261 1255 C ATOM 98 O ILE A 923 5.730 -7.024 -47.131 1.00 72.18 O ANISOU 98 O ILE A 923 8016 10763 8645 459 221 1225 O ATOM 99 CB ILE A 923 4.706 -5.534 -50.023 1.00 73.71 C ANISOU 99 CB ILE A 923 8465 10624 8917 -134 17 1281 C ATOM 100 CG1 ILE A 923 4.822 -4.136 -50.637 1.00 65.49 C ANISOU 100 CG1 ILE A 923 7213 9740 7930 -664 -115 1434 C ATOM 101 CG2 ILE A 923 3.467 -5.646 -49.147 1.00 67.72 C ANISOU 101 CG2 ILE A 923 7975 9194 8563 -289 -125 1054 C ATOM 102 CD1 ILE A 923 3.871 -3.876 -51.775 1.00 60.87 C ANISOU 102 CD1 ILE A 923 6982 8687 7457 -817 -249 1338 C ATOM 103 N ALA A 924 5.749 -8.347 -49.002 1.00 64.26 N ANISOU 103 N ALA A 924 7461 9732 7222 1109 354 1165 N ATOM 104 CA ALA A 924 5.454 -9.648 -48.357 1.00 73.37 C ANISOU 104 CA ALA A 924 8960 10572 8346 1547 389 1005 C ATOM 105 C ALA A 924 6.524 -9.980 -47.316 1.00 81.34 C ANISOU 105 C ALA A 924 9672 12068 9164 1805 494 1083 C ATOM 106 O ALA A 924 6.144 -10.428 -46.217 1.00 87.65 O ANISOU 106 O ALA A 924 10621 12562 10119 1838 458 982 O ATOM 107 CB ALA A 924 5.356 -10.737 -49.388 1.00 68.47 C ANISOU 107 CB ALA A 924 8732 9821 7462 2051 441 922 C ATOM 108 N ASN A 925 7.802 -9.788 -47.661 1.00 75.45 N ANISOU 108 N ASN A 925 8525 12064 8080 1984 617 1251 N ATOM 109 CA ASN A 925 8.948 -10.051 -46.750 1.00 75.39 C ANISOU 109 CA ASN A 925 8176 12614 7855 2252 715 1327 C ATOM 110 C ASN A 925 8.839 -9.105 -45.554 1.00 69.22 C ANISOU 110 C ASN A 925 7112 11792 7398 1749 630 1381 C ATOM 111 O ASN A 925 8.766 -9.621 -44.426 1.00 66.83 O ANISOU 111 O ASN A 925 6901 11320 7172 1891 619 1299 O ATOM 112 CB ASN A 925 10.295 -9.948 -47.469 1.00 69.54 C ANISOU 112 CB ASN A 925 7019 12722 6682 2502 861 1488 C ATOM 113 CG ASN A 925 10.522 -11.092 -48.435 1.00 82.15 C ANISOU 113 CG ASN A 925 8902 14406 7905 3141 946 1401 C ATOM 114 OD1 ASN A 925 9.860 -12.133 -48.361 1.00 86.75 O ANISOU 114 OD1 ASN A 925 9996 14455 8510 3485 896 1226 O ATOM 115 ND2 ASN A 925 11.461 -10.902 -49.349 1.00 80.02 N ANISOU 115 ND2 ASN A 925 8309 14820 7274 3295 1067 1525 N ATOM 116 N GLN A 926 8.785 -7.792 -45.810 1.00 65.37 N ANISOU 116 N GLN A 926 6335 11418 7085 1187 554 1507 N ATOM 117 CA GLN A 926 8.629 -6.732 -44.777 1.00 65.24 C ANISOU 117 CA GLN A 926 6058 11342 7388 663 431 1559 C ATOM 118 C GLN A 926 7.469 -7.082 -43.836 1.00 66.38 C ANISOU 118 C GLN A 926 6559 10787 7876 589 327 1357 C ATOM 119 O GLN A 926 7.657 -7.012 -42.603 1.00 63.24 O ANISOU 119 O GLN A 926 6013 10432 7583 538 309 1352 O ATOM 120 CB GLN A 926 8.366 -5.373 -45.430 1.00 66.84 C ANISOU 120 CB GLN A 926 6100 11538 7758 74 300 1671 C ATOM 121 CG GLN A 926 9.556 -4.793 -46.184 1.00 58.39 C ANISOU 121 CG GLN A 926 4604 11214 6367 -3 386 1911 C ATOM 122 CD GLN A 926 10.851 -4.911 -45.417 1.00 60.91 C ANISOU 122 CD GLN A 926 4475 12218 6449 191 505 2037 C ATOM 123 OE1 GLN A 926 11.511 -5.951 -45.441 1.00 70.21 O ANISOU 123 OE1 GLN A 926 5644 13719 7315 758 667 2002 O ATOM 124 NE2 GLN A 926 11.226 -3.836 -44.740 1.00 60.67 N ANISOU 124 NE2 GLN A 926 4079 12414 6560 -268 403 2174 N ATOM 125 N PHE A 927 6.311 -7.430 -44.402 1.00 62.54 N ANISOU 125 N PHE A 927 6515 9699 7549 570 261 1198 N ATOM 126 CA PHE A 927 5.087 -7.810 -43.649 1.00 64.66 C ANISOU 126 CA PHE A 927 7142 9297 8128 475 168 991 C ATOM 127 C PHE A 927 5.409 -8.997 -42.726 1.00 59.56 C ANISOU 127 C PHE A 927 6647 8656 7327 918 266 932 C ATOM 128 O PHE A 927 5.265 -8.852 -41.503 1.00 67.39 O ANISOU 128 O PHE A 927 7559 9556 8491 768 227 897 O ATOM 129 CB PHE A 927 3.940 -8.100 -44.622 1.00 61.26 C ANISOU 129 CB PHE A 927 7146 8313 7818 444 99 842 C ATOM 130 CG PHE A 927 2.647 -8.481 -43.958 1.00 55.97 C ANISOU 130 CG PHE A 927 6825 6992 7448 315 7 627 C ATOM 131 CD1 PHE A 927 2.007 -7.596 -43.111 1.00 50.64 C ANISOU 131 CD1 PHE A 927 6010 6114 7116 -143 -124 561 C ATOM 132 CD2 PHE A 927 2.087 -9.731 -44.160 1.00 68.09 C ANISOU 132 CD2 PHE A 927 8825 8141 8904 650 44 490 C ATOM 133 CE1 PHE A 927 0.823 -7.952 -42.483 1.00 57.88 C ANISOU 133 CE1 PHE A 927 7211 6495 8286 -268 -195 356 C ATOM 134 CE2 PHE A 927 0.895 -10.081 -43.546 1.00 63.27 C ANISOU 134 CE2 PHE A 927 8518 6969 8554 487 -35 303 C ATOM 135 CZ PHE A 927 0.258 -9.186 -42.716 1.00 53.34 C ANISOU 135 CZ PHE A 927 7082 5555 7631 25 -144 232 C ATOM 136 N ASN A 928 5.873 -10.114 -43.300 1.00 58.35 N ANISOU 136 N ASN A 928 6709 8625 6838 1461 374 922 N ATOM 137 CA ASN A 928 6.191 -11.383 -42.585 1.00 57.30 C ANISOU 137 CA ASN A 928 6814 8458 6498 1958 438 854 C ATOM 138 C ASN A 928 7.232 -11.109 -41.493 1.00 57.91 C ANISOU 138 C ASN A 928 6478 9038 6489 2001 487 962 C ATOM 139 O ASN A 928 7.123 -11.706 -40.423 1.00 62.51 O ANISOU 139 O ASN A 928 7222 9432 7097 2132 477 890 O ATOM 140 CB ASN A 928 6.679 -12.479 -43.539 1.00 64.15 C ANISOU 140 CB ASN A 928 7936 9465 6973 2560 517 835 C ATOM 141 CG ASN A 928 5.594 -13.014 -44.455 1.00 67.02 C ANISOU 141 CG ASN A 928 8807 9246 7412 2594 453 702 C ATOM 142 OD1 ASN A 928 4.454 -13.156 -44.038 1.00 75.16 O ANISOU 142 OD1 ASN A 928 10151 9679 8728 2344 361 574 O ATOM 143 ND2 ASN A 928 5.930 -13.335 -45.697 1.00 68.71 N ANISOU 143 ND2 ASN A 928 9104 9640 7361 2906 499 723 N ATOM 144 N SER A 929 8.203 -10.234 -41.760 1.00 67.38 N ANISOU 144 N SER A 929 7167 10855 7578 1877 533 1132 N ATOM 145 CA SER A 929 9.186 -9.753 -40.757 1.00 59.66 C ANISOU 145 CA SER A 929 5729 10384 6554 1825 559 1249 C ATOM 146 C SER A 929 8.416 -9.058 -39.631 1.00 63.00 C ANISOU 146 C SER A 929 6130 10426 7380 1342 437 1201 C ATOM 147 O SER A 929 8.507 -9.540 -38.501 1.00 69.98 O ANISOU 147 O SER A 929 7078 11237 8275 1491 441 1148 O ATOM 148 CB SER A 929 10.244 -8.867 -41.374 1.00 60.52 C ANISOU 148 CB SER A 929 5309 11197 6487 1692 613 1447 C ATOM 149 OG SER A 929 9.819 -7.518 -41.420 1.00 64.06 O ANISOU 149 OG SER A 929 5544 11555 7239 1052 496 1527 O ATOM 150 N ALA A 930 7.632 -8.022 -39.944 1.00 58.52 N ANISOU 150 N ALA A 930 5518 9597 7120 813 321 1199 N ATOM 151 CA ALA A 930 6.890 -7.193 -38.964 1.00 50.90 C ANISOU 151 CA ALA A 930 4490 8314 6536 334 179 1142 C ATOM 152 C ALA A 930 6.036 -8.085 -38.054 1.00 64.11 C ANISOU 152 C ALA A 930 6555 9469 8333 462 174 958 C ATOM 153 O ALA A 930 6.135 -7.946 -36.822 1.00 64.77 O ANISOU 153 O ALA A 930 6517 9573 8519 378 147 948 O ATOM 154 CB ALA A 930 6.035 -6.183 -39.684 1.00 46.93 C ANISOU 154 CB ALA A 930 4008 7527 6298 -144 37 1116 C ATOM 155 N ILE A 931 5.221 -8.963 -38.637 1.00 53.04 N ANISOU 155 N ILE A 931 5615 7622 6917 640 191 824 N ATOM 156 CA ILE A 931 4.315 -9.869 -37.874 1.00 60.55 C ANISOU 156 CA ILE A 931 6988 8050 7968 716 179 654 C ATOM 157 C ILE A 931 5.149 -10.693 -36.896 1.00 67.60 C ANISOU 157 C ILE A 931 7890 9170 8625 1104 261 692 C ATOM 158 O ILE A 931 4.738 -10.798 -35.733 1.00 67.95 O ANISOU 158 O ILE A 931 8009 8997 8813 975 229 624 O ATOM 159 CB ILE A 931 3.493 -10.773 -38.810 1.00 60.98 C ANISOU 159 CB ILE A 931 7540 7656 7975 895 183 532 C ATOM 160 CG1 ILE A 931 2.409 -9.959 -39.525 1.00 61.93 C ANISOU 160 CG1 ILE A 931 7698 7436 8396 459 70 444 C ATOM 161 CG2 ILE A 931 2.916 -11.966 -38.049 1.00 55.28 C ANISOU 161 CG2 ILE A 931 7268 6514 7221 1085 193 406 C ATOM 162 CD1 ILE A 931 1.537 -10.777 -40.442 1.00 75.52 C ANISOU 162 CD1 ILE A 931 9897 8698 10100 596 57 316 C ATOM 163 N GLY A 932 6.257 -11.268 -37.368 1.00 65.51 N ANISOU 163 N GLY A 932 7561 9330 7999 1576 355 785 N ATOM 164 CA GLY A 932 7.210 -12.028 -36.537 1.00 54.17 C ANISOU 164 CA GLY A 932 6106 8184 6294 2009 417 818 C ATOM 165 C GLY A 932 7.568 -11.250 -35.289 1.00 55.21 C ANISOU 165 C GLY A 932 5863 8534 6582 1743 387 878 C ATOM 166 O GLY A 932 7.352 -11.793 -34.192 1.00 58.96 O ANISOU 166 O GLY A 932 6540 8783 7081 1815 372 810 O ATOM 167 N LYS A 933 8.046 -10.006 -35.458 1.00 60.63 N ANISOU 167 N LYS A 933 6048 9615 7372 1418 363 1004 N ATOM 168 CA LYS A 933 8.431 -9.084 -34.353 1.00 58.06 C ANISOU 168 CA LYS A 933 5323 9528 7210 1120 305 1077 C ATOM 169 C LYS A 933 7.225 -8.850 -33.430 1.00 61.78 C ANISOU 169 C LYS A 933 5995 9451 8026 755 207 942 C ATOM 170 O LYS A 933 7.432 -8.829 -32.211 1.00 62.02 O ANISOU 170 O LYS A 933 5937 9526 8100 742 189 937 O ATOM 171 CB LYS A 933 8.886 -7.705 -34.842 1.00 55.49 C ANISOU 171 CB LYS A 933 4510 9594 6979 731 248 1227 C ATOM 172 CG LYS A 933 9.892 -7.620 -35.984 1.00 62.15 C ANISOU 172 CG LYS A 933 5095 10993 7526 920 335 1372 C ATOM 173 CD LYS A 933 11.017 -8.634 -36.012 1.00 77.44 C ANISOU 173 CD LYS A 933 6988 13385 9051 1531 472 1403 C ATOM 174 CE LYS A 933 12.287 -8.099 -36.658 1.00 82.41 C ANISOU 174 CE LYS A 933 7106 14783 9422 1576 541 1585 C ATOM 175 NZ LYS A 933 12.084 -6.850 -37.440 1.00 75.28 N ANISOU 175 NZ LYS A 933 5962 13959 8681 1035 471 1706 N ATOM 176 N ILE A 934 6.025 -8.644 -33.987 1.00 48.28 N ANISOU 176 N ILE A 934 4525 7274 6546 467 143 832 N ATOM 177 CA ILE A 934 4.774 -8.372 -33.208 1.00 54.51 C ANISOU 177 CA ILE A 934 5479 7570 7662 99 48 677 C ATOM 178 C ILE A 934 4.441 -9.608 -32.353 1.00 60.20 C ANISOU 178 C ILE A 934 6595 7994 8284 356 111 576 C ATOM 179 O ILE A 934 4.105 -9.427 -31.150 1.00 63.68 O ANISOU 179 O ILE A 934 7005 8317 8872 172 73 519 O ATOM 180 CB ILE A 934 3.609 -7.963 -34.142 1.00 44.92 C ANISOU 180 CB ILE A 934 4435 5960 6674 -210 -36 564 C ATOM 181 CG1 ILE A 934 3.850 -6.584 -34.758 1.00 45.16 C ANISOU 181 CG1 ILE A 934 4090 6233 6836 -549 -146 659 C ATOM 182 CG2 ILE A 934 2.261 -8.022 -33.433 1.00 43.01 C ANISOU 182 CG2 ILE A 934 4430 5209 6701 -485 -106 366 C ATOM 183 CD1 ILE A 934 3.143 -6.378 -36.068 1.00 45.90 C ANISOU 183 CD1 ILE A 934 4357 6076 7008 -682 -199 601 C ATOM 184 N GLN A 935 4.534 -10.808 -32.953 1.00 59.63 N ANISOU 184 N GLN A 935 6897 7802 7957 764 191 556 N ATOM 185 CA GLN A 935 4.294 -12.123 -32.296 1.00 53.56 C ANISOU 185 CA GLN A 935 6590 6732 7030 1051 230 478 C ATOM 186 C GLN A 935 5.195 -12.248 -31.066 1.00 61.38 C ANISOU 186 C GLN A 935 7411 8022 7889 1234 253 547 C ATOM 187 O GLN A 935 4.714 -12.765 -30.038 1.00 66.20 O ANISOU 187 O GLN A 935 8279 8345 8530 1192 243 474 O ATOM 188 CB GLN A 935 4.589 -13.287 -33.247 1.00 57.19 C ANISOU 188 CB GLN A 935 7421 7135 7175 1537 279 478 C ATOM 189 CG GLN A 935 3.535 -13.520 -34.322 1.00 54.91 C ANISOU 189 CG GLN A 935 7460 6416 6989 1413 249 379 C ATOM 190 CD GLN A 935 3.902 -14.618 -35.296 1.00 65.84 C ANISOU 190 CD GLN A 935 9198 7771 8046 1920 279 382 C ATOM 191 OE1 GLN A 935 5.023 -14.680 -35.797 1.00 69.53 O ANISOU 191 OE1 GLN A 935 9464 8703 8251 2290 331 479 O ATOM 192 NE2 GLN A 935 2.944 -15.484 -35.598 1.00 69.74 N ANISOU 192 NE2 GLN A 935 10219 7733 8547 1939 238 268 N ATOM 193 N ASP A 936 6.458 -11.820 -31.192 1.00 59.62 N ANISOU 193 N ASP A 936 6777 8367 7509 1429 283 682 N ATOM 194 CA ASP A 936 7.450 -11.783 -30.080 1.00 62.52 C ANISOU 194 CA ASP A 936 6897 9101 7756 1602 293 755 C ATOM 195 C ASP A 936 6.924 -10.786 -29.040 1.00 56.02 C ANISOU 195 C ASP A 936 5842 8181 7262 1112 218 733 C ATOM 196 O ASP A 936 6.849 -11.154 -27.854 1.00 63.64 O ANISOU 196 O ASP A 936 6935 9024 8223 1147 210 691 O ATOM 197 CB ASP A 936 8.882 -11.493 -30.577 1.00 65.12 C ANISOU 197 CB ASP A 936 6798 10102 7844 1887 340 898 C ATOM 198 CG ASP A 936 9.630 -12.689 -31.176 1.00 71.41 C ANISOU 198 CG ASP A 936 7826 11075 8232 2519 408 894 C ATOM 199 OD1 ASP A 936 9.700 -13.750 -30.513 1.00 73.68 O ANISOU 199 OD1 ASP A 936 8483 11173 8338 2870 402 825 O ATOM 200 OD2 ASP A 936 10.157 -12.553 -32.302 1.00 71.96 O ANISOU 200 OD2 ASP A 936 7714 11480 8147 2668 456 957 O ATOM 201 N SER A 937 6.513 -9.594 -29.478 1.00 54.91 N ANISOU 201 N SER A 937 5412 8063 7388 676 148 746 N ATOM 202 CA SER A 937 6.070 -8.492 -28.587 1.00 49.95 C ANISOU 202 CA SER A 937 4523 7386 7069 221 40 718 C ATOM 203 C SER A 937 4.837 -8.943 -27.809 1.00 53.80 C ANISOU 203 C SER A 937 5372 7356 7714 53 25 548 C ATOM 204 O SER A 937 4.780 -8.667 -26.595 1.00 54.70 O ANISOU 204 O SER A 937 5385 7474 7923 -77 -13 521 O ATOM 205 CB SER A 937 5.775 -7.258 -29.353 1.00 48.09 C ANISOU 205 CB SER A 937 4013 7202 7057 -173 -63 743 C ATOM 206 OG SER A 937 4.506 -7.371 -29.962 1.00 48.85 O ANISOU 206 OG SER A 937 4414 6826 7322 -368 -93 597 O ATOM 207 N LEU A 938 3.896 -9.612 -28.487 1.00 56.75 N ANISOU 207 N LEU A 938 6143 7320 8101 50 54 440 N ATOM 208 CA LEU A 938 2.646 -10.129 -27.868 1.00 45.74 C ANISOU 208 CA LEU A 938 5110 5438 6831 -138 50 276 C ATOM 209 C LEU A 938 2.978 -11.149 -26.780 1.00 47.09 C ANISOU 209 C LEU A 938 5540 5564 6789 129 114 288 C ATOM 210 O LEU A 938 2.391 -11.065 -25.693 1.00 71.26 O ANISOU 210 O LEU A 938 8642 8463 9970 -97 95 208 O ATOM 211 CB LEU A 938 1.743 -10.762 -28.928 1.00 54.95 C ANISOU 211 CB LEU A 938 6661 6217 8001 -142 68 180 C ATOM 212 CG LEU A 938 0.991 -9.784 -29.829 1.00 47.76 C ANISOU 212 CG LEU A 938 5589 5200 7358 -494 -21 106 C ATOM 213 CD1 LEU A 938 0.135 -10.527 -30.842 1.00 41.38 C ANISOU 213 CD1 LEU A 938 5188 4002 6531 -458 -3 8 C ATOM 214 CD2 LEU A 938 0.126 -8.832 -29.017 1.00 41.20 C ANISOU 214 CD2 LEU A 938 4559 4255 6839 -941 -124 -23 C ATOM 215 N SER A 939 3.886 -12.075 -27.062 1.00 54.45 N ANISOU 215 N SER A 939 6648 6641 7399 604 176 375 N ATOM 216 CA SER A 939 4.336 -13.098 -26.085 1.00 57.90 C ANISOU 216 CA SER A 939 7370 7041 7587 923 209 391 C ATOM 217 C SER A 939 5.001 -12.423 -24.877 1.00 76.64 C ANISOU 217 C SER A 939 9372 9737 10012 862 185 448 C ATOM 218 O SER A 939 4.631 -12.786 -23.750 1.00 75.57 O ANISOU 218 O SER A 939 9434 9404 9876 786 183 397 O ATOM 219 CB SER A 939 5.238 -14.123 -26.714 1.00 66.19 C ANISOU 219 CB SER A 939 8652 8222 8274 1485 245 453 C ATOM 220 OG SER A 939 5.321 -15.279 -25.886 1.00 78.19 O ANISOU 220 OG SER A 939 10619 9529 9561 1756 242 430 O ATOM 221 N SER A 940 5.918 -11.473 -25.086 1.00 48.79 N ANISOU 221 N SER A 940 5336 6681 6522 869 161 553 N ATOM 222 CA SER A 940 6.588 -10.726 -23.984 1.00 55.79 C ANISOU 222 CA SER A 940 5833 7891 7472 791 115 614 C ATOM 223 C SER A 940 5.546 -10.004 -23.116 1.00 46.96 C ANISOU 223 C SER A 940 4658 6519 6664 314 49 511 C ATOM 224 O SER A 940 5.691 -10.050 -21.885 1.00 49.53 O ANISOU 224 O SER A 940 4975 6867 6977 316 35 501 O ATOM 225 CB SER A 940 7.622 -9.753 -24.489 1.00 46.56 C ANISOU 225 CB SER A 940 4132 7249 6311 794 83 747 C ATOM 226 OG SER A 940 8.691 -10.423 -25.129 1.00 51.78 O ANISOU 226 OG SER A 940 4789 8235 6650 1269 152 832 O ATOM 227 N THR A 941 4.558 -9.344 -23.736 1.00 48.26 N ANISOU 227 N THR A 941 4778 6473 7085 -61 0 426 N ATOM 228 CA THR A 941 3.444 -8.645 -23.042 1.00 55.11 C ANISOU 228 CA THR A 941 5591 7103 8244 -502 -76 288 C ATOM 229 C THR A 941 2.751 -9.651 -22.120 1.00 53.96 C ANISOU 229 C THR A 941 5862 6627 8014 -483 -7 191 C ATOM 230 O THR A 941 2.692 -9.397 -20.903 1.00 52.11 O ANISOU 230 O THR A 941 5538 6430 7832 -595 -33 160 O ATOM 231 CB THR A 941 2.454 -8.014 -24.036 1.00 52.68 C ANISOU 231 CB THR A 941 5256 6586 8174 -826 -142 186 C ATOM 232 OG1 THR A 941 3.178 -7.194 -24.952 1.00 46.99 O ANISOU 232 OG1 THR A 941 4206 6168 7479 -829 -203 303 O ATOM 233 CG2 THR A 941 1.384 -7.183 -23.360 1.00 39.65 C ANISOU 233 CG2 THR A 941 3491 4762 6814 -1245 -247 23 C ATOM 234 N ALA A 942 2.275 -10.763 -22.684 1.00 53.37 N ANISOU 234 N ALA A 942 6239 6244 7794 -347 69 152 N ATOM 235 CA ALA A 942 1.550 -11.841 -21.965 1.00 54.93 C ANISOU 235 CA ALA A 942 6911 6083 7876 -362 128 74 C ATOM 236 C ALA A 942 2.368 -12.348 -20.770 1.00 53.75 C ANISOU 236 C ALA A 942 6840 6072 7512 -107 151 153 C ATOM 237 O ALA A 942 1.770 -12.597 -19.708 1.00 52.90 O ANISOU 237 O ALA A 942 6901 5786 7412 -290 165 86 O ATOM 238 CB ALA A 942 1.238 -12.959 -22.916 1.00 53.26 C ANISOU 238 CB ALA A 942 7167 5576 7494 -177 175 65 C ATOM 239 N SER A 943 3.682 -12.505 -20.949 1.00 57.90 N ANISOU 239 N SER A 943 7244 6920 7836 302 152 282 N ATOM 240 CA SER A 943 4.644 -12.906 -19.892 1.00 63.00 C ANISOU 240 CA SER A 943 7912 7759 8267 605 151 357 C ATOM 241 C SER A 943 4.594 -11.870 -18.763 1.00 57.09 C ANISOU 241 C SER A 943 6786 7177 7728 315 100 338 C ATOM 242 O SER A 943 4.416 -12.258 -17.602 1.00 59.47 O ANISOU 242 O SER A 943 7279 7359 7958 292 109 309 O ATOM 243 CB SER A 943 6.041 -13.064 -20.470 1.00 59.14 C ANISOU 243 CB SER A 943 7253 7661 7556 1074 151 476 C ATOM 244 OG SER A 943 6.978 -13.520 -19.500 1.00 65.23 O ANISOU 244 OG SER A 943 8066 8616 8102 1410 137 529 O ATOM 245 N ALA A 944 4.734 -10.591 -19.101 1.00 48.26 N ANISOU 245 N ALA A 944 5172 6316 6850 97 34 354 N ATOM 246 CA ALA A 944 4.845 -9.483 -18.122 1.00 53.40 C ANISOU 246 CA ALA A 944 5424 7169 7695 -141 -55 345 C ATOM 247 C ALA A 944 3.538 -9.404 -17.327 1.00 55.82 C ANISOU 247 C ALA A 944 5889 7156 8163 -505 -58 189 C ATOM 248 O ALA A 944 3.587 -9.205 -16.091 1.00 60.90 O ANISOU 248 O ALA A 944 6466 7856 8817 -564 -84 168 O ATOM 249 CB ALA A 944 5.163 -8.170 -18.816 1.00 46.47 C ANISOU 249 CB ALA A 944 4056 6571 7029 -327 -157 393 C ATOM 250 N LEU A 945 2.403 -9.559 -18.012 1.00 57.46 N ANISOU 250 N LEU A 945 6291 7058 8482 -738 -31 76 N ATOM 251 CA LEU A 945 1.077 -9.500 -17.354 1.00 57.04 C ANISOU 251 CA LEU A 945 6364 6739 8571 -1104 -24 -93 C ATOM 252 C LEU A 945 0.934 -10.699 -16.409 1.00 63.36 C ANISOU 252 C LEU A 945 7603 7344 9126 -996 73 -88 C ATOM 253 O LEU A 945 0.445 -10.498 -15.281 1.00 56.00 O ANISOU 253 O LEU A 945 6644 6391 8241 -1203 71 -167 O ATOM 254 CB LEU A 945 -0.010 -9.457 -18.428 1.00 51.29 C ANISOU 254 CB LEU A 945 5738 5757 7993 -1340 -22 -212 C ATOM 255 CG LEU A 945 -0.083 -8.144 -19.200 1.00 45.21 C ANISOU 255 CG LEU A 945 4555 5134 7489 -1527 -151 -249 C ATOM 256 CD1 LEU A 945 -0.986 -8.293 -20.406 1.00 37.52 C ANISOU 256 CD1 LEU A 945 3846 3993 6418 -1569 -140 -308 C ATOM 257 CD2 LEU A 945 -0.560 -6.997 -18.320 1.00 42.62 C ANISOU 257 CD2 LEU A 945 4225 5087 6882 -1575 -236 -270 C ATOM 258 N GLY A 946 1.397 -11.880 -16.830 1.00 50.37 N ANISOU 258 N GLY A 946 6355 5575 7210 -669 139 3 N ATOM 259 CA GLY A 946 1.420 -13.105 -16.007 1.00 55.49 C ANISOU 259 CA GLY A 946 7491 6018 7576 -517 199 33 C ATOM 260 C GLY A 946 2.216 -12.935 -14.723 1.00 58.43 C ANISOU 260 C GLY A 946 7733 6614 7854 -373 173 92 C ATOM 261 O GLY A 946 1.702 -13.306 -13.654 1.00 55.87 O ANISOU 261 O GLY A 946 7632 6138 7458 -530 204 48 O ATOM 262 N LYS A 947 3.429 -12.391 -14.810 1.00 68.25 N ANISOU 262 N LYS A 947 8622 8219 9089 -96 116 191 N ATOM 263 CA LYS A 947 4.296 -12.147 -13.626 1.00 60.52 C ANISOU 263 CA LYS A 947 7472 7489 8033 67 73 249 C ATOM 264 C LYS A 947 3.658 -11.075 -12.730 1.00 60.63 C ANISOU 264 C LYS A 947 7163 7569 8305 -328 26 156 C ATOM 265 O LYS A 947 3.723 -11.271 -11.501 1.00 71.35 O ANISOU 265 O LYS A 947 8622 8919 9567 -319 28 149 O ATOM 266 CB LYS A 947 5.714 -11.776 -14.061 1.00 59.66 C ANISOU 266 CB LYS A 947 7019 7786 7862 427 19 370 C ATOM 267 CG LYS A 947 6.476 -12.870 -14.800 1.00 61.35 C ANISOU 267 CG LYS A 947 7537 8002 7773 899 53 445 C ATOM 268 CD LYS A 947 7.977 -12.606 -14.843 1.00 66.07 C ANISOU 268 CD LYS A 947 7789 9069 8247 1290 4 552 C ATOM 269 CE LYS A 947 8.731 -13.464 -15.836 1.00 60.75 C ANISOU 269 CE LYS A 947 7294 8488 7299 1757 29 602 C ATOM 270 NZ LYS A 947 9.976 -12.798 -16.290 1.00 63.83 N ANISOU 270 NZ LYS A 947 7160 9423 7668 1979 -3 694 N ATOM 271 N LEU A 948 3.056 -10.015 -13.304 1.00 59.47 N ANISOU 271 N LEU A 948 6671 7471 8454 -642 -27 77 N ATOM 272 CA LEU A 948 2.351 -8.935 -12.553 1.00 56.08 C ANISOU 272 CA LEU A 948 5936 7096 8276 -1006 -104 -48 C ATOM 273 C LEU A 948 1.150 -9.523 -11.805 1.00 56.94 C ANISOU 273 C LEU A 948 6372 6925 8339 -1259 -18 -178 C ATOM 274 O LEU A 948 0.956 -9.169 -10.614 1.00 50.76 O ANISOU 274 O LEU A 948 5490 6215 7580 -1383 -42 -238 O ATOM 275 CB LEU A 948 1.885 -7.823 -13.500 1.00 44.53 C ANISOU 275 CB LEU A 948 4128 5686 7104 -1260 -201 -121 C ATOM 276 CG LEU A 948 2.952 -6.824 -13.937 1.00 42.24 C ANISOU 276 CG LEU A 948 3401 5732 6915 -1156 -330 -6 C ATOM 277 CD1 LEU A 948 2.356 -5.813 -14.913 1.00 37.39 C ANISOU 277 CD1 LEU A 948 2796 5149 6262 -1318 -373 -95 C ATOM 278 CD2 LEU A 948 3.576 -6.116 -12.740 1.00 40.94 C ANISOU 278 CD2 LEU A 948 2953 5814 6787 -1137 -437 23 C ATOM 279 N GLN A 949 0.370 -10.376 -12.473 1.00 60.90 N ANISOU 279 N GLN A 949 7241 7131 8768 -1346 76 -221 N ATOM 280 CA GLN A 949 -0.813 -11.048 -11.865 1.00 55.05 C ANISOU 280 CA GLN A 949 6840 6125 7952 -1628 170 -332 C ATOM 281 C GLN A 949 -0.344 -11.854 -10.650 1.00 56.59 C ANISOU 281 C GLN A 949 7340 6293 7870 -1467 218 -247 C ATOM 282 O GLN A 949 -0.907 -11.652 -9.577 1.00 55.62 O ANISOU 282 O GLN A 949 7184 6192 7758 -1699 238 -332 O ATOM 283 CB GLN A 949 -1.546 -11.933 -12.881 1.00 55.88 C ANISOU 283 CB GLN A 949 7325 5914 7993 -1707 244 -357 C ATOM 284 CG GLN A 949 -2.722 -12.717 -12.294 1.00 63.56 C ANISOU 284 CG GLN A 949 8671 6624 8855 -2023 341 -449 C ATOM 285 CD GLN A 949 -3.664 -13.271 -13.342 1.00 64.44 C ANISOU 285 CD GLN A 949 9042 6451 8991 -2206 384 -516 C ATOM 286 OE1 GLN A 949 -3.257 -13.640 -14.438 1.00 64.24 O ANISOU 286 OE1 GLN A 949 9156 6324 8928 -1980 367 -442 O ATOM 287 NE2 GLN A 949 -4.945 -13.344 -13.017 1.00 62.50 N ANISOU 287 NE2 GLN A 949 8703 6295 8748 -2271 339 -562 N ATOM 288 N ASP A 950 0.675 -12.702 -10.812 1.00 64.17 N ANISOU 288 N ASP A 950 8577 7223 8580 -1065 225 -96 N ATOM 289 CA ASP A 950 1.197 -13.586 -9.731 1.00 70.87 C ANISOU 289 CA ASP A 950 9793 8006 9127 -857 246 -12 C ATOM 290 C ASP A 950 1.561 -12.734 -8.513 1.00 69.37 C ANISOU 290 C ASP A 950 9253 8085 9019 -890 194 -30 C ATOM 291 O ASP A 950 0.969 -12.948 -7.439 1.00 79.16 O ANISOU 291 O ASP A 950 10660 9240 10179 -1102 238 -82 O ATOM 292 CB ASP A 950 2.432 -14.389 -10.155 1.00 83.08 C ANISOU 292 CB ASP A 950 11580 9567 10418 -337 213 129 C ATOM 293 CG ASP A 950 2.173 -15.516 -11.142 1.00 92.03 C ANISOU 293 CG ASP A 950 13207 10387 11374 -222 246 157 C ATOM 294 OD1 ASP A 950 0.977 -15.831 -11.402 1.00 89.71 O ANISOU 294 OD1 ASP A 950 13145 9813 11128 -577 304 79 O ATOM 295 OD2 ASP A 950 3.181 -16.079 -11.638 1.00100.77 O ANISOU 295 OD2 ASP A 950 14461 11543 12284 235 203 247 O ATOM 296 N VAL A 951 2.476 -11.786 -8.699 1.00 60.96 N ANISOU 296 N VAL A 951 7719 7340 8104 -709 97 14 N ATOM 297 CA VAL A 951 3.024 -10.930 -7.609 1.00 62.59 C ANISOU 297 CA VAL A 951 7573 7821 8388 -682 12 15 C ATOM 298 C VAL A 951 1.915 -10.064 -6.988 1.00 60.70 C ANISOU 298 C VAL A 951 7098 7596 8369 -1112 -2 -147 C ATOM 299 O VAL A 951 1.917 -9.936 -5.746 1.00 59.96 O ANISOU 299 O VAL A 951 6995 7570 8216 -1150 -15 -174 O ATOM 300 CB VAL A 951 4.193 -10.074 -8.123 1.00 61.98 C ANISOU 300 CB VAL A 951 7035 8082 8432 -446 -102 103 C ATOM 301 CG1 VAL A 951 4.609 -9.018 -7.108 1.00 51.89 C ANISOU 301 CG1 VAL A 951 5355 7072 7288 -491 -221 89 C ATOM 302 CG2 VAL A 951 5.361 -10.967 -8.513 1.00 62.66 C ANISOU 302 CG2 VAL A 951 7332 8224 8251 26 -88 243 C ATOM 303 N VAL A 952 1.010 -9.476 -7.779 1.00 67.39 N ANISOU 303 N VAL A 952 7759 8396 9451 -1403 -12 -265 N ATOM 304 CA VAL A 952 -0.091 -8.636 -7.208 1.00 64.74 C ANISOU 304 CA VAL A 952 7185 8100 9313 -1783 -44 -457 C ATOM 305 C VAL A 952 -0.931 -9.492 -6.257 1.00 67.94 C ANISOU 305 C VAL A 952 7961 8334 9518 -1972 90 -520 C ATOM 306 O VAL A 952 -1.306 -8.972 -5.187 1.00 69.76 O ANISOU 306 O VAL A 952 8029 8693 9785 -2128 66 -622 O ATOM 307 CB VAL A 952 -0.988 -7.970 -8.267 1.00 59.74 C ANISOU 307 CB VAL A 952 6370 7420 8910 -2001 -98 -565 C ATOM 308 CG1 VAL A 952 -2.275 -7.457 -7.642 1.00 60.51 C ANISOU 308 CG1 VAL A 952 6549 7509 8932 -1996 -188 -549 C ATOM 309 CG2 VAL A 952 -0.271 -6.835 -8.983 1.00 53.24 C ANISOU 309 CG2 VAL A 952 5272 6818 8137 -1790 -280 -418 C ATOM 310 N ASN A 953 -1.196 -10.747 -6.637 1.00 66.82 N ANISOU 310 N ASN A 953 8308 7920 9160 -1960 213 -457 N ATOM 311 CA ASN A 953 -2.078 -11.695 -5.901 1.00 66.13 C ANISOU 311 CA ASN A 953 8646 7629 8853 -2202 344 -495 C ATOM 312 C ASN A 953 -1.360 -12.190 -4.630 1.00 69.56 C ANISOU 312 C ASN A 953 9308 8095 9028 -2009 353 -388 C ATOM 313 O ASN A 953 -2.002 -12.213 -3.565 1.00 72.80 O ANISOU 313 O ASN A 953 9772 8532 9356 -2254 410 -463 O ATOM 314 CB ASN A 953 -2.575 -12.817 -6.827 1.00 58.61 C ANISOU 314 CB ASN A 953 8153 6351 7764 -2267 433 -455 C ATOM 315 CG ASN A 953 -3.632 -12.370 -7.826 1.00 59.13 C ANISOU 315 CG ASN A 953 8028 6368 8071 -2565 443 -607 C ATOM 316 OD1 ASN A 953 -4.402 -11.445 -7.577 1.00 56.31 O ANISOU 316 OD1 ASN A 953 7268 6241 7886 -2578 358 -699 O ATOM 317 ND2 ASN A 953 -3.688 -13.025 -8.975 1.00 59.77 N ANISOU 317 ND2 ASN A 953 8371 6223 8116 -2495 463 -554 N ATOM 318 N GLN A 954 -0.077 -12.552 -4.715 1.00 68.58 N ANISOU 318 N GLN A 954 9298 7991 8768 -1579 294 -229 N ATOM 319 CA GLN A 954 0.768 -12.897 -3.534 1.00 72.28 C ANISOU 319 CA GLN A 954 9935 8519 9011 -1330 265 -134 C ATOM 320 C GLN A 954 0.748 -11.755 -2.512 1.00 71.30 C ANISOU 320 C GLN A 954 9363 8677 9052 -1441 201 -224 C ATOM 321 O GLN A 954 0.633 -12.042 -1.311 1.00 81.07 O ANISOU 321 O GLN A 954 10784 9905 10114 -1498 234 -227 O ATOM 322 CB GLN A 954 2.244 -13.094 -3.898 1.00 80.35 C ANISOU 322 CB GLN A 954 10954 9636 9941 -818 174 11 C ATOM 323 CG GLN A 954 2.572 -14.382 -4.645 1.00 83.25 C ANISOU 323 CG GLN A 954 11843 9739 10050 -560 202 113 C ATOM 324 CD GLN A 954 4.068 -14.594 -4.718 1.00 90.03 C ANISOU 324 CD GLN A 954 12687 10754 10765 -20 107 229 C ATOM 325 OE1 GLN A 954 4.798 -14.296 -3.772 1.00 99.74 O ANISOU 325 OE1 GLN A 954 13779 12171 11946 160 42 258 O ATOM 326 NE2 GLN A 954 4.549 -15.098 -5.846 1.00 84.63 N ANISOU 326 NE2 GLN A 954 12128 10020 10007 259 92 285 N ATOM 327 N ASN A 955 0.927 -10.516 -2.977 1.00 68.28 N ANISOU 327 N ASN A 955 8437 8530 8978 -1450 94 -285 N ATOM 328 CA ASN A 955 1.022 -9.309 -2.115 1.00 65.67 C ANISOU 328 CA ASN A 955 7656 8471 8825 -1512 -21 -372 C ATOM 329 C ASN A 955 -0.354 -9.022 -1.520 1.00 57.70 C ANISOU 329 C ASN A 955 6599 7453 7873 -1924 42 -563 C ATOM 330 O ASN A 955 -0.401 -8.516 -0.377 1.00 57.73 O ANISOU 330 O ASN A 955 6450 7615 7871 -1968 -3 -630 O ATOM 331 CB ASN A 955 1.591 -8.103 -2.866 1.00 66.78 C ANISOU 331 CB ASN A 955 7283 8831 9258 -1428 -183 -373 C ATOM 332 CG ASN A 955 3.084 -8.215 -3.107 1.00 73.88 C ANISOU 332 CG ASN A 955 8129 9861 10080 -1018 -258 -192 C ATOM 333 OD1 ASN A 955 3.711 -9.227 -2.771 1.00 75.29 O ANISOU 333 OD1 ASN A 955 8665 9955 9987 -751 -197 -80 O ATOM 334 ND2 ASN A 955 3.665 -7.173 -3.683 1.00 71.06 N ANISOU 334 ND2 ASN A 955 7329 9724 9947 -969 -403 -167 N ATOM 335 N ALA A 956 -1.423 -9.346 -2.252 1.00 63.78 N ANISOU 335 N ALA A 956 7489 8062 8682 -2204 140 -654 N ATOM 336 CA ALA A 956 -2.809 -9.182 -1.765 1.00 54.86 C ANISOU 336 CA ALA A 956 6315 6951 7577 -2611 219 -852 C ATOM 337 C ALA A 956 -3.021 -10.161 -0.614 1.00 64.84 C ANISOU 337 C ALA A 956 7999 8127 8512 -2696 354 -800 C ATOM 338 O ALA A 956 -3.538 -9.746 0.443 1.00 65.88 O ANISOU 338 O ALA A 956 7985 8428 8617 -2872 368 -921 O ATOM 339 CB ALA A 956 -3.809 -9.392 -2.870 1.00 51.95 C ANISOU 339 CB ALA A 956 6030 6430 7279 -2663 253 -871 C ATOM 340 N GLN A 957 -2.600 -11.409 -0.800 1.00 69.33 N ANISOU 340 N GLN A 957 9084 8440 8818 -2559 433 -626 N ATOM 341 CA GLN A 957 -2.776 -12.460 0.234 1.00 79.41 C ANISOU 341 CA GLN A 957 10856 9576 9742 -2651 544 -551 C ATOM 342 C GLN A 957 -1.942 -12.079 1.470 1.00 79.68 C ANISOU 342 C GLN A 957 10784 9792 9697 -2419 467 -508 C ATOM 343 O GLN A 957 -2.515 -12.065 2.582 1.00 79.01 O ANISOU 343 O GLN A 957 10739 9797 9486 -2643 532 -579 O ATOM 344 CB GLN A 957 -2.432 -13.842 -0.326 1.00 82.68 C ANISOU 344 CB GLN A 957 11876 9643 9894 -2510 590 -377 C ATOM 345 CG GLN A 957 -2.983 -14.978 0.531 1.00 89.48 C ANISOU 345 CG GLN A 957 13309 10296 10393 -2751 704 -319 C ATOM 346 CD GLN A 957 -2.041 -16.154 0.635 1.00 92.04 C ANISOU 346 CD GLN A 957 14231 10344 10395 -2410 658 -120 C ATOM 347 OE1 GLN A 957 -1.809 -16.692 1.717 1.00 81.08 O ANISOU 347 OE1 GLN A 957 13184 8894 8730 -2385 666 -46 O ATOM 348 NE2 GLN A 957 -1.483 -16.564 -0.494 1.00 94.72 N ANISOU 348 NE2 GLN A 957 14716 10521 10754 -2126 598 -42 N ATOM 349 N ALA A 958 -0.658 -11.743 1.284 1.00 71.88 N ANISOU 349 N ALA A 958 9643 8888 8782 -1998 332 -404 N ATOM 350 CA ALA A 958 0.275 -11.359 2.371 1.00 67.11 C ANISOU 350 CA ALA A 958 8921 8457 8119 -1731 232 -356 C ATOM 351 C ALA A 958 -0.394 -10.310 3.266 1.00 66.40 C ANISOU 351 C ALA A 958 8435 8618 8175 -1974 206 -530 C ATOM 352 O ALA A 958 -0.344 -10.476 4.491 1.00 62.92 O ANISOU 352 O ALA A 958 8133 8227 7547 -1975 225 -526 O ATOM 353 CB ALA A 958 1.575 -10.849 1.798 1.00 71.52 C ANISOU 353 CB ALA A 958 9202 9148 8825 -1325 80 -263 C ATOM 354 N LEU A 959 -1.012 -9.285 2.666 1.00 82.84 N ANISOU 354 N LEU A 959 10063 10848 10565 -2160 150 -688 N ATOM 355 CA LEU A 959 -1.751 -8.211 3.385 1.00 67.62 C ANISOU 355 CA LEU A 959 7734 9168 8790 -2376 94 -897 C ATOM 356 C LEU A 959 -2.940 -8.822 4.138 1.00 60.45 C ANISOU 356 C LEU A 959 7072 8236 7660 -2736 277 -997 C ATOM 357 O LEU A 959 -3.106 -8.477 5.324 1.00 62.14 O ANISOU 357 O LEU A 959 7192 8629 7789 -2783 268 -1077 O ATOM 358 CB LEU A 959 -2.203 -7.126 2.400 1.00 55.13 C ANISOU 358 CB LEU A 959 5696 7692 7558 -2487 -22 -1048 C ATOM 359 CG LEU A 959 -2.958 -5.947 3.019 1.00 53.86 C ANISOU 359 CG LEU A 959 5298 7653 7514 -2359 -139 -1125 C ATOM 360 CD1 LEU A 959 -2.292 -5.467 4.296 1.00 60.69 C ANISOU 360 CD1 LEU A 959 5993 8726 8340 -2288 -238 -1170 C ATOM 361 CD2 LEU A 959 -3.078 -4.791 2.042 1.00 50.39 C ANISOU 361 CD2 LEU A 959 4724 7114 7307 -2061 -330 -997 C ATOM 362 N ASN A 960 -3.710 -9.715 3.502 1.00 61.71 N ANISOU 362 N ASN A 960 7545 8193 7710 -2986 435 -986 N ATOM 363 CA ASN A 960 -4.939 -10.332 4.090 1.00 59.75 C ANISOU 363 CA ASN A 960 7521 7939 7241 -3404 621 -1077 C ATOM 364 C ASN A 960 -4.574 -11.269 5.250 1.00 71.80 C ANISOU 364 C ASN A 960 9519 9369 8391 -3371 706 -926 C ATOM 365 O ASN A 960 -5.314 -11.267 6.256 1.00 68.13 O ANISOU 365 O ASN A 960 9056 9064 7768 -3642 803 -1025 O ATOM 366 CB ASN A 960 -5.775 -11.067 3.047 1.00 58.96 C ANISOU 366 CB ASN A 960 7653 7626 7122 -3676 742 -1083 C ATOM 367 CG ASN A 960 -6.384 -10.112 2.051 1.00 66.68 C ANISOU 367 CG ASN A 960 8211 8713 8411 -3373 614 -1150 C ATOM 368 OD1 ASN A 960 -7.024 -9.139 2.438 1.00 60.29 O ANISOU 368 OD1 ASN A 960 7073 8120 7715 -3227 536 -1251 O ATOM 369 ND2 ASN A 960 -6.174 -10.371 0.769 1.00 70.93 N ANISOU 369 ND2 ASN A 960 8825 9060 9065 -3270 583 -1074 N ATOM 370 N THR A 961 -3.478 -12.026 5.127 1.00 59.12 N ANISOU 370 N THR A 961 8298 7530 6634 -3042 663 -707 N ATOM 371 CA THR A 961 -2.896 -12.866 6.211 1.00 61.62 C ANISOU 371 CA THR A 961 9087 7728 6597 -2912 688 -554 C ATOM 372 C THR A 961 -2.400 -11.978 7.363 1.00 70.77 C ANISOU 372 C THR A 961 9924 9164 7802 -2736 589 -613 C ATOM 373 O THR A 961 -2.583 -12.351 8.544 1.00 77.86 O ANISOU 373 O THR A 961 11063 10089 8430 -2846 657 -597 O ATOM 374 CB THR A 961 -1.726 -13.706 5.688 1.00 63.07 C ANISOU 374 CB THR A 961 9676 7635 6654 -2508 612 -344 C ATOM 375 OG1 THR A 961 -2.235 -14.570 4.675 1.00 69.35 O ANISOU 375 OG1 THR A 961 10811 8157 7381 -2674 692 -294 O ATOM 376 CG2 THR A 961 -1.037 -14.511 6.768 1.00 65.59 C ANISOU 376 CG2 THR A 961 10481 7822 6618 -2314 594 -201 C ATOM 377 N LEU A 962 -1.742 -10.868 7.037 1.00 62.53 N ANISOU 377 N LEU A 962 8383 8306 7071 -2468 421 -667 N ATOM 378 CA LEU A 962 -1.304 -9.893 8.057 1.00 66.72 C ANISOU 378 CA LEU A 962 8563 9102 7684 -2307 292 -740 C ATOM 379 C LEU A 962 -2.558 -9.408 8.793 1.00 68.05 C ANISOU 379 C LEU A 962 8522 9494 7839 -2684 378 -952 C ATOM 380 O LEU A 962 -2.621 -9.617 10.015 1.00 70.82 O ANISOU 380 O LEU A 962 9034 9922 7954 -2723 426 -952 O ATOM 381 CB LEU A 962 -0.517 -8.760 7.393 1.00 57.49 C ANISOU 381 CB LEU A 962 6894 8079 6869 -2032 82 -762 C ATOM 382 CG LEU A 962 -0.086 -7.628 8.321 1.00 63.83 C ANISOU 382 CG LEU A 962 7303 9148 7800 -1878 -94 -848 C ATOM 383 CD1 LEU A 962 0.760 -8.148 9.470 1.00 73.47 C ANISOU 383 CD1 LEU A 962 8821 10337 8756 -1629 -111 -720 C ATOM 384 CD2 LEU A 962 0.672 -6.563 7.551 1.00 64.19 C ANISOU 384 CD2 LEU A 962 6896 9311 8183 -1663 -313 -846 C ATOM 385 N VAL A 963 -3.548 -8.865 8.078 1.00 70.60 N ANISOU 385 N VAL A 963 8530 9921 8375 -2952 404 -1132 N ATOM 386 CA VAL A 963 -4.763 -8.257 8.707 1.00 71.85 C ANISOU 386 CA VAL A 963 8394 10362 8543 -3275 461 -1383 C ATOM 387 C VAL A 963 -5.416 -9.268 9.666 1.00 75.02 C ANISOU 387 C VAL A 963 9213 10746 8547 -3571 680 -1346 C ATOM 388 O VAL A 963 -5.876 -8.842 10.738 1.00 77.32 O ANISOU 388 O VAL A 963 9336 11305 8736 -3680 703 -1484 O ATOM 389 CB VAL A 963 -5.769 -7.737 7.660 1.00 67.58 C ANISOU 389 CB VAL A 963 7568 9865 8246 -3417 461 -1538 C ATOM 390 CG1 VAL A 963 -7.174 -7.592 8.221 1.00 59.52 C ANISOU 390 CG1 VAL A 963 6499 9016 7098 -3526 579 -1665 C ATOM 391 CG2 VAL A 963 -5.316 -6.421 7.054 1.00 77.18 C ANISOU 391 CG2 VAL A 963 8413 11096 9817 -2959 208 -1524 C ATOM 392 N LYS A 964 -5.488 -10.552 9.308 1.00 76.09 N ANISOU 392 N LYS A 964 9881 10584 8447 -3711 827 -1170 N ATOM 393 CA LYS A 964 -6.197 -11.563 10.141 1.00 79.11 C ANISOU 393 CA LYS A 964 10703 10927 8429 -4071 1031 -1119 C ATOM 394 C LYS A 964 -5.379 -11.808 11.412 1.00 81.27 C ANISOU 394 C LYS A 964 11238 11193 8449 -3847 994 -993 C ATOM 395 O LYS A 964 -5.968 -11.822 12.510 1.00 86.31 O ANISOU 395 O LYS A 964 11895 12035 8862 -4081 1097 -1067 O ATOM 396 CB LYS A 964 -6.484 -12.842 9.347 1.00 88.44 C ANISOU 396 CB LYS A 964 12414 11754 9434 -4285 1154 -962 C ATOM 397 CG LYS A 964 -7.670 -12.717 8.394 1.00 95.97 C ANISOU 397 CG LYS A 964 13146 12771 10548 -4655 1246 -1121 C ATOM 398 CD LYS A 964 -7.914 -13.914 7.489 1.00 98.67 C ANISOU 398 CD LYS A 964 13995 12742 10754 -4841 1332 -968 C ATOM 399 CE LYS A 964 -8.662 -13.546 6.221 1.00 90.01 C ANISOU 399 CE LYS A 964 12576 11691 9934 -4773 1294 -1087 C ATOM 400 NZ LYS A 964 -8.164 -14.289 5.036 1.00 80.45 N ANISOU 400 NZ LYS A 964 11716 10091 8759 -4678 1260 -930 N ATOM 401 N GLN A 965 -4.064 -11.949 11.280 1.00 72.03 N ANISOU 401 N GLN A 965 10231 9825 7311 -3399 847 -824 N ATOM 402 CA GLN A 965 -3.191 -12.241 12.440 1.00 73.26 C ANISOU 402 CA GLN A 965 10671 9940 7224 -3140 788 -699 C ATOM 403 C GLN A 965 -3.009 -10.983 13.303 1.00 79.30 C ANISOU 403 C GLN A 965 10921 11057 8152 -2981 667 -857 C ATOM 404 O GLN A 965 -2.595 -11.138 14.464 1.00 81.21 O ANISOU 404 O GLN A 965 11355 11333 8169 -2864 649 -803 O ATOM 405 CB GLN A 965 -1.846 -12.796 11.990 1.00 74.86 C ANISOU 405 CB GLN A 965 11188 9851 7403 -2690 657 -492 C ATOM 406 CG GLN A 965 -1.169 -13.563 13.113 1.00 91.41 C ANISOU 406 CG GLN A 965 13796 11802 9134 -2514 637 -342 C ATOM 407 CD GLN A 965 0.062 -14.328 12.691 1.00 96.53 C ANISOU 407 CD GLN A 965 14846 12147 9683 -2079 515 -151 C ATOM 408 OE1 GLN A 965 0.530 -14.243 11.551 1.00 94.98 O ANISOU 408 OE1 GLN A 965 14512 11878 9699 -1868 443 -122 O ATOM 409 NE2 GLN A 965 0.607 -15.079 13.637 1.00 95.30 N ANISOU 409 NE2 GLN A 965 15195 11830 9184 -1925 484 -29 N ATOM 410 N LEU A 966 -3.292 -9.788 12.761 1.00 84.45 N ANISOU 410 N LEU A 966 10974 11942 9172 -2966 565 -1046 N ATOM 411 CA LEU A 966 -3.277 -8.501 13.510 1.00 61.28 C ANISOU 411 CA LEU A 966 7531 9343 6408 -2845 419 -1232 C ATOM 412 C LEU A 966 -4.546 -8.390 14.356 1.00 61.73 C ANISOU 412 C LEU A 966 7493 9675 6285 -3225 573 -1425 C ATOM 413 O LEU A 966 -4.422 -8.034 15.530 1.00 69.13 O ANISOU 413 O LEU A 966 8367 10803 7096 -3138 532 -1481 O ATOM 414 CB LEU A 966 -3.172 -7.321 12.544 1.00 57.17 C ANISOU 414 CB LEU A 966 6467 8934 6321 -2715 230 -1362 C ATOM 415 CG LEU A 966 -1.789 -7.073 11.943 1.00 60.82 C ANISOU 415 CG LEU A 966 6873 9255 6981 -2302 32 -1201 C ATOM 416 CD1 LEU A 966 -1.849 -5.926 10.954 1.00 58.40 C ANISOU 416 CD1 LEU A 966 6056 9057 7075 -2265 -143 -1328 C ATOM 417 CD2 LEU A 966 -0.760 -6.778 13.019 1.00 60.04 C ANISOU 417 CD2 LEU A 966 6775 9227 6811 -1968 -117 -1130 C ATOM 418 N SER A 967 -5.714 -8.704 13.792 1.00 66.44 N ANISOU 418 N SER A 967 8079 10311 6855 -3629 744 -1526 N ATOM 419 CA SER A 967 -7.008 -8.796 14.527 1.00 70.54 C ANISOU 419 CA SER A 967 8538 11119 7146 -4052 935 -1700 C ATOM 420 C SER A 967 -6.889 -9.821 15.664 1.00 77.27 C ANISOU 420 C SER A 967 9923 11890 7545 -4175 1087 -1527 C ATOM 421 O SER A 967 -7.431 -9.566 16.757 1.00 80.82 O ANISOU 421 O SER A 967 10258 12651 7800 -4323 1160 -1655 O ATOM 422 CB SER A 967 -8.169 -9.144 13.624 1.00 67.61 C ANISOU 422 CB SER A 967 8128 10758 6801 -4468 1095 -1797 C ATOM 423 OG SER A 967 -8.399 -8.145 12.643 1.00 70.85 O ANISOU 423 OG SER A 967 8050 11261 7610 -4354 948 -1979 O ATOM 424 N SER A 968 -6.218 -10.945 15.413 1.00 67.77 N ANISOU 424 N SER A 968 9299 10288 6162 -4109 1122 -1254 N ATOM 425 CA SER A 968 -5.970 -11.996 16.430 1.00 75.23 C ANISOU 425 CA SER A 968 10847 11075 6663 -4190 1225 -1061 C ATOM 426 C SER A 968 -5.138 -11.409 17.577 1.00 71.12 C ANISOU 426 C SER A 968 10226 10689 6108 -3824 1082 -1068 C ATOM 427 O SER A 968 -5.555 -11.539 18.744 1.00 72.75 O ANISOU 427 O SER A 968 10542 11084 6016 -4008 1185 -1103 O ATOM 428 CB SER A 968 -5.301 -13.196 15.807 1.00 82.87 C ANISOU 428 CB SER A 968 12434 11562 7489 -4095 1219 -793 C ATOM 429 OG SER A 968 -4.878 -14.124 16.800 1.00 84.98 O ANISOU 429 OG SER A 968 13306 11640 7343 -4085 1252 -606 O ATOM 430 N ASN A 969 -4.013 -10.769 17.248 1.00 65.87 N ANISOU 430 N ASN A 969 9346 9950 5732 -3338 851 -1039 N ATOM 431 CA ASN A 969 -3.091 -10.150 18.236 1.00 65.60 C ANISOU 431 CA ASN A 969 9193 10022 5711 -2945 673 -1040 C ATOM 432 C ASN A 969 -3.840 -9.076 19.054 1.00 65.61 C ANISOU 432 C ASN A 969 8698 10464 5767 -3058 663 -1303 C ATOM 433 O ASN A 969 -3.805 -9.173 20.292 1.00 67.71 O ANISOU 433 O ASN A 969 9117 10846 5762 -3049 694 -1301 O ATOM 434 CB ASN A 969 -1.817 -9.631 17.558 1.00 62.87 C ANISOU 434 CB ASN A 969 8653 9546 5689 -2459 428 -966 C ATOM 435 CG ASN A 969 -0.850 -10.736 17.178 1.00 63.71 C ANISOU 435 CG ASN A 969 9304 9264 5639 -2232 410 -710 C ATOM 436 OD1 ASN A 969 -1.134 -11.916 17.367 1.00 66.28 O ANISOU 436 OD1 ASN A 969 10197 9365 5620 -2437 561 -581 O ATOM 437 ND2 ASN A 969 0.306 -10.371 16.647 1.00 61.83 N ANISOU 437 ND2 ASN A 969 8907 8953 5633 -1807 212 -639 N ATOM 438 N PHE A 970 -4.511 -8.103 18.424 1.00 63.18 N ANISOU 438 N PHE A 970 7839 10396 5770 -3148 612 -1531 N ATOM 439 CA PHE A 970 -5.196 -7.003 19.146 1.00 63.22 C ANISOU 439 CA PHE A 970 7351 10830 5839 -3190 556 -1815 C ATOM 440 C PHE A 970 -6.249 -7.583 20.079 1.00 66.66 C ANISOU 440 C PHE A 970 7968 11489 5869 -3597 814 -1882 C ATOM 441 O PHE A 970 -6.394 -7.069 21.189 1.00 67.87 O ANISOU 441 O PHE A 970 7962 11931 5894 -3535 783 -2012 O ATOM 442 CB PHE A 970 -5.857 -6.003 18.199 1.00 60.88 C ANISOU 442 CB PHE A 970 6503 10718 5909 -3252 458 -2058 C ATOM 443 CG PHE A 970 -4.895 -5.125 17.442 1.00 57.66 C ANISOU 443 CG PHE A 970 5811 10190 5908 -2868 165 -2039 C ATOM 444 CD1 PHE A 970 -3.851 -4.492 18.094 1.00 56.97 C ANISOU 444 CD1 PHE A 970 5628 10115 5904 -2478 -71 -1997 C ATOM 445 CD2 PHE A 970 -5.050 -4.924 16.081 1.00 55.51 C ANISOU 445 CD2 PHE A 970 5367 9802 5924 -2921 121 -2061 C ATOM 446 CE1 PHE A 970 -2.969 -3.687 17.392 1.00 55.89 C ANISOU 446 CE1 PHE A 970 5225 9888 6123 -2173 -341 -1965 C ATOM 447 CE2 PHE A 970 -4.166 -4.123 15.381 1.00 52.85 C ANISOU 447 CE2 PHE A 970 4776 9370 5934 -2607 -144 -2028 C ATOM 448 CZ PHE A 970 -3.129 -3.505 16.038 1.00 52.33 C ANISOU 448 CZ PHE A 970 4612 9332 5940 -2249 -374 -1976 C ATOM 449 N GLY A 971 -6.980 -8.598 19.625 1.00 68.75 N ANISOU 449 N GLY A 971 8547 11640 5934 -4013 1055 -1798 N ATOM 450 CA GLY A 971 -7.939 -9.327 20.473 1.00 73.81 C ANISOU 450 CA GLY A 971 9437 12469 6138 -4467 1321 -1808 C ATOM 451 C GLY A 971 -7.263 -9.773 21.756 1.00 74.76 C ANISOU 451 C GLY A 971 9964 12520 5923 -4324 1322 -1648 C ATOM 452 O GLY A 971 -7.740 -9.399 22.837 1.00 76.64 O ANISOU 452 O GLY A 971 10037 13119 5962 -4413 1380 -1793 O ATOM 453 N ALA A 972 -6.156 -10.503 21.619 1.00 74.13 N ANISOU 453 N ALA A 972 10379 11999 5788 -4072 1239 -1375 N ATOM 454 CA ALA A 972 -5.349 -11.085 22.719 1.00 76.26 C ANISOU 454 CA ALA A 972 11142 12100 5735 -3888 1209 -1187 C ATOM 455 C ALA A 972 -4.826 -9.984 23.657 1.00 76.45 C ANISOU 455 C ALA A 972 10789 12387 5872 -3504 1021 -1329 C ATOM 456 O ALA A 972 -4.751 -10.235 24.871 1.00 78.95 O ANISOU 456 O ALA A 972 11356 12783 5858 -3515 1067 -1290 O ATOM 457 CB ALA A 972 -4.214 -11.904 22.140 1.00 75.68 C ANISOU 457 CB ALA A 972 11565 11521 5669 -3603 1100 -919 C ATOM 458 N ILE A 973 -4.474 -8.819 23.115 1.00 71.99 N ANISOU 458 N ILE A 973 9672 11936 5746 -3188 803 -1482 N ATOM 459 CA ILE A 973 -3.962 -7.659 23.899 1.00 77.02 C ANISOU 459 CA ILE A 973 9919 12806 6538 -2810 573 -1629 C ATOM 460 C ILE A 973 -5.116 -7.096 24.743 1.00 74.39 C ANISOU 460 C ILE A 973 9263 12954 6049 -3062 682 -1895 C ATOM 461 O ILE A 973 -4.988 -7.097 25.984 1.00 76.99 O ANISOU 461 O ILE A 973 9723 13420 6109 -2988 688 -1901 O ATOM 462 CB ILE A 973 -3.316 -6.617 22.962 1.00 67.11 C ANISOU 462 CB ILE A 973 8200 11514 5785 -2463 297 -1702 C ATOM 463 CG1 ILE A 973 -1.987 -7.131 22.404 1.00 66.58 C ANISOU 463 CG1 ILE A 973 8441 11044 5814 -2138 173 -1440 C ATOM 464 CG2 ILE A 973 -3.144 -5.275 23.652 1.00 67.74 C ANISOU 464 CG2 ILE A 973 7800 11891 6047 -2182 54 -1915 C ATOM 465 CD1 ILE A 973 -1.489 -6.348 21.214 1.00 68.59 C ANISOU 465 CD1 ILE A 973 8296 11243 6523 -1924 -32 -1470 C ATOM 466 N SER A 974 -6.215 -6.675 24.107 1.00 74.26 N ANISOU 466 N SER A 974 8851 13194 6169 -3344 768 -2113 N ATOM 467 CA SER A 974 -7.400 -6.079 24.784 1.00 76.02 C ANISOU 467 CA SER A 974 8690 13939 6257 -3571 865 -2414 C ATOM 468 C SER A 974 -7.899 -6.998 25.909 1.00 84.54 C ANISOU 468 C SER A 974 10168 15152 6800 -3906 1138 -2329 C ATOM 469 O SER A 974 -8.347 -6.464 26.938 1.00 86.79 O ANISOU 469 O SER A 974 10222 15843 6910 -3900 1151 -2523 O ATOM 470 CB SER A 974 -8.500 -5.765 23.803 1.00 75.21 C ANISOU 470 CB SER A 974 8201 14037 6338 -3861 945 -2628 C ATOM 471 OG SER A 974 -8.859 -6.921 23.063 1.00 85.36 O ANISOU 471 OG SER A 974 9862 15077 7493 -4244 1178 -2441 O ATOM 472 N SER A 975 -7.839 -8.319 25.720 1.00 83.28 N ANISOU 472 N SER A 975 10597 14669 6375 -4191 1334 -2053 N ATOM 473 CA SER A 975 -8.183 -9.341 26.745 1.00 85.34 C ANISOU 473 CA SER A 975 11365 14965 6095 -4538 1575 -1906 C ATOM 474 C SER A 975 -7.259 -9.167 27.954 1.00 92.57 C ANISOU 474 C SER A 975 12474 15840 6858 -4159 1432 -1833 C ATOM 475 O SER A 975 -7.769 -9.021 29.079 1.00 88.82 O ANISOU 475 O SER A 975 11945 15727 6075 -4290 1536 -1943 O ATOM 476 CB SER A 975 -8.095 -10.744 26.175 1.00 86.70 C ANISOU 476 CB SER A 975 12185 14692 6064 -4838 1726 -1604 C ATOM 477 OG SER A 975 -8.058 -11.723 27.206 1.00 90.60 O ANISOU 477 OG SER A 975 13280 15094 6051 -5060 1870 -1406 O ATOM 478 N VAL A 976 -5.947 -9.169 27.709 1.00 90.32 N ANISOU 478 N VAL A 976 12388 15151 6780 -3699 1199 -1663 N ATOM 479 CA VAL A 976 -4.892 -9.091 28.762 1.00 84.76 C ANISOU 479 CA VAL A 976 11922 14329 5954 -3291 1031 -1564 C ATOM 480 C VAL A 976 -5.004 -7.742 29.472 1.00 83.66 C ANISOU 480 C VAL A 976 11204 14615 5969 -3028 868 -1846 C ATOM 481 O VAL A 976 -4.867 -7.723 30.700 1.00 90.93 O ANISOU 481 O VAL A 976 12269 15673 6607 -2941 868 -1854 O ATOM 482 CB VAL A 976 -3.479 -9.300 28.185 1.00 88.83 C ANISOU 482 CB VAL A 976 12681 14369 6703 -2842 801 -1355 C ATOM 483 CG1 VAL A 976 -2.412 -9.104 29.247 1.00 90.17 C ANISOU 483 CG1 VAL A 976 13021 14459 6782 -2402 604 -1289 C ATOM 484 CG2 VAL A 976 -3.327 -10.669 27.539 1.00 95.55 C ANISOU 484 CG2 VAL A 976 14153 14785 7365 -3049 930 -1088 C ATOM 485 N LEU A 977 -5.255 -6.669 28.722 1.00 84.62 N ANISOU 485 N LEU A 977 10722 14923 6508 -2905 721 -2071 N ATOM 486 CA LEU A 977 -5.388 -5.291 29.266 1.00 86.08 C ANISOU 486 CA LEU A 977 10338 15492 6876 -2629 510 -2366 C ATOM 487 C LEU A 977 -6.583 -5.211 30.225 1.00 87.44 C ANISOU 487 C LEU A 977 10366 16170 6686 -2938 721 -2581 C ATOM 488 O LEU A 977 -6.422 -4.613 31.309 1.00 89.78 O ANISOU 488 O LEU A 977 10540 16702 6872 -2696 604 -2704 O ATOM 489 CB LEU A 977 -5.537 -4.289 28.114 1.00 84.04 C ANISOU 489 CB LEU A 977 9534 15289 7109 -2509 317 -2553 C ATOM 490 CG LEU A 977 -4.246 -3.886 27.396 1.00 79.39 C ANISOU 490 CG LEU A 977 8910 14336 6920 -2090 16 -2414 C ATOM 491 CD1 LEU A 977 -4.534 -2.825 26.343 1.00 73.96 C ANISOU 491 CD1 LEU A 977 7678 13748 6675 -2024 -176 -2619 C ATOM 492 CD2 LEU A 977 -3.186 -3.383 28.370 1.00 76.83 C ANISOU 492 CD2 LEU A 977 8619 13970 6602 -1642 -241 -2376 C ATOM 493 N ASN A 978 -7.736 -5.770 29.846 1.00103.11 N ANISOU 493 N ASN A 978 12346 18342 8489 -3449 1014 -2631 N ATOM 494 CA ASN A 978 -8.980 -5.758 30.666 1.00106.02 C ANISOU 494 CA ASN A 978 12536 19261 8484 -3811 1254 -2842 C ATOM 495 C ASN A 978 -8.758 -6.533 31.970 1.00109.05 C ANISOU 495 C ASN A 978 13427 19641 8366 -3911 1404 -2662 C ATOM 496 O ASN A 978 -9.214 -6.049 33.019 1.00109.47 O ANISOU 496 O ASN A 978 13263 20143 8186 -3889 1434 -2859 O ATOM 497 CB ASN A 978 -10.171 -6.329 29.898 1.00111.93 C ANISOU 497 CB ASN A 978 13222 20169 9139 -4373 1540 -2890 C ATOM 498 CG ASN A 978 -10.587 -5.438 28.752 1.00109.68 C ANISOU 498 CG ASN A 978 12374 19991 9309 -4283 1394 -3138 C ATOM 499 OD1 ASN A 978 -10.155 -4.285 28.659 1.00 97.28 O ANISOU 499 OD1 ASN A 978 10410 18469 8083 -3836 1085 -3320 O ATOM 500 ND2 ASN A 978 -11.405 -5.978 27.864 1.00111.73 N ANISOU 500 ND2 ASN A 978 12624 20263 9567 -4713 1598 -3138 N ATOM 501 N ASP A 979 -8.086 -7.687 31.897 1.00111.29 N ANISOU 501 N ASP A 979 14373 19437 8477 -4003 1479 -2309 N ATOM 502 CA ASP A 979 -7.680 -8.510 33.069 1.00108.37 C ANISOU 502 CA ASP A 979 14599 18939 7638 -4055 1573 -2091 C ATOM 503 C ASP A 979 -6.745 -7.727 33.994 1.00112.43 C ANISOU 503 C ASP A 979 15024 19464 8231 -3490 1298 -2150 C ATOM 504 O ASP A 979 -6.900 -7.865 35.212 1.00124.09 O ANISOU 504 O ASP A 979 16674 21158 9317 -3544 1385 -2160 O ATOM 505 CB ASP A 979 -6.962 -9.795 32.655 1.00112.70 C ANISOU 505 CB ASP A 979 15879 18879 8062 -4142 1610 -1718 C ATOM 506 CG ASP A 979 -7.777 -11.041 32.932 1.00121.33 C ANISOU 506 CG ASP A 979 17482 19978 8641 -4780 1939 -1549 C ATOM 507 OD1 ASP A 979 -8.957 -11.064 32.514 1.00129.97 O ANISOU 507 OD1 ASP A 979 18276 21369 9738 -5220 2138 -1673 O ATOM 508 OD2 ASP A 979 -7.231 -11.965 33.586 1.00121.48 O ANISOU 508 OD2 ASP A 979 18180 19675 8302 -4811 1961 -1290 O ATOM 509 N ILE A 980 -5.788 -6.979 33.439 1.00 96.86 N ANISOU 509 N ILE A 980 12819 17258 6727 -2987 978 -2172 N ATOM 510 CA ILE A 980 -4.799 -6.167 34.215 1.00 95.73 C ANISOU 510 CA ILE A 980 12567 17091 6716 -2425 668 -2223 C ATOM 511 C ILE A 980 -5.522 -4.998 34.902 1.00 96.34 C ANISOU 511 C ILE A 980 12069 17734 6800 -2335 600 -2580 C ATOM 512 O ILE A 980 -5.198 -4.731 36.081 1.00 97.94 O ANISOU 512 O ILE A 980 12348 18063 6800 -2100 511 -2619 O ATOM 513 CB ILE A 980 -3.634 -5.705 33.314 1.00 91.64 C ANISOU 513 CB ILE A 980 11930 16194 6696 -1981 352 -2141 C ATOM 514 CG1 ILE A 980 -2.673 -6.865 33.049 1.00 91.84 C ANISOU 514 CG1 ILE A 980 12596 15681 6617 -1926 370 -1794 C ATOM 515 CG2 ILE A 980 -2.908 -4.498 33.898 1.00 90.07 C ANISOU 515 CG2 ILE A 980 11384 16101 6738 -1457 1 -2291 C ATOM 516 CD1 ILE A 980 -1.708 -6.610 31.926 1.00 88.20 C ANISOU 516 CD1 ILE A 980 12014 14890 6607 -1605 139 -1702 C ATOM 517 N LEU A 981 -6.457 -4.337 34.211 1.00107.83 N ANISOU 517 N LEU A 981 12990 19515 8466 -2492 626 -2840 N ATOM 518 CA LEU A 981 -7.217 -3.174 34.747 1.00 96.86 C ANISOU 518 CA LEU A 981 11018 18686 7097 -2377 531 -3226 C ATOM 519 C LEU A 981 -8.159 -3.615 35.872 1.00108.89 C ANISOU 519 C LEU A 981 12638 20668 8066 -2718 835 -3311 C ATOM 520 O LEU A 981 -8.396 -2.799 36.783 1.00107.54 O ANISOU 520 O LEU A 981 12166 20899 7794 -2491 724 -3563 O ATOM 521 CB LEU A 981 -8.008 -2.518 33.615 1.00 98.96 C ANISOU 521 CB LEU A 981 10754 19147 7700 -2490 494 -3470 C ATOM 522 CG LEU A 981 -7.174 -1.724 32.613 1.00 90.44 C ANISOU 522 CG LEU A 981 9444 17738 7181 -2108 135 -3469 C ATOM 523 CD1 LEU A 981 -8.045 -1.216 31.479 1.00 88.86 C ANISOU 523 CD1 LEU A 981 8790 17710 7261 -2278 129 -3696 C ATOM 524 CD2 LEU A 981 -6.456 -0.566 33.294 1.00 89.35 C ANISOU 524 CD2 LEU A 981 9068 17655 7225 -1570 -256 -3613 C ATOM 525 N SER A 982 -8.701 -4.835 35.799 1.00110.12 N ANISOU 525 N SER A 982 13191 20783 7867 -3253 1194 -3115 N ATOM 526 CA SER A 982 -9.568 -5.427 36.852 1.00113.73 C ANISOU 526 CA SER A 982 13801 21547 7865 -3626 1492 -3085 C ATOM 527 C SER A 982 -8.710 -5.795 38.069 1.00118.52 C ANISOU 527 C SER A 982 14907 21983 8141 -3414 1444 -2901 C ATOM 528 O SER A 982 -9.103 -5.409 39.189 1.00132.60 O ANISOU 528 O SER A 982 16529 24094 9759 -3327 1459 -3024 O ATOM 529 CB SER A 982 -10.350 -6.609 36.336 1.00116.95 C ANISOU 529 CB SER A 982 14486 21824 8127 -4237 1816 -2874 C ATOM 530 OG SER A 982 -9.514 -7.744 36.166 1.00123.22 O ANISOU 530 OG SER A 982 16007 22076 8736 -4339 1869 -2510 O ATOM 531 N ARG A 983 -7.584 -6.494 37.851 1.00105.98 N ANISOU 531 N ARG A 983 13887 19856 6523 -3292 1362 -2607 N ATOM 532 CA ARG A 983 -6.573 -6.825 38.896 1.00115.81 C ANISOU 532 CA ARG A 983 15634 20824 7543 -2995 1245 -2412 C ATOM 533 C ARG A 983 -6.185 -5.545 39.654 1.00118.59 C ANISOU 533 C ARG A 983 15561 21430 8066 -2449 947 -2665 C ATOM 534 O ARG A 983 -6.173 -5.585 40.897 1.00110.91 O ANISOU 534 O ARG A 983 14767 20651 6724 -2389 983 -2681 O ATOM 535 CB ARG A 983 -5.288 -7.427 38.306 1.00113.87 C ANISOU 535 CB ARG A 983 15869 19887 7511 -2738 1069 -2102 C ATOM 536 CG ARG A 983 -5.289 -8.929 38.033 1.00110.44 C ANISOU 536 CG ARG A 983 16145 19061 6755 -3158 1298 -1772 C ATOM 537 CD ARG A 983 -3.856 -9.460 37.911 1.00115.16 C ANISOU 537 CD ARG A 983 17269 19032 7453 -2760 1072 -1500 C ATOM 538 NE ARG A 983 -3.626 -10.702 37.168 1.00122.28 N ANISOU 538 NE ARG A 983 18758 19449 8252 -3001 1170 -1212 N ATOM 539 CZ ARG A 983 -2.575 -11.518 37.333 1.00128.91 C ANISOU 539 CZ ARG A 983 20243 19775 8961 -2771 1044 -954 C ATOM 540 NH1 ARG A 983 -1.652 -11.264 38.251 1.00135.84 N ANISOU 540 NH1 ARG A 983 21274 20555 9785 -2316 832 -934 N ATOM 541 NH2 ARG A 983 -2.464 -12.610 36.592 1.00123.96 N ANISOU 541 NH2 ARG A 983 20128 18732 8241 -2989 1119 -725 N ATOM 542 N LEU A 984 -5.864 -4.470 38.920 1.00127.49 N ANISOU 542 N LEU A 984 16180 22537 9724 -2076 650 -2843 N ATOM 543 CA LEU A 984 -5.378 -3.162 39.447 1.00125.09 C ANISOU 543 CA LEU A 984 15470 22390 9670 -1519 285 -3076 C ATOM 544 C LEU A 984 -6.454 -2.493 40.315 1.00129.71 C ANISOU 544 C LEU A 984 15650 23643 9990 -1586 368 -3419 C ATOM 545 O LEU A 984 -6.080 -1.889 41.345 1.00128.82 O ANISOU 545 O LEU A 984 15489 23668 9788 -1214 173 -3530 O ATOM 546 CB LEU A 984 -5.000 -2.273 38.260 1.00107.20 C ANISOU 546 CB LEU A 984 12769 19959 8005 -1248 -12 -3175 C ATOM 547 CG LEU A 984 -4.517 -0.869 38.605 1.00105.98 C ANISOU 547 CG LEU A 984 12186 19924 8159 -709 -434 -3412 C ATOM 548 CD1 LEU A 984 -3.483 -0.423 37.586 1.00104.55 C ANISOU 548 CD1 LEU A 984 11904 19313 8509 -406 -754 -3301 C ATOM 549 CD2 LEU A 984 -5.687 0.111 38.689 1.00109.46 C ANISOU 549 CD2 LEU A 984 12037 20941 8613 -746 -459 -3823 C ATOM 550 N ASP A 985 -7.727 -2.556 39.905 1.00126.49 N ANISOU 550 N ASP A 985 14937 23583 9540 -1998 623 -3563 N ATOM 551 CA ASP A 985 -8.873 -2.019 40.690 1.00128.09 C ANISOU 551 CA ASP A 985 14722 24287 9659 -2063 726 -3796 C ATOM 552 C ASP A 985 -8.939 -2.759 42.034 1.00128.19 C ANISOU 552 C ASP A 985 15165 24357 9183 -2213 938 -3626 C ATOM 553 O ASP A 985 -9.032 -2.080 43.085 1.00121.54 O ANISOU 553 O ASP A 985 14133 23782 8266 -1924 824 -3789 O ATOM 554 CB ASP A 985 -10.182 -2.108 39.900 1.00127.31 C ANISOU 554 CB ASP A 985 14245 24465 9663 -2498 957 -3917 C ATOM 555 CG ASP A 985 -10.290 -1.077 38.789 1.00123.99 C ANISOU 555 CG ASP A 985 13287 24080 9742 -2269 703 -4165 C ATOM 556 OD1 ASP A 985 -9.460 -0.145 38.761 1.00120.22 O ANISOU 556 OD1 ASP A 985 12664 23457 9557 -1757 327 -4266 O ATOM 557 OD2 ASP A 985 -11.203 -1.216 37.957 1.00123.10 O ANISOU 557 OD2 ASP A 985 12918 24114 9740 -2607 867 -4242 O ATOM 558 N LYS A 986 -8.842 -4.093 41.995 1.00131.24 N ANISOU 558 N LYS A 986 16143 24458 9264 -2624 1208 -3300 N ATOM 559 CA LYS A 986 -8.927 -4.989 43.183 1.00126.54 C ANISOU 559 CA LYS A 986 16055 23833 8191 -2843 1427 -3083 C ATOM 560 C LYS A 986 -7.732 -4.768 44.119 1.00127.68 C ANISOU 560 C LYS A 986 16531 23776 8204 -2354 1182 -3023 C ATOM 561 O LYS A 986 -7.918 -4.935 45.339 1.00142.30 O ANISOU 561 O LYS A 986 18563 25776 9729 -2361 1272 -2994 O ATOM 562 CB LYS A 986 -9.060 -6.455 42.751 1.00127.13 C ANISOU 562 CB LYS A 986 16707 23554 8043 -3379 1709 -2736 C ATOM 563 CG LYS A 986 -10.432 -7.080 42.980 1.00131.38 C ANISOU 563 CG LYS A 986 17165 24382 8371 -3967 2046 -2707 C ATOM 564 CD LYS A 986 -11.605 -6.108 42.898 1.00138.31 C ANISOU 564 CD LYS A 986 17248 25867 9438 -4003 2068 -3070 C ATOM 565 CE LYS A 986 -12.121 -5.891 41.492 1.00140.33 C ANISOU 565 CE LYS A 986 17110 26157 10052 -4177 2071 -3191 C ATOM 566 NZ LYS A 986 -12.876 -4.620 41.369 1.00145.04 N ANISOU 566 NZ LYS A 986 16917 27274 10918 -3965 1943 -3594 N ATOM 567 N VAL A 987 -6.564 -4.392 43.592 1.00128.36 N ANISOU 567 N VAL A 987 16677 23557 8536 -1941 872 -3013 N ATOM 568 CA VAL A 987 -5.374 -4.034 44.422 1.00130.84 C ANISOU 568 CA VAL A 987 17219 23702 8794 -1410 570 -2992 C ATOM 569 C VAL A 987 -5.599 -2.629 45.005 1.00136.27 C ANISOU 569 C VAL A 987 17311 24756 9711 -985 316 -3328 C ATOM 570 O VAL A 987 -5.454 -2.483 46.228 1.00141.35 O ANISOU 570 O VAL A 987 18089 25495 10122 -787 273 -3345 O ATOM 571 CB VAL A 987 -4.059 -4.161 43.627 1.00115.71 C ANISOU 571 CB VAL A 987 15533 21181 7252 -1088 299 -2784 C ATOM 572 CG1 VAL A 987 -2.888 -3.492 44.328 1.00115.66 C ANISOU 572 CG1 VAL A 987 15558 20974 7412 -464 -88 -2796 C ATOM 573 CG2 VAL A 987 -3.733 -5.617 43.334 1.00116.79 C ANISOU 573 CG2 VAL A 987 16370 20851 7155 -1418 512 -2410 C ATOM 574 N GLU A 988 -5.970 -1.647 44.177 1.00138.45 N ATOM 575 CA GLU A 988 -6.339 -0.284 44.642 1.00142.30 C ATOM 576 C GLU A 988 -7.682 -0.369 45.378 1.00148.47 C ATOM 577 O GLU A 988 -7.839 0.366 46.381 1.00158.90 O ATOM 578 CB GLU A 988 -6.443 0.695 43.474 1.00140.40 C ATOM 579 CG GLU A 988 -5.131 0.938 42.748 1.00136.33 C ATOM 580 CD GLU A 988 -5.098 2.245 41.973 1.00132.66 C ATOM 581 OE1 GLU A 988 -6.188 2.800 41.709 1.00134.96 O ATOM 582 OE2 GLU A 988 -3.985 2.715 41.652 1.00127.32 O