>>6LXT:HELIX    7 AA7 GLN C  913  GLU C  988  1                                  76    
QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 7 AA7 GLN C 913 GLU C 988 1 76 ATOM 1771 N GLN C 913 -1.978 -1.635 -65.446 1.00114.68 N ANISOU 1771 N GLN C 913 15064 15934 12577 -519 -162 1389 N ATOM 1772 CA GLN C 913 -0.676 -1.591 -64.713 1.00116.70 C ANISOU 1772 CA GLN C 913 15089 16586 12665 -918 -74 1423 C ATOM 1773 C GLN C 913 -0.540 -0.279 -63.920 1.00117.34 C ANISOU 1773 C GLN C 913 15727 16291 12566 -1272 -229 1573 C ATOM 1774 O GLN C 913 0.321 -0.244 -63.019 1.00118.00 O ANISOU 1774 O GLN C 913 15649 16596 12589 -1501 -168 1579 O ATOM 1775 CB GLN C 913 0.518 -1.794 -65.655 1.00120.62 C ANISOU 1775 CB GLN C 913 15266 17729 12835 -1364 32 1454 C ATOM 1776 CG GLN C 913 0.984 -3.245 -65.756 1.00117.05 C ANISOU 1776 CG GLN C 913 14077 17833 12562 -1091 235 1271 C ATOM 1777 CD GLN C 913 0.054 -4.132 -66.552 1.00109.99 C ANISOU 1777 CD GLN C 913 12984 16882 11925 -588 279 1150 C ATOM 1778 OE1 GLN C 913 -0.697 -3.676 -67.408 1.00111.67 O ANISOU 1778 OE1 GLN C 913 13539 16805 12084 -554 177 1212 O ATOM 1779 NE2 GLN C 913 0.106 -5.425 -66.274 1.00100.44 N ANISOU 1779 NE2 GLN C 913 11222 15951 10991 -190 429 973 N ATOM 1780 N ASN C 914 -1.340 0.753 -64.233 1.00114.90 N ANISOU 1780 N ASN C 914 16047 15440 12170 -1310 -429 1682 N ATOM 1781 CA ASN C 914 -1.500 1.977 -63.393 1.00120.15 C ANISOU 1781 CA ASN C 914 17297 15617 12736 -1517 -606 1799 C ATOM 1782 C ASN C 914 -2.229 1.588 -62.098 1.00121.96 C ANISOU 1782 C ASN C 914 17442 15538 13359 -1023 -597 1667 C ATOM 1783 O ASN C 914 -1.724 1.937 -61.007 1.00124.65 O ANISOU 1783 O ASN C 914 17829 15857 13677 -1207 -597 1695 O ATOM 1784 CB ASN C 914 -2.234 3.108 -64.130 1.00118.15 C ANISOU 1784 CB ASN C 914 17740 14852 12298 -1623 -840 1930 C ATOM 1785 CG ASN C 914 -2.389 4.382 -63.317 1.00116.06 C ANISOU 1785 CG ASN C 914 18101 14077 11919 -1835 -1038 2044 C ATOM 1786 OD1 ASN C 914 -1.904 5.439 -63.714 1.00120.96 O ANISOU 1786 OD1 ASN C 914 19185 14607 12166 -2359 -1163 2220 O ATOM 1787 ND2 ASN C 914 -3.078 4.313 -62.189 1.00113.91 N ANISOU 1787 ND2 ASN C 914 17868 13459 11954 -1442 -1074 1943 N ATOM 1788 N VAL C 915 -3.362 0.884 -62.221 1.00117.24 N ANISOU 1788 N VAL C 915 16719 14729 13097 -435 -585 1523 N ATOM 1789 CA VAL C 915 -4.219 0.439 -61.079 1.00108.32 C ANISOU 1789 CA VAL C 915 15506 13295 12354 74 -571 1375 C ATOM 1790 C VAL C 915 -3.375 -0.434 -60.147 1.00101.30 C ANISOU 1790 C VAL C 915 14082 12824 11585 75 -381 1300 C ATOM 1791 O VAL C 915 -3.465 -0.247 -58.922 1.00102.32 O ANISOU 1791 O VAL C 915 14287 12749 11840 148 -401 1274 O ATOM 1792 CB VAL C 915 -5.470 -0.327 -61.554 1.00108.33 C ANISOU 1792 CB VAL C 915 15376 13119 12666 664 -554 1215 C ATOM 1793 CG1 VAL C 915 -6.297 -0.835 -60.381 1.00 96.85 C ANISOU 1793 CG1 VAL C 915 13807 11406 11587 1145 -520 1052 C ATOM 1794 CG2 VAL C 915 -6.327 0.506 -62.498 1.00114.64 C ANISOU 1794 CG2 VAL C 915 16694 13518 13347 700 -753 1274 C ATOM 1795 N LEU C 916 -2.605 -1.363 -60.719 1.00100.59 N ANISOU 1795 N LEU C 916 13469 13296 11453 16 -211 1256 N ATOM 1796 CA LEU C 916 -1.699 -2.273 -59.972 1.00 90.50 C ANISOU 1796 CA LEU C 916 11647 12479 10260 22 -36 1175 C ATOM 1797 C LEU C 916 -0.708 -1.439 -59.170 1.00 90.78 C ANISOU 1797 C LEU C 916 11846 12597 10051 -466 -75 1292 C ATOM 1798 O LEU C 916 -0.624 -1.655 -57.955 1.00 88.10 O ANISOU 1798 O LEU C 916 11396 12205 9874 -336 -40 1238 O ATOM 1799 CB LEU C 916 -0.961 -3.188 -60.949 1.00 84.35 C ANISOU 1799 CB LEU C 916 10357 12298 9393 -38 113 1123 C ATOM 1800 CG LEU C 916 -1.766 -4.395 -61.414 1.00 88.91 C ANISOU 1800 CG LEU C 916 10594 12903 10286 513 209 959 C ATOM 1801 CD1 LEU C 916 -1.084 -5.093 -62.579 1.00 97.12 C ANISOU 1801 CD1 LEU C 916 11218 14496 11189 406 324 922 C ATOM 1802 CD2 LEU C 916 -1.985 -5.361 -60.264 1.00 88.31 C ANISOU 1802 CD2 LEU C 916 10191 12814 10547 928 310 815 C ATOM 1803 N TYR C 917 -0.005 -0.519 -59.830 1.00 96.87 N ANISOU 1803 N TYR C 917 12881 13489 10436 -1016 -144 1443 N ATOM 1804 CA TYR C 917 1.038 0.322 -59.192 1.00 98.91 C ANISOU 1804 CA TYR C 917 13296 13876 10408 -1559 -174 1558 C ATOM 1805 C TYR C 917 0.392 1.149 -58.077 1.00102.81 C ANISOU 1805 C TYR C 917 14260 13790 11013 -1478 -316 1598 C ATOM 1806 O TYR C 917 0.956 1.175 -56.971 1.00109.56 O ANISOU 1806 O TYR C 917 15000 14741 11885 -1582 -275 1585 O ATOM 1807 CB TYR C 917 1.778 1.199 -60.204 1.00109.84 C ANISOU 1807 CB TYR C 917 14939 15451 11345 -2175 -232 1713 C ATOM 1808 CG TYR C 917 2.900 2.003 -59.594 1.00115.79 C ANISOU 1808 CG TYR C 917 15818 16390 11786 -2761 -244 1816 C ATOM 1809 CD1 TYR C 917 3.933 1.377 -58.908 1.00123.12 C ANISOU 1809 CD1 TYR C 917 16235 17838 12708 -2859 -94 1732 C ATOM 1810 CD2 TYR C 917 2.930 3.387 -59.679 1.00110.60 C ANISOU 1810 CD2 TYR C 917 15799 15387 10836 -3214 -412 1989 C ATOM 1811 CE1 TYR C 917 4.967 2.098 -58.330 1.00123.33 C ANISOU 1811 CE1 TYR C 917 16353 18060 12445 -3396 -100 1810 C ATOM 1812 CE2 TYR C 917 3.960 4.122 -59.114 1.00112.17 C ANISOU 1812 CE2 TYR C 917 16116 15762 10742 -3771 -418 2077 C ATOM 1813 CZ TYR C 917 4.982 3.477 -58.433 1.00118.22 C ANISOU 1813 CZ TYR C 917 16340 17072 11507 -3866 -256 1984 C ATOM 1814 OH TYR C 917 6.003 4.186 -57.867 1.00117.48 O ANISOU 1814 OH TYR C 917 16339 17178 11121 -4414 -255 2055 O ATOM 1815 N GLU C 918 -0.764 1.768 -58.335 1.00101.10 N ANISOU 1815 N GLU C 918 14536 13002 10877 -1272 -480 1627 N ATOM 1816 CA GLU C 918 -1.443 2.638 -57.336 1.00104.22 C ANISOU 1816 CA GLU C 918 15414 12820 11363 -1187 -639 1652 C ATOM 1817 C GLU C 918 -1.912 1.761 -56.166 1.00 95.35 C ANISOU 1817 C GLU C 918 13956 11644 10630 -697 -543 1488 C ATOM 1818 O GLU C 918 -1.844 2.246 -55.022 1.00 94.55 O ANISOU 1818 O GLU C 918 14026 11339 10560 -762 -593 1500 O ATOM 1819 CB GLU C 918 -2.523 3.507 -57.998 1.00103.58 C ANISOU 1819 CB GLU C 918 15932 12179 11245 -1083 -852 1708 C ATOM 1820 CG GLU C 918 -1.912 4.614 -58.861 1.00114.52 C ANISOU 1820 CG GLU C 918 17763 13558 12190 -1676 -975 1905 C ATOM 1821 CD GLU C 918 -2.749 5.833 -59.224 1.00118.92 C ANISOU 1821 CD GLU C 918 19066 13495 12625 -1709 -1239 2002 C ATOM 1822 OE1 GLU C 918 -3.858 5.998 -58.677 1.00118.82 O ANISOU 1822 OE1 GLU C 918 19285 12995 12865 -1272 -1356 1911 O ATOM 1823 OE2 GLU C 918 -2.266 6.638 -60.050 1.00116.30 O ANISOU 1823 OE2 GLU C 918 19091 13172 11924 -2188 -1334 2166 O ATOM 1824 N ASN C 919 -2.293 0.507 -56.427 1.00 84.29 N ANISOU 1824 N ASN C 919 12089 10444 9493 -259 -404 1343 N ATOM 1825 CA ASN C 919 -2.670 -0.472 -55.373 1.00 83.67 C ANISOU 1825 CA ASN C 919 11653 10368 9771 190 -292 1185 C ATOM 1826 C ASN C 919 -1.440 -0.776 -54.512 1.00 85.04 C ANISOU 1826 C ASN C 919 11487 10960 9863 -63 -177 1198 C ATOM 1827 O ASN C 919 -1.597 -0.869 -53.278 1.00 86.31 O ANISOU 1827 O ASN C 919 11629 10969 10197 94 -167 1144 O ATOM 1828 CB ASN C 919 -3.276 -1.753 -55.952 1.00 85.24 C ANISOU 1828 CB ASN C 919 11443 10711 10234 668 -168 1035 C ATOM 1829 CG ASN C 919 -4.749 -1.618 -56.276 1.00 89.93 C ANISOU 1829 CG ASN C 919 12325 10815 11028 1076 -271 958 C ATOM 1830 OD1 ASN C 919 -5.443 -0.795 -55.684 1.00 98.21 O ANISOU 1830 OD1 ASN C 919 13801 11396 12120 1136 -416 965 O ATOM 1831 ND2 ASN C 919 -5.239 -2.429 -57.201 1.00 83.29 N ANISOU 1831 ND2 ASN C 919 11244 10091 10311 1368 -199 868 N ATOM 1832 N GLN C 920 -0.267 -0.929 -55.131 1.00 74.90 N ANISOU 1832 N GLN C 920 9938 10199 8320 -435 -94 1255 N ATOM 1833 CA GLN C 920 0.992 -1.262 -54.416 1.00 74.64 C ANISOU 1833 CA GLN C 920 9536 10641 8182 -680 16 1247 C ATOM 1834 C GLN C 920 1.343 -0.087 -53.507 1.00 77.04 C ANISOU 1834 C GLN C 920 10238 10721 8313 -1056 -93 1358 C ATOM 1835 O GLN C 920 1.609 -0.326 -52.321 1.00 84.74 O ANISOU 1835 O GLN C 920 11058 11735 9404 -978 -49 1309 O ATOM 1836 CB GLN C 920 2.123 -1.571 -55.394 1.00 76.95 C ANISOU 1836 CB GLN C 920 9488 11549 8202 -1020 111 1268 C ATOM 1837 CG GLN C 920 1.870 -2.816 -56.230 1.00 90.71 C ANISOU 1837 CG GLN C 920 10788 13559 10120 -641 228 1143 C ATOM 1838 CD GLN C 920 2.702 -4.002 -55.808 1.00 98.15 C ANISOU 1838 CD GLN C 920 11111 15033 11150 -497 383 1015 C ATOM 1839 OE1 GLN C 920 3.923 -3.910 -55.693 1.00105.72 O ANISOU 1839 OE1 GLN C 920 11850 16457 11862 -871 431 1033 O ATOM 1840 NE2 GLN C 920 2.036 -5.128 -55.591 1.00 92.62 N ANISOU 1840 NE2 GLN C 920 10132 14267 10792 49 458 877 N ATOM 1841 N LYS C 921 1.315 1.135 -54.040 1.00 78.04 N ANISOU 1841 N LYS C 921 10878 10602 8171 -1441 -235 1501 N ATOM 1842 CA LYS C 921 1.524 2.371 -53.244 1.00 80.88 C ANISOU 1842 CA LYS C 921 11706 10665 8360 -1801 -365 1611 C ATOM 1843 C LYS C 921 0.608 2.314 -52.015 1.00 89.87 C ANISOU 1843 C LYS C 921 12964 11357 9825 -1380 -412 1526 C ATOM 1844 O LYS C 921 1.135 2.416 -50.886 1.00 95.71 O ANISOU 1844 O LYS C 921 13627 12171 10568 -1495 -384 1520 O ATOM 1845 CB LYS C 921 1.198 3.631 -54.049 1.00 82.65 C ANISOU 1845 CB LYS C 921 12559 10518 8326 -2120 -548 1760 C ATOM 1846 CG LYS C 921 2.195 4.077 -55.112 1.00 83.08 C ANISOU 1846 CG LYS C 921 12653 10947 7965 -2701 -536 1884 C ATOM 1847 CD LYS C 921 1.532 5.139 -55.980 1.00 97.64 C ANISOU 1847 CD LYS C 921 15144 12323 9633 -2854 -732 2012 C ATOM 1848 CE LYS C 921 2.450 6.026 -56.790 1.00106.84 C ANISOU 1848 CE LYS C 921 16584 13685 10325 -3546 -779 2178 C ATOM 1849 NZ LYS C 921 1.682 6.686 -57.875 1.00111.58 N ANISOU 1849 NZ LYS C 921 17702 13885 10808 -3558 -948 2275 N ATOM 1850 N LEU C 922 -0.705 2.144 -52.238 1.00 86.14 N ANISOU 1850 N LEU C 922 12658 10463 9609 -915 -478 1452 N ATOM 1851 CA LEU C 922 -1.764 2.090 -51.187 1.00 71.54 C ANISOU 1851 CA LEU C 922 10941 8164 8076 -480 -530 1346 C ATOM 1852 C LEU C 922 -1.359 1.083 -50.102 1.00 79.57 C ANISOU 1852 C LEU C 922 11465 9472 9297 -282 -370 1240 C ATOM 1853 O LEU C 922 -1.326 1.466 -48.912 1.00 83.20 O ANISOU 1853 O LEU C 922 12049 9760 9805 -317 -406 1235 O ATOM 1854 CB LEU C 922 -3.100 1.704 -51.837 1.00 67.60 C ANISOU 1854 CB LEU C 922 10513 7357 7816 11 -570 1243 C ATOM 1855 CG LEU C 922 -4.290 1.569 -50.893 1.00 67.19 C ANISOU 1855 CG LEU C 922 10564 6875 8089 482 -614 1103 C ATOM 1856 CD1 LEU C 922 -4.659 2.915 -50.296 1.00 77.93 C ANISOU 1856 CD1 LEU C 922 12510 7748 9353 324 -818 1162 C ATOM 1857 CD2 LEU C 922 -5.483 0.965 -51.611 1.00 63.23 C ANISOU 1857 CD2 LEU C 922 10008 6200 7817 963 -612 975 C ATOM 1858 N ILE C 923 -1.049 -0.155 -50.499 1.00 72.67 N ANISOU 1858 N ILE C 923 10061 9021 8529 -83 -207 1158 N ATOM 1859 CA ILE C 923 -0.637 -1.256 -49.574 1.00 70.01 C ANISOU 1859 CA ILE C 923 9232 8988 8380 139 -56 1052 C ATOM 1860 C ILE C 923 0.537 -0.775 -48.715 1.00 67.02 C ANISOU 1860 C ILE C 923 8822 8851 7791 -278 -49 1127 C ATOM 1861 O ILE C 923 0.491 -0.968 -47.496 1.00 68.68 O ANISOU 1861 O ILE C 923 8965 8978 8151 -137 -28 1075 O ATOM 1862 CB ILE C 923 -0.269 -2.532 -50.354 1.00 69.79 C ANISOU 1862 CB ILE C 923 8675 9428 8415 325 96 972 C ATOM 1863 CG1 ILE C 923 -1.501 -3.187 -50.980 1.00 67.07 C ANISOU 1863 CG1 ILE C 923 8306 8843 8335 806 112 867 C ATOM 1864 CG2 ILE C 923 0.491 -3.508 -49.470 1.00 60.40 C ANISOU 1864 CG2 ILE C 923 7010 8622 7319 431 227 893 C ATOM 1865 CD1 ILE C 923 -1.176 -4.168 -52.088 1.00 64.91 C ANISOU 1865 CD1 ILE C 923 7620 8987 8056 907 227 815 C ATOM 1866 N ALA C 924 1.558 -0.190 -49.340 1.00 71.97 N ANISOU 1866 N ALA C 924 9485 9785 8074 -782 -61 1239 N ATOM 1867 CA ALA C 924 2.800 0.261 -48.669 1.00 68.47 C ANISOU 1867 CA ALA C 924 8974 9658 7385 -1235 -43 1302 C ATOM 1868 C ALA C 924 2.488 1.401 -47.694 1.00 65.34 C ANISOU 1868 C ALA C 924 9067 8802 6958 -1398 -177 1370 C ATOM 1869 O ALA C 924 3.083 1.413 -46.607 1.00 78.70 O ANISOU 1869 O ALA C 924 10637 10628 8638 -1503 -144 1357 O ATOM 1870 CB ALA C 924 3.838 0.673 -49.683 1.00 62.04 C ANISOU 1870 CB ALA C 924 8122 9257 6195 -1752 -28 1393 C ATOM 1871 N ASN C 925 1.589 2.316 -48.055 1.00 69.42 N ANISOU 1871 N ASN C 925 10118 8798 7462 -1403 -330 1432 N ATOM 1872 CA ASN C 925 1.270 3.508 -47.221 1.00 78.25 C ANISOU 1872 CA ASN C 925 11754 9449 8527 -1571 -484 1495 C ATOM 1873 C ASN C 925 0.392 3.107 -46.027 1.00 74.95 C ANISOU 1873 C ASN C 925 11301 8719 8458 -1102 -482 1371 C ATOM 1874 O ASN C 925 0.588 3.684 -44.925 1.00 73.91 O ANISOU 1874 O ASN C 925 11337 8445 8302 -1246 -530 1387 O ATOM 1875 CB ASN C 925 0.634 4.622 -48.056 1.00 79.30 C ANISOU 1875 CB ASN C 925 12485 9135 8509 -1725 -668 1594 C ATOM 1876 CG ASN C 925 1.631 5.282 -48.991 1.00 82.60 C ANISOU 1876 CG ASN C 925 13039 9827 8518 -2319 -688 1742 C ATOM 1877 OD1 ASN C 925 2.816 5.417 -48.670 1.00 80.90 O ANISOU 1877 OD1 ASN C 925 12651 10011 8078 -2741 -617 1791 O ATOM 1878 ND2 ASN C 925 1.167 5.690 -50.161 1.00 89.06 N ANISOU 1878 ND2 ASN C 925 14162 10452 9224 -2365 -785 1808 N ATOM 1879 N GLN C 926 -0.555 2.187 -46.249 1.00 73.30 N ANISOU 1879 N GLN C 926 10897 8405 8548 -580 -428 1248 N ATOM 1880 CA GLN C 926 -1.421 1.596 -45.194 1.00 68.28 C ANISOU 1880 CA GLN C 926 10158 7534 8253 -110 -397 1108 C ATOM 1881 C GLN C 926 -0.540 0.805 -44.215 1.00 69.33 C ANISOU 1881 C GLN C 926 9841 8069 8432 -119 -254 1069 C ATOM 1882 O GLN C 926 -0.687 0.991 -42.988 1.00 57.84 O ANISOU 1882 O GLN C 926 8461 6439 7075 -62 -274 1034 O ATOM 1883 CB GLN C 926 -2.489 0.711 -45.837 1.00 69.84 C ANISOU 1883 CB GLN C 926 10203 7619 8713 389 -350 987 C ATOM 1884 CG GLN C 926 -3.523 1.470 -46.660 1.00 64.89 C ANISOU 1884 CG GLN C 926 10031 6549 8077 480 -507 996 C ATOM 1885 CD GLN C 926 -4.172 2.592 -45.887 1.00 58.19 C ANISOU 1885 CD GLN C 926 9685 5189 7234 459 -682 995 C ATOM 1886 OE1 GLN C 926 -3.582 3.651 -45.698 1.00 66.45 O ANISOU 1886 OE1 GLN C 926 11057 6156 8036 43 -788 1119 O ATOM 1887 NE2 GLN C 926 -5.397 2.372 -45.434 1.00 63.48 N ANISOU 1887 NE2 GLN C 926 10426 5516 8179 904 -714 845 N ATOM 1888 N PHE C 927 0.361 -0.024 -44.745 1.00 61.13 N ANISOU 1888 N PHE C 927 8358 7556 7312 -191 -124 1070 N ATOM 1889 CA PHE C 927 1.283 -0.883 -43.964 1.00 56.56 C ANISOU 1889 CA PHE C 927 7313 7419 6758 -176 5 1023 C ATOM 1890 C PHE C 927 2.179 -0.013 -43.084 1.00 58.07 C ANISOU 1890 C PHE C 927 7642 7692 6729 -607 -41 1105 C ATOM 1891 O PHE C 927 2.312 -0.323 -41.895 1.00 68.44 O ANISOU 1891 O PHE C 927 8821 9025 8158 -491 -5 1053 O ATOM 1892 CB PHE C 927 2.143 -1.743 -44.887 1.00 62.94 C ANISOU 1892 CB PHE C 927 7668 8786 7462 -226 121 1007 C ATOM 1893 CG PHE C 927 3.111 -2.631 -44.156 1.00 69.06 C ANISOU 1893 CG PHE C 927 7967 10027 8246 -187 233 945 C ATOM 1894 CD1 PHE C 927 2.651 -3.616 -43.300 1.00 70.17 C ANISOU 1894 CD1 PHE C 927 7888 10097 8677 256 297 836 C ATOM 1895 CD2 PHE C 927 4.476 -2.485 -44.319 1.00 64.60 C ANISOU 1895 CD2 PHE C 927 7179 9976 7389 -592 269 987 C ATOM 1896 CE1 PHE C 927 3.535 -4.443 -42.623 1.00 66.67 C ANISOU 1896 CE1 PHE C 927 7031 10064 8235 314 382 779 C ATOM 1897 CE2 PHE C 927 5.359 -3.317 -43.648 1.00 61.37 C ANISOU 1897 CE2 PHE C 927 6327 10005 6987 -522 357 912 C ATOM 1898 CZ PHE C 927 4.889 -4.293 -42.801 1.00 66.20 C ANISOU 1898 CZ PHE C 927 6744 10517 7891 -60 407 813 C ATOM 1899 N ASN C 928 2.774 1.032 -43.663 1.00 57.79 N ANISOU 1899 N ASN C 928 7874 7706 6377 -1101 -117 1227 N ATOM 1900 CA ASN C 928 3.700 1.960 -42.962 1.00 62.38 C ANISOU 1900 CA ASN C 928 8613 8388 6700 -1588 -163 1312 C ATOM 1901 C ASN C 928 2.907 2.740 -41.914 1.00 61.06 C ANISOU 1901 C ASN C 928 8869 7674 6657 -1506 -280 1313 C ATOM 1902 O ASN C 928 3.441 2.997 -40.828 1.00 59.18 O ANISOU 1902 O ASN C 928 8608 7506 6370 -1666 -275 1317 O ATOM 1903 CB ASN C 928 4.417 2.901 -43.935 1.00 66.33 C ANISOU 1903 CB ASN C 928 9345 9035 6823 -2147 -219 1441 C ATOM 1904 CG ASN C 928 5.482 2.235 -44.787 1.00 71.87 C ANISOU 1904 CG ASN C 928 9588 10382 7337 -2336 -95 1430 C ATOM 1905 OD1 ASN C 928 6.007 1.178 -44.443 1.00 76.41 O ANISOU 1905 OD1 ASN C 928 9651 11372 8008 -2138 27 1332 O ATOM 1906 ND2 ASN C 928 5.833 2.863 -45.899 1.00 67.29 N ANISOU 1906 ND2 ASN C 928 9196 9900 6472 -2730 -134 1526 N ATOM 1907 N SER C 929 1.675 3.108 -42.249 1.00 58.47 N ANISOU 1907 N SER C 929 8907 6833 6475 -1261 -385 1299 N ATOM 1908 CA SER C 929 0.688 3.701 -41.313 1.00 68.49 C ANISOU 1908 CA SER C 929 10547 7559 7917 -1065 -500 1255 C ATOM 1909 C SER C 929 0.538 2.760 -40.112 1.00 70.32 C ANISOU 1909 C SER C 929 10429 7876 8412 -715 -393 1135 C ATOM 1910 O SER C 929 0.961 3.129 -38.997 1.00 56.94 O ANISOU 1910 O SER C 929 8775 6184 6676 -875 -405 1144 O ATOM 1911 CB SER C 929 -0.627 3.964 -42.027 1.00 71.41 C ANISOU 1911 CB SER C 929 11250 7458 8423 -770 -610 1218 C ATOM 1912 OG SER C 929 -1.729 3.951 -41.130 1.00 77.33 O ANISOU 1912 OG SER C 929 12139 7798 9443 -386 -661 1099 O ATOM 1913 N ALA C 930 0.011 1.560 -40.359 1.00 66.30 N ANISOU 1913 N ALA C 930 9585 7458 8149 -275 -288 1030 N ATOM 1914 CA ALA C 930 -0.337 0.574 -39.319 1.00 57.16 C ANISOU 1914 CA ALA C 930 8133 6321 7263 111 -192 908 C ATOM 1915 C ALA C 930 0.870 0.408 -38.399 1.00 63.49 C ANISOU 1915 C ALA C 930 8675 7505 7942 -127 -125 940 C ATOM 1916 O ALA C 930 0.723 0.710 -37.199 1.00 61.80 O ANISOU 1916 O ALA C 930 8575 7111 7794 -114 -155 914 O ATOM 1917 CB ALA C 930 -0.763 -0.725 -39.953 1.00 54.98 C ANISOU 1917 CB ALA C 930 7502 6198 7190 514 -77 815 C ATOM 1918 N ILE C 931 2.022 0.015 -38.960 1.00 61.16 N ANISOU 1918 N ILE C 931 8056 7724 7459 -351 -46 987 N ATOM 1919 CA ILE C 931 3.277 -0.243 -38.189 1.00 59.57 C ANISOU 1919 CA ILE C 931 7543 7971 7119 -566 23 998 C ATOM 1920 C ILE C 931 3.565 0.949 -37.276 1.00 67.39 C ANISOU 1920 C ILE C 931 8868 8780 7959 -922 -71 1065 C ATOM 1921 O ILE C 931 3.846 0.704 -36.091 1.00 59.26 O ANISOU 1921 O ILE C 931 7700 7825 6991 -865 -40 1025 O ATOM 1922 CB ILE C 931 4.483 -0.529 -39.097 1.00 56.41 C ANISOU 1922 CB ILE C 931 6821 8141 6471 -843 90 1035 C ATOM 1923 CG1 ILE C 931 4.289 -1.797 -39.934 1.00 56.76 C ANISOU 1923 CG1 ILE C 931 6492 8408 6668 -478 188 954 C ATOM 1924 CG2 ILE C 931 5.756 -0.594 -38.267 1.00 53.15 C ANISOU 1924 CG2 ILE C 931 6138 8170 5885 -1099 136 1035 C ATOM 1925 CD1 ILE C 931 3.974 -3.040 -39.134 1.00 56.42 C ANISOU 1925 CD1 ILE C 931 6134 8397 6905 -4 270 840 C ATOM 1926 N GLY C 932 3.509 2.174 -37.812 1.00 54.43 N ANISOU 1926 N GLY C 932 7655 6909 6118 -1274 -186 1162 N ATOM 1927 CA GLY C 932 3.656 3.414 -37.031 1.00 63.21 C ANISOU 1927 CA GLY C 932 9161 7770 7085 -1614 -296 1226 C ATOM 1928 C GLY C 932 2.804 3.380 -35.775 1.00 67.11 C ANISOU 1928 C GLY C 932 9772 7891 7834 -1298 -328 1143 C ATOM 1929 O GLY C 932 3.365 3.509 -34.666 1.00 62.72 O ANISOU 1929 O GLY C 932 9141 7453 7236 -1431 -311 1138 O ATOM 1930 N LYS C 933 1.497 3.165 -35.935 1.00 71.29 N ANISOU 1930 N LYS C 933 10454 8016 8618 -888 -366 1066 N ATOM 1931 CA LYS C 933 0.516 3.106 -34.818 1.00 66.83 C ANISOU 1931 CA LYS C 933 10006 7079 8309 -557 -395 961 C ATOM 1932 C LYS C 933 0.905 2.012 -33.815 1.00 69.99 C ANISOU 1932 C LYS C 933 9967 7780 8845 -354 -262 891 C ATOM 1933 O LYS C 933 0.806 2.272 -32.604 1.00 59.98 O ANISOU 1933 O LYS C 933 8781 6375 7633 -349 -284 856 O ATOM 1934 CB LYS C 933 -0.892 2.816 -35.342 1.00 60.97 C ANISOU 1934 CB LYS C 933 9393 5963 7808 -126 -428 864 C ATOM 1935 CG LYS C 933 -1.429 3.823 -36.346 1.00 63.95 C ANISOU 1935 CG LYS C 933 10219 6002 8076 -246 -577 917 C ATOM 1936 CD LYS C 933 -2.910 4.100 -36.197 1.00 64.12 C ANISOU 1936 CD LYS C 933 10543 5504 8315 119 -681 796 C ATOM 1937 CE LYS C 933 -3.509 4.714 -37.443 1.00 60.51 C ANISOU 1937 CE LYS C 933 10426 4779 7787 121 -807 827 C ATOM 1938 NZ LYS C 933 -4.218 3.696 -38.253 1.00 66.38 N ANISOU 1938 NZ LYS C 933 10921 5575 8724 519 -723 737 N ATOM 1939 N ILE C 934 1.301 0.829 -34.303 1.00 63.39 N ANISOU 1939 N ILE C 934 8698 7326 8062 -178 -136 866 N ATOM 1940 CA ILE C 934 1.684 -0.348 -33.460 1.00 59.94 C ANISOU 1940 CA ILE C 934 7837 7186 7753 55 -17 798 C ATOM 1941 C ILE C 934 2.936 0.010 -32.644 1.00 64.66 C ANISOU 1941 C ILE C 934 8326 8106 8135 -303 -12 855 C ATOM 1942 O ILE C 934 2.938 -0.244 -31.421 1.00 64.72 O ANISOU 1942 O ILE C 934 8260 8093 8237 -193 8 810 O ATOM 1943 CB ILE C 934 1.866 -1.608 -34.329 1.00 54.56 C ANISOU 1943 CB ILE C 934 6754 6831 7145 302 94 759 C ATOM 1944 CG1 ILE C 934 0.523 -2.092 -34.877 1.00 46.57 C ANISOU 1944 CG1 ILE C 934 5824 5485 6387 710 103 675 C ATOM 1945 CG2 ILE C 934 2.581 -2.709 -33.567 1.00 50.50 C ANISOU 1945 CG2 ILE C 934 5815 6694 6679 454 194 712 C ATOM 1946 CD1 ILE C 934 0.651 -2.922 -36.130 1.00 57.91 C ANISOU 1946 CD1 ILE C 934 6992 7178 7835 848 176 663 C ATOM 1947 N GLN C 935 3.939 0.625 -33.275 1.00 63.55 N ANISOU 1947 N GLN C 935 8193 8248 7706 -733 -33 947 N ATOM 1948 CA GLN C 935 5.172 1.088 -32.587 1.00 66.84 C ANISOU 1948 CA GLN C 935 8522 8995 7880 -1130 -32 996 C ATOM 1949 C GLN C 935 4.781 1.954 -31.391 1.00 66.29 C ANISOU 1949 C GLN C 935 8787 8558 7844 -1218 -115 999 C ATOM 1950 O GLN C 935 5.292 1.691 -30.296 1.00 73.16 O ANISOU 1950 O GLN C 935 9475 9609 8715 -1220 -79 970 O ATOM 1951 CB GLN C 935 6.076 1.875 -33.533 1.00 74.20 C ANISOU 1951 CB GLN C 935 9532 10180 8479 -1630 -60 1092 C ATOM 1952 CG GLN C 935 6.758 1.012 -34.584 1.00 75.11 C ANISOU 1952 CG GLN C 935 9239 10789 8510 -1609 33 1076 C ATOM 1953 CD GLN C 935 7.665 1.828 -35.469 1.00 78.34 C ANISOU 1953 CD GLN C 935 9730 11469 8567 -2146 10 1164 C ATOM 1954 OE1 GLN C 935 8.687 1.342 -35.949 1.00 81.44 O ANISOU 1954 OE1 GLN C 935 9745 12412 8788 -2294 87 1144 O ATOM 1955 NE2 GLN C 935 7.303 3.087 -35.675 1.00 69.91 N ANISOU 1955 NE2 GLN C 935 9167 10019 7378 -2450 -101 1255 N ATOM 1956 N ASP C 936 3.901 2.935 -31.604 1.00 71.63 N ANISOU 1956 N ASP C 936 9935 8740 8543 -1272 -229 1025 N ATOM 1957 CA ASP C 936 3.384 3.842 -30.545 1.00 71.68 C ANISOU 1957 CA ASP C 936 10307 8339 8591 -1332 -328 1011 C ATOM 1958 C ASP C 936 2.720 2.983 -29.456 1.00 74.59 C ANISOU 1958 C ASP C 936 10496 8600 9243 -899 -270 897 C ATOM 1959 O ASP C 936 2.983 3.241 -28.262 1.00 75.45 O ANISOU 1959 O ASP C 936 10622 8706 9338 -988 -280 882 O ATOM 1960 CB ASP C 936 2.465 4.915 -31.150 1.00 72.54 C ANISOU 1960 CB ASP C 936 10939 7934 8690 -1390 -473 1037 C ATOM 1961 CG ASP C 936 1.947 5.956 -30.167 1.00 85.35 C ANISOU 1961 CG ASP C 936 12971 9127 10331 -1468 -597 1015 C ATOM 1962 OD1 ASP C 936 2.730 6.384 -29.293 1.00 91.10 O ANISOU 1962 OD1 ASP C 936 13690 10003 10919 -1758 -598 1047 O ATOM 1963 OD2 ASP C 936 0.756 6.336 -30.284 1.00 83.77 O ANISOU 1963 OD2 ASP C 936 13091 8454 10282 -1232 -697 953 O ATOM 1964 N SER C 937 1.921 1.978 -29.844 1.00 64.12 N ANISOU 1964 N SER C 937 9000 7208 8154 -464 -206 818 N ATOM 1965 CA SER C 937 1.157 1.107 -28.912 1.00 55.04 C ANISOU 1965 CA SER C 937 7709 5928 7277 -46 -146 703 C ATOM 1966 C SER C 937 2.144 0.284 -28.082 1.00 62.40 C ANISOU 1966 C SER C 937 8249 7288 8173 -48 -51 704 C ATOM 1967 O SER C 937 1.950 0.198 -26.854 1.00 67.76 O ANISOU 1967 O SER C 937 8934 7869 8941 43 -46 655 O ATOM 1968 CB SER C 937 0.166 0.220 -29.622 1.00 56.01 C ANISOU 1968 CB SER C 937 7736 5918 7627 372 -94 622 C ATOM 1969 OG SER C 937 0.762 -1.016 -29.988 1.00 63.93 O ANISOU 1969 OG SER C 937 8307 7329 8654 523 25 619 O ATOM 1970 N LEU C 938 3.181 -0.278 -28.712 1.00 54.83 N ANISOU 1970 N LEU C 938 6962 6796 7075 -151 15 749 N ATOM 1971 CA LEU C 938 4.202 -1.082 -27.985 1.00 59.67 C ANISOU 1971 CA LEU C 938 7185 7853 7632 -137 90 738 C ATOM 1972 C LEU C 938 4.901 -0.196 -26.947 1.00 62.66 C ANISOU 1972 C LEU C 938 7680 8292 7836 -487 38 779 C ATOM 1973 O LEU C 938 5.096 -0.645 -25.810 1.00 67.63 O ANISOU 1973 O LEU C 938 8164 9008 8524 -371 67 740 O ATOM 1974 CB LEU C 938 5.211 -1.692 -28.962 1.00 57.90 C ANISOU 1974 CB LEU C 938 6607 8133 7258 -213 149 763 C ATOM 1975 CG LEU C 938 4.668 -2.781 -29.888 1.00 62.68 C ANISOU 1975 CG LEU C 938 7018 8757 8039 163 215 710 C ATOM 1976 CD1 LEU C 938 5.762 -3.303 -30.800 1.00 62.54 C ANISOU 1976 CD1 LEU C 938 6643 9272 7849 57 265 723 C ATOM 1977 CD2 LEU C 938 4.031 -3.933 -29.120 1.00 60.73 C ANISOU 1977 CD2 LEU C 938 6620 8401 8055 618 273 622 C ATOM 1978 N SER C 939 5.237 1.039 -27.304 1.00 57.11 N ANISOU 1978 N SER C 939 7252 7526 6921 -905 -39 855 N ATOM 1979 CA SER C 939 5.890 1.999 -26.381 1.00 60.00 C ANISOU 1979 CA SER C 939 7767 7927 7103 -1281 -93 894 C ATOM 1980 C SER C 939 4.967 2.287 -25.186 1.00 58.68 C ANISOU 1980 C SER C 939 7842 7332 7122 -1106 -139 837 C ATOM 1981 O SER C 939 5.459 2.221 -24.045 1.00 67.13 O ANISOU 1981 O SER C 939 8798 8548 8160 -1161 -123 820 O ATOM 1982 CB SER C 939 6.320 3.245 -27.115 1.00 59.40 C ANISOU 1982 CB SER C 939 7983 7820 6765 -1760 -170 985 C ATOM 1983 OG SER C 939 7.411 2.958 -27.986 1.00 54.25 O ANISOU 1983 OG SER C 939 7042 7675 5897 -1984 -112 1025 O ATOM 1984 N SER C 940 3.675 2.546 -25.422 1.00 58.56 N ANISOU 1984 N SER C 940 8126 6833 7293 -886 -193 795 N ATOM 1985 CA SER C 940 2.670 2.826 -24.356 1.00 56.99 C ANISOU 1985 CA SER C 940 8158 6217 7277 -698 -239 713 C ATOM 1986 C SER C 940 2.526 1.610 -23.433 1.00 60.24 C ANISOU 1986 C SER C 940 8253 6763 7873 -352 -140 636 C ATOM 1987 O SER C 940 2.394 1.815 -22.207 1.00 55.76 O ANISOU 1987 O SER C 940 7752 6089 7346 -352 -156 595 O ATOM 1988 CB SER C 940 1.332 3.219 -24.915 1.00 50.19 C ANISOU 1988 CB SER C 940 7625 4872 6573 -495 -313 657 C ATOM 1989 OG SER C 940 1.389 4.500 -25.516 1.00 62.13 O ANISOU 1989 OG SER C 940 9519 6178 7911 -821 -436 726 O ATOM 1990 N THR C 941 2.533 0.395 -23.995 1.00 50.63 N ANISOU 1990 N THR C 941 6722 5758 6758 -71 -47 615 N ATOM 1991 CA THR C 941 2.491 -0.875 -23.220 1.00 48.07 C ANISOU 1991 CA THR C 941 6094 5585 6585 255 44 553 C ATOM 1992 C THR C 941 3.712 -0.942 -22.291 1.00 54.49 C ANISOU 1992 C THR C 941 6699 6773 7232 55 59 593 C ATOM 1993 O THR C 941 3.536 -1.107 -21.065 1.00 55.24 O ANISOU 1993 O THR C 941 6797 6793 7399 145 65 551 O ATOM 1994 CB THR C 941 2.402 -2.084 -24.153 1.00 47.93 C ANISOU 1994 CB THR C 941 5799 5742 6671 550 127 533 C ATOM 1995 OG1 THR C 941 1.263 -1.845 -24.978 1.00 47.23 O ANISOU 1995 OG1 THR C 941 5936 5292 6716 696 102 493 O ATOM 1996 CG2 THR C 941 2.267 -3.403 -23.419 1.00 43.97 C ANISOU 1996 CG2 THR C 941 5039 5342 6327 898 209 470 C ATOM 1997 N ALA C 942 4.912 -0.788 -22.845 1.00 56.25 N ANISOU 1997 N ALA C 942 6746 7399 7226 -221 61 662 N ATOM 1998 CA ALA C 942 6.179 -0.780 -22.082 1.00 52.64 C ANISOU 1998 CA ALA C 942 6070 7355 6574 -444 69 688 C ATOM 1999 C ALA C 942 6.091 0.248 -20.945 1.00 56.24 C ANISOU 1999 C ALA C 942 6797 7593 6978 -675 5 693 C ATOM 2000 O ALA C 942 6.413 -0.127 -19.816 1.00 61.25 O ANISOU 2000 O ALA C 942 7294 8357 7623 -609 23 667 O ATOM 2001 CB ALA C 942 7.347 -0.509 -22.999 1.00 53.05 C ANISOU 2001 CB ALA C 942 5958 7833 6367 -767 72 745 C ATOM 2002 N SER C 943 5.678 1.492 -21.221 1.00 52.56 N ANISOU 2002 N SER C 943 6711 6805 6453 -931 -75 724 N ATOM 2003 CA SER C 943 5.462 2.560 -20.201 1.00 54.15 C ANISOU 2003 CA SER C 943 7221 6737 6618 -1141 -151 717 C ATOM 2004 C SER C 943 4.623 2.016 -19.042 1.00 56.34 C ANISOU 2004 C SER C 943 7498 6787 7123 -806 -129 629 C ATOM 2005 O SER C 943 5.085 2.111 -17.898 1.00 58.45 O ANISOU 2005 O SER C 943 7705 7171 7331 -902 -130 620 O ATOM 2006 CB SER C 943 4.784 3.776 -20.777 1.00 46.81 C ANISOU 2006 CB SER C 943 6737 5386 5664 -1323 -253 738 C ATOM 2007 OG SER C 943 5.724 4.664 -21.345 1.00 70.86 O ANISOU 2007 OG SER C 943 9878 8616 8430 -1784 -296 828 O ATOM 2008 N ALA C 944 3.430 1.493 -19.356 1.00 52.22 N ANISOU 2008 N ALA C 944 7044 5959 6837 -446 -110 562 N ATOM 2009 CA ALA C 944 2.387 1.063 -18.396 1.00 48.67 C ANISOU 2009 CA ALA C 944 6653 5228 6612 -135 -90 460 C ATOM 2010 C ALA C 944 2.917 -0.080 -17.527 1.00 45.88 C ANISOU 2010 C ALA C 944 5963 5183 6285 37 -8 451 C ATOM 2011 O ALA C 944 2.696 -0.039 -16.301 1.00 52.11 O ANISOU 2011 O ALA C 944 6801 5879 7120 67 -11 405 O ATOM 2012 CB ALA C 944 1.138 0.653 -19.135 1.00 48.24 C ANISOU 2012 CB ALA C 944 6690 4869 6770 190 -74 387 C ATOM 2013 N LEU C 945 3.611 -1.048 -18.128 1.00 49.19 N ANISOU 2013 N LEU C 945 6061 5961 6667 143 55 488 N ATOM 2014 CA LEU C 945 4.240 -2.177 -17.381 1.00 51.74 C ANISOU 2014 CA LEU C 945 6063 6605 6990 318 114 483 C ATOM 2015 C LEU C 945 5.376 -1.651 -16.488 1.00 55.16 C ANISOU 2015 C LEU C 945 6423 7325 7212 14 79 524 C ATOM 2016 O LEU C 945 5.520 -2.160 -15.358 1.00 56.26 O ANISOU 2016 O LEU C 945 6460 7540 7375 128 95 500 O ATOM 2017 CB LEU C 945 4.746 -3.239 -18.361 1.00 48.43 C ANISOU 2017 CB LEU C 945 5334 6502 6565 498 168 501 C ATOM 2018 CG LEU C 945 3.669 -3.925 -19.202 1.00 49.16 C ANISOU 2018 CG LEU C 945 5457 6349 6872 824 214 453 C ATOM 2019 CD1 LEU C 945 4.321 -4.748 -20.301 1.00 41.58 C ANISOU 2019 CD1 LEU C 945 4204 5730 5864 926 254 477 C ATOM 2020 CD2 LEU C 945 2.765 -4.791 -18.335 1.00 42.05 C ANISOU 2020 CD2 LEU C 945 4572 5228 6178 1158 261 378 C ATOM 2021 N GLY C 946 6.147 -0.663 -16.958 1.00 57.82 N ANISOU 2021 N GLY C 946 6819 7814 7336 -369 33 582 N ATOM 2022 CA GLY C 946 7.210 0.003 -16.177 1.00 46.28 C ANISOU 2022 CA GLY C 946 5316 6618 5652 -713 -1 614 C ATOM 2023 C GLY C 946 6.662 0.656 -14.924 1.00 45.71 C ANISOU 2023 C GLY C 946 5492 6240 5635 -773 -42 580 C ATOM 2024 O GLY C 946 7.180 0.361 -13.842 1.00 62.40 O ANISOU 2024 O GLY C 946 7460 8549 7699 -768 -33 567 O ATOM 2025 N LYS C 947 5.625 1.488 -15.060 1.00 61.31 N ANISOU 2025 N LYS C 947 7827 7755 7712 -806 -91 554 N ATOM 2026 CA LYS C 947 4.958 2.185 -13.922 1.00 50.91 C ANISOU 2026 CA LYS C 947 6774 6106 6462 -847 -139 497 C ATOM 2027 C LYS C 947 4.307 1.156 -12.983 1.00 47.43 C ANISOU 2027 C LYS C 947 6218 5590 6215 -482 -81 424 C ATOM 2028 O LYS C 947 4.467 1.317 -11.767 1.00 58.54 O ANISOU 2028 O LYS C 947 7633 7017 7591 -547 -92 401 O ATOM 2029 CB LYS C 947 3.992 3.240 -14.461 1.00 46.46 C ANISOU 2029 CB LYS C 947 6609 5083 5959 -924 -218 470 C ATOM 2030 CG LYS C 947 4.685 4.331 -15.262 1.00 54.08 C ANISOU 2030 CG LYS C 947 7739 6106 6703 -1332 -286 552 C ATOM 2031 CD LYS C 947 3.756 5.357 -15.864 1.00 64.36 C ANISOU 2031 CD LYS C 947 9462 6940 8050 -1391 -386 531 C ATOM 2032 CE LYS C 947 4.414 6.138 -16.983 1.00 71.05 C ANISOU 2032 CE LYS C 947 10443 7869 8683 -1744 -437 630 C ATOM 2033 NZ LYS C 947 3.544 7.239 -17.461 1.00 67.94 N ANISOU 2033 NZ LYS C 947 10512 6990 8311 -1816 -561 612 N ATOM 2034 N LEU C 948 3.640 0.121 -13.507 1.00 45.12 N ANISOU 2034 N LEU C 948 5818 5226 6099 -130 -21 392 N ATOM 2035 CA LEU C 948 3.102 -0.989 -12.675 1.00 56.16 C ANISOU 2035 CA LEU C 948 7095 6586 7657 202 43 331 C ATOM 2036 C LEU C 948 4.247 -1.643 -11.878 1.00 63.17 C ANISOU 2036 C LEU C 948 7701 7885 8414 181 64 378 C ATOM 2037 O LEU C 948 4.142 -1.715 -10.625 1.00 65.31 O ANISOU 2037 O LEU C 948 7998 8118 8699 201 64 345 O ATOM 2038 CB LEU C 948 2.333 -1.975 -13.563 1.00 40.74 C ANISOU 2038 CB LEU C 948 5070 4527 5884 543 104 297 C ATOM 2039 CG LEU C 948 0.892 -1.539 -13.823 1.00 48.33 C ANISOU 2039 CG LEU C 948 6311 5031 7023 663 90 200 C ATOM 2040 CD1 LEU C 948 0.214 -2.380 -14.887 1.00 34.85 C ANISOU 2040 CD1 LEU C 948 4531 3242 5467 953 147 169 C ATOM 2041 CD2 LEU C 948 0.087 -1.577 -12.537 1.00 51.30 C ANISOU 2041 CD2 LEU C 948 6802 5184 7506 763 101 101 C ATOM 2042 N GLN C 949 5.335 -2.037 -12.545 1.00 53.86 N ANISOU 2042 N GLN C 949 6265 7101 7097 128 74 442 N ATOM 2043 CA GLN C 949 6.470 -2.727 -11.877 1.00 56.57 C ANISOU 2043 CA GLN C 949 6314 7873 7307 146 81 469 C ATOM 2044 C GLN C 949 6.954 -1.872 -10.705 1.00 56.28 C ANISOU 2044 C GLN C 949 6360 7891 7133 -135 35 473 C ATOM 2045 O GLN C 949 7.119 -2.441 -9.608 1.00 63.61 O ANISOU 2045 O GLN C 949 7194 8910 8064 -12 42 458 O ATOM 2046 CB GLN C 949 7.623 -3.012 -12.842 1.00 62.10 C ANISOU 2046 CB GLN C 949 6735 9015 7844 67 83 514 C ATOM 2047 CG GLN C 949 8.803 -3.687 -12.155 1.00 61.07 C ANISOU 2047 CG GLN C 949 6296 9344 7565 104 73 519 C ATOM 2048 CD GLN C 949 9.854 -4.186 -13.109 1.00 60.64 C ANISOU 2048 CD GLN C 949 5924 9747 7370 106 77 530 C ATOM 2049 OE1 GLN C 949 9.973 -3.719 -14.235 1.00 66.01 O ANISOU 2049 OE1 GLN C 949 6616 10471 7993 -60 84 549 O ATOM 2050 NE2 GLN C 949 10.638 -5.138 -12.643 1.00 52.16 N ANISOU 2050 NE2 GLN C 949 4565 9027 6228 295 66 510 N ATOM 2051 N ASP C 950 7.165 -0.568 -10.930 1.00 59.25 N ANISOU 2051 N ASP C 950 6920 8204 7387 -499 -13 494 N ATOM 2052 CA ASP C 950 7.710 0.376 -9.911 1.00 62.65 C ANISOU 2052 CA ASP C 950 7440 8702 7664 -819 -60 497 C ATOM 2053 C ASP C 950 6.741 0.452 -8.723 1.00 60.62 C ANISOU 2053 C ASP C 950 7377 8100 7556 -693 -64 434 C ATOM 2054 O ASP C 950 7.204 0.347 -7.569 1.00 61.50 O ANISOU 2054 O ASP C 950 7403 8369 7595 -734 -70 426 O ATOM 2055 CB ASP C 950 7.985 1.770 -10.488 1.00 61.89 C ANISOU 2055 CB ASP C 950 7559 8538 7417 -1233 -114 530 C ATOM 2056 CG ASP C 950 9.118 1.826 -11.503 1.00 77.76 C ANISOU 2056 CG ASP C 950 9367 10957 9221 -1451 -108 587 C ATOM 2057 OD1 ASP C 950 9.878 0.832 -11.634 1.00 82.69 O ANISOU 2057 OD1 ASP C 950 9642 11987 9790 -1301 -69 591 O ATOM 2058 OD2 ASP C 950 9.229 2.864 -12.166 1.00 85.83 O ANISOU 2058 OD2 ASP C 950 10591 11891 10129 -1771 -147 621 O ATOM 2059 N VAL C 951 5.442 0.600 -8.987 1.00 53.39 N ANISOU 2059 N VAL C 951 6701 6749 6836 -537 -62 379 N ATOM 2060 CA VAL C 951 4.444 0.847 -7.912 1.00 51.17 C ANISOU 2060 CA VAL C 951 6628 6130 6686 -457 -70 293 C ATOM 2061 C VAL C 951 4.190 -0.457 -7.162 1.00 58.96 C ANISOU 2061 C VAL C 951 7441 7185 7778 -137 -6 266 C ATOM 2062 O VAL C 951 4.083 -0.396 -5.915 1.00 59.90 O ANISOU 2062 O VAL C 951 7599 7270 7890 -158 -10 229 O ATOM 2063 CB VAL C 951 3.143 1.466 -8.443 1.00 56.91 C ANISOU 2063 CB VAL C 951 7658 6395 7571 -394 -98 217 C ATOM 2064 CG1 VAL C 951 2.080 1.509 -7.360 1.00 59.50 C ANISOU 2064 CG1 VAL C 951 8142 6426 8041 -260 -95 101 C ATOM 2065 CG2 VAL C 951 3.391 2.860 -8.996 1.00 62.76 C ANISOU 2065 CG2 VAL C 951 8634 7026 8187 -733 -186 245 C ATOM 2066 N VAL C 952 4.100 -1.589 -7.867 1.00 55.82 N ANISOU 2066 N VAL C 952 6870 6874 7466 141 49 285 N ATOM 2067 CA VAL C 952 3.917 -2.919 -7.205 1.00 45.72 C ANISOU 2067 CA VAL C 952 5443 5660 6270 446 103 270 C ATOM 2068 C VAL C 952 5.080 -3.122 -6.234 1.00 62.67 C ANISOU 2068 C VAL C 952 7407 8164 8239 348 78 320 C ATOM 2069 O VAL C 952 4.802 -3.497 -5.081 1.00 67.76 O ANISOU 2069 O VAL C 952 8082 8751 8914 436 89 290 O ATOM 2070 CB VAL C 952 3.801 -4.085 -8.203 1.00 41.66 C ANISOU 2070 CB VAL C 952 4766 5214 5849 740 155 288 C ATOM 2071 CG1 VAL C 952 3.957 -5.427 -7.522 1.00 37.06 C ANISOU 2071 CG1 VAL C 952 4022 4768 5291 1008 188 296 C ATOM 2072 CG2 VAL C 952 2.483 -4.054 -8.953 1.00 38.36 C ANISOU 2072 CG2 VAL C 952 4526 4422 5628 889 190 218 C ATOM 2073 N ASN C 953 6.314 -2.825 -6.673 1.00 62.49 N ANISOU 2073 N ASN C 953 7210 8503 8029 154 43 382 N ATOM 2074 CA ASN C 953 7.564 -3.077 -5.902 1.00 60.19 C ANISOU 2074 CA ASN C 953 6694 8628 7546 74 13 418 C ATOM 2075 C ASN C 953 7.641 -2.117 -4.702 1.00 60.85 C ANISOU 2075 C ASN C 953 6923 8651 7546 -187 -23 397 C ATOM 2076 O ASN C 953 8.008 -2.599 -3.612 1.00 66.61 O ANISOU 2076 O ASN C 953 7558 9533 8219 -117 -33 397 O ATOM 2077 CB ASN C 953 8.799 -3.069 -6.810 1.00 56.89 C ANISOU 2077 CB ASN C 953 6029 8638 6950 -51 -7 463 C ATOM 2078 CG ASN C 953 8.967 -4.353 -7.613 1.00 57.85 C ANISOU 2078 CG ASN C 953 5924 8930 7128 276 20 473 C ATOM 2079 OD1 ASN C 953 8.486 -5.420 -7.237 1.00 50.21 O ANISOU 2079 OD1 ASN C 953 4934 7860 6285 601 42 459 O ATOM 2080 ND2 ASN C 953 9.661 -4.281 -8.732 1.00 53.49 N ANISOU 2080 ND2 ASN C 953 5206 8643 6476 187 17 492 N ATOM 2081 N GLN C 954 7.277 -0.837 -4.865 1.00 58.50 N ANISOU 2081 N GLN C 954 6863 8124 7241 -463 -49 377 N ATOM 2082 CA GLN C 954 7.215 0.145 -3.745 1.00 59.36 C ANISOU 2082 CA GLN C 954 7145 8121 7288 -708 -87 342 C ATOM 2083 C GLN C 954 6.217 -0.323 -2.696 1.00 67.06 C ANISOU 2083 C GLN C 954 8231 8832 8418 -492 -60 278 C ATOM 2084 O GLN C 954 6.526 -0.193 -1.511 1.00 69.45 O ANISOU 2084 O GLN C 954 8519 9228 8640 -579 -77 265 O ATOM 2085 CB GLN C 954 6.757 1.526 -4.192 1.00 61.22 C ANISOU 2085 CB GLN C 954 7670 8065 7526 -980 -130 318 C ATOM 2086 CG GLN C 954 7.808 2.263 -5.001 1.00 69.32 C ANISOU 2086 CG GLN C 954 8643 9346 8350 -1307 -163 381 C ATOM 2087 CD GLN C 954 7.325 3.603 -5.497 1.00 78.48 C ANISOU 2087 CD GLN C 954 10134 10179 9504 -1568 -219 365 C ATOM 2088 OE1 GLN C 954 6.396 4.197 -4.950 1.00 83.43 O ANISOU 2088 OE1 GLN C 954 11026 10434 10241 -1563 -252 295 O ATOM 2089 NE2 GLN C 954 7.965 4.093 -6.549 1.00 81.05 N ANISOU 2089 NE2 GLN C 954 10455 10647 9692 -1801 -238 425 N ATOM 2090 N ASN C 955 5.061 -0.819 -3.132 1.00 63.17 N ANISOU 2090 N ASN C 955 7844 8032 8127 -238 -18 231 N ATOM 2091 CA ASN C 955 3.991 -1.295 -2.222 1.00 53.39 C ANISOU 2091 CA ASN C 955 6717 6534 7036 -41 19 151 C ATOM 2092 C ASN C 955 4.524 -2.518 -1.465 1.00 63.67 C ANISOU 2092 C ASN C 955 7813 8091 8287 146 45 196 C ATOM 2093 O ASN C 955 4.341 -2.578 -0.224 1.00 65.85 O ANISOU 2093 O ASN C 955 8142 8333 8546 134 46 163 O ATOM 2094 CB ASN C 955 2.674 -1.497 -2.981 1.00 52.25 C ANISOU 2094 CB ASN C 955 6718 6033 7100 163 60 78 C ATOM 2095 CG ASN C 955 2.025 -0.178 -3.360 1.00 61.47 C ANISOU 2095 CG ASN C 955 8144 6902 8310 -16 10 7 C ATOM 2096 OD1 ASN C 955 2.669 0.879 -3.304 1.00 66.86 O ANISOU 2096 OD1 ASN C 955 8895 7651 8857 -310 -55 36 O ATOM 2097 ND2 ASN C 955 0.751 -0.223 -3.733 1.00 45.28 N ANISOU 2097 ND2 ASN C 955 6246 4520 6438 158 33 -95 N ATOM 2098 N ALA C 956 5.215 -3.425 -2.164 1.00 58.85 N ANISOU 2098 N ALA C 956 6983 7739 7637 306 54 266 N ATOM 2099 CA ALA C 956 5.737 -4.683 -1.585 1.00 57.93 C ANISOU 2099 CA ALA C 956 6683 7855 7471 531 58 309 C ATOM 2100 C ALA C 956 6.713 -4.340 -0.458 1.00 64.03 C ANISOU 2100 C ALA C 956 7372 8903 8053 349 4 334 C ATOM 2101 O ALA C 956 6.663 -4.996 0.583 1.00 75.09 O ANISOU 2101 O ALA C 956 8768 10323 9438 473 3 335 O ATOM 2102 CB ALA C 956 6.385 -5.526 -2.646 1.00 50.60 C ANISOU 2102 CB ALA C 956 5535 7171 6520 711 58 362 C ATOM 2103 N GLN C 957 7.553 -3.325 -0.654 1.00 65.53 N ANISOU 2103 N GLN C 957 7511 9294 8095 49 -38 351 N ATOM 2104 CA GLN C 957 8.577 -2.901 0.341 1.00 73.49 C ANISOU 2104 CA GLN C 957 8418 10604 8901 -159 -90 366 C ATOM 2105 C GLN C 957 7.895 -2.188 1.517 1.00 64.76 C ANISOU 2105 C GLN C 957 7534 9242 7830 -304 -90 311 C ATOM 2106 O GLN C 957 8.296 -2.425 2.678 1.00 65.68 O ANISOU 2106 O GLN C 957 7594 9510 7851 -307 -112 314 O ATOM 2107 CB GLN C 957 9.632 -2.026 -0.336 1.00 79.53 C ANISOU 2107 CB GLN C 957 9067 11660 9492 -460 -124 390 C ATOM 2108 CG GLN C 957 10.488 -2.803 -1.329 1.00 85.42 C ANISOU 2108 CG GLN C 957 9537 12755 10164 -320 -129 429 C ATOM 2109 CD GLN C 957 11.665 -2.012 -1.847 1.00 89.77 C ANISOU 2109 CD GLN C 957 9935 13674 10498 -643 -160 441 C ATOM 2110 OE1 GLN C 957 12.179 -1.112 -1.180 1.00101.29 O ANISOU 2110 OE1 GLN C 957 11424 15249 11812 -949 -188 429 O ATOM 2111 NE2 GLN C 957 12.111 -2.362 -3.045 1.00 78.37 N ANISOU 2111 NE2 GLN C 957 8322 12433 9023 -588 -151 458 N ATOM 2112 N ALA C 958 6.899 -1.342 1.236 1.00 57.74 N ANISOU 2112 N ALA C 958 6888 7983 7066 -411 -73 252 N ATOM 2113 CA ALA C 958 6.105 -0.654 2.274 1.00 53.88 C ANISOU 2113 CA ALA C 958 6620 7222 6630 -524 -75 171 C ATOM 2114 C ALA C 958 5.487 -1.701 3.194 1.00 57.13 C ANISOU 2114 C ALA C 958 7036 7547 7122 -271 -34 146 C ATOM 2115 O ALA C 958 5.556 -1.499 4.403 1.00 57.75 O ANISOU 2115 O ALA C 958 7151 7658 7134 -365 -48 120 O ATOM 2116 CB ALA C 958 5.051 0.217 1.663 1.00 51.34 C ANISOU 2116 CB ALA C 958 6545 6512 6448 -593 -73 95 C ATOM 2117 N LEU C 959 4.926 -2.783 2.638 1.00 61.32 N ANISOU 2117 N LEU C 959 7539 7978 7782 25 15 155 N ATOM 2118 CA LEU C 959 4.304 -3.880 3.431 1.00 58.54 C ANISOU 2118 CA LEU C 959 7215 7529 7498 261 59 138 C ATOM 2119 C LEU C 959 5.375 -4.601 4.265 1.00 58.80 C ANISOU 2119 C LEU C 959 7078 7902 7363 315 17 218 C ATOM 2120 O LEU C 959 5.144 -4.816 5.463 1.00 62.62 O ANISOU 2120 O LEU C 959 7630 8350 7812 315 20 198 O ATOM 2121 CB LEU C 959 3.584 -4.849 2.491 1.00 56.30 C ANISOU 2121 CB LEU C 959 6935 7086 7372 543 116 135 C ATOM 2122 CG LEU C 959 2.872 -6.027 3.161 1.00 55.07 C ANISOU 2122 CG LEU C 959 6836 6803 7284 774 169 116 C ATOM 2123 CD1 LEU C 959 2.073 -5.578 4.375 1.00 51.90 C ANISOU 2123 CD1 LEU C 959 6609 6211 6901 653 192 22 C ATOM 2124 CD2 LEU C 959 1.946 -6.734 2.180 1.00 49.21 C ANISOU 2124 CD2 LEU C 959 6139 5841 6716 1001 236 82 C ATOM 2125 N ASN C 960 6.519 -4.941 3.673 1.00 59.06 N ANISOU 2125 N ASN C 960 6892 8267 7281 357 -26 296 N ATOM 2126 CA ASN C 960 7.639 -5.623 4.379 1.00 53.55 C ANISOU 2126 CA ASN C 960 6008 7931 6406 435 -86 359 C ATOM 2127 C ASN C 960 8.182 -4.721 5.507 1.00 56.22 C ANISOU 2127 C ASN C 960 6354 8414 6593 159 -128 343 C ATOM 2128 O ASN C 960 8.426 -5.235 6.594 1.00 61.88 O ANISOU 2128 O ASN C 960 7054 9233 7224 228 -156 360 O ATOM 2129 CB ASN C 960 8.712 -6.088 3.391 1.00 56.46 C ANISOU 2129 CB ASN C 960 6125 8642 6686 538 -126 414 C ATOM 2130 CG ASN C 960 8.208 -7.135 2.414 1.00 61.32 C ANISOU 2130 CG ASN C 960 6726 9129 7444 844 -90 429 C ATOM 2131 OD1 ASN C 960 7.407 -8.005 2.771 1.00 59.18 O ANISOU 2131 OD1 ASN C 960 6576 8630 7278 1062 -57 425 O ATOM 2132 ND2 ASN C 960 8.669 -7.061 1.172 1.00 63.14 N ANISOU 2132 ND2 ASN C 960 6813 9510 7669 848 -93 442 N ATOM 2133 N THR C 961 8.330 -3.415 5.288 1.00 53.56 N ANISOU 2133 N THR C 961 6062 8067 6221 -150 -135 309 N ATOM 2134 CA THR C 961 8.794 -2.439 6.313 1.00 60.09 C ANISOU 2134 CA THR C 961 6915 9006 6909 -443 -172 282 C ATOM 2135 C THR C 961 7.761 -2.292 7.441 1.00 60.69 C ANISOU 2135 C THR C 961 7205 8783 7071 -456 -142 217 C ATOM 2136 O THR C 961 8.170 -2.084 8.610 1.00 56.34 O ANISOU 2136 O THR C 961 6637 8372 6396 -572 -173 210 O ATOM 2137 CB THR C 961 9.057 -1.076 5.664 1.00 57.46 C ANISOU 2137 CB THR C 961 6630 8669 6534 -770 -185 259 C ATOM 2138 OG1 THR C 961 10.112 -1.270 4.720 1.00 71.87 O ANISOU 2138 OG1 THR C 961 8230 10833 8245 -780 -208 314 O ATOM 2139 CG2 THR C 961 9.413 0.008 6.660 1.00 53.79 C ANISOU 2139 CG2 THR C 961 6227 8267 5942 -1089 -219 220 C ATOM 2140 N LEU C 962 6.471 -2.336 7.094 1.00 54.48 N ANISOU 2140 N LEU C 962 6604 7615 6480 -356 -85 157 N ATOM 2141 CA LEU C 962 5.346 -2.355 8.064 1.00 48.46 C ANISOU 2141 CA LEU C 962 6032 6569 5811 -333 -45 71 C ATOM 2142 C LEU C 962 5.431 -3.647 8.887 1.00 51.37 C ANISOU 2142 C LEU C 962 6346 7039 6132 -114 -36 121 C ATOM 2143 O LEU C 962 5.450 -3.560 10.126 1.00 60.75 O ANISOU 2143 O LEU C 962 7579 8267 7238 -201 -48 101 O ATOM 2144 CB LEU C 962 4.017 -2.250 7.310 1.00 44.91 C ANISOU 2144 CB LEU C 962 5751 5740 5571 -240 13 -15 C ATOM 2145 CG LEU C 962 2.773 -2.358 8.184 1.00 49.64 C ANISOU 2145 CG LEU C 962 6525 6064 6271 -198 65 -129 C ATOM 2146 CD1 LEU C 962 2.697 -1.210 9.174 1.00 49.65 C ANISOU 2146 CD1 LEU C 962 6628 6025 6211 -462 33 -216 C ATOM 2147 CD2 LEU C 962 1.510 -2.419 7.346 1.00 47.73 C ANISOU 2147 CD2 LEU C 962 6411 5496 6229 -66 122 -224 C ATOM 2148 N VAL C 963 5.534 -4.804 8.234 1.00 52.85 N ANISOU 2148 N VAL C 963 6448 7276 6357 155 -25 188 N ATOM 2149 CA VAL C 963 5.617 -6.117 8.942 1.00 56.15 C ANISOU 2149 CA VAL C 963 6849 7762 6722 385 -31 245 C ATOM 2150 C VAL C 963 6.766 -6.081 9.957 1.00 54.92 C ANISOU 2150 C VAL C 963 6573 7941 6352 301 -112 299 C ATOM 2151 O VAL C 963 6.585 -6.557 11.079 1.00 60.93 O ANISOU 2151 O VAL C 963 7415 8683 7053 340 -118 305 O ATOM 2152 CB VAL C 963 5.778 -7.302 7.972 1.00 59.29 C ANISOU 2152 CB VAL C 963 7155 8202 7169 684 -31 313 C ATOM 2153 CG1 VAL C 963 6.270 -8.542 8.697 1.00 58.82 C ANISOU 2153 CG1 VAL C 963 7059 8294 6996 901 -81 390 C ATOM 2154 CG2 VAL C 963 4.485 -7.608 7.228 1.00 57.86 C ANISOU 2154 CG2 VAL C 963 7117 7671 7197 806 58 255 C ATOM 2155 N LYS C 964 7.925 -5.564 9.577 1.00 66.45 N ANISOU 2155 N LYS C 964 7845 9715 7688 187 -172 332 N ATOM 2156 CA LYS C 964 9.113 -5.592 10.467 1.00 74.86 C ANISOU 2156 CA LYS C 964 8759 11149 8534 128 -255 373 C ATOM 2157 C LYS C 964 8.840 -4.702 11.679 1.00 79.08 C ANISOU 2157 C LYS C 964 9415 11613 9020 -130 -248 316 C ATOM 2158 O LYS C 964 9.102 -5.138 12.820 1.00 74.55 O ANISOU 2158 O LYS C 964 8845 11150 8330 -91 -285 338 O ATOM 2159 CB LYS C 964 10.381 -5.178 9.713 1.00 77.51 C ANISOU 2159 CB LYS C 964 8850 11859 8741 35 -310 397 C ATOM 2160 CG LYS C 964 10.940 -6.266 8.803 1.00 93.47 C ANISOU 2160 CG LYS C 964 10697 14068 10751 330 -345 452 C ATOM 2161 CD LYS C 964 12.193 -5.886 8.037 1.00 96.77 C ANISOU 2161 CD LYS C 964 10849 14893 11027 231 -394 454 C ATOM 2162 CE LYS C 964 12.531 -6.890 6.953 1.00 83.40 C ANISOU 2162 CE LYS C 964 8999 13330 9360 524 -415 485 C ATOM 2163 NZ LYS C 964 13.989 -6.959 6.705 1.00 75.74 N ANISOU 2163 NZ LYS C 964 7719 12879 8181 521 -497 478 N ATOM 2164 N GLN C 965 8.320 -3.501 11.448 1.00 75.72 N ANISOU 2164 N GLN C 965 9097 11000 8675 -379 -209 240 N ATOM 2165 CA GLN C 965 8.114 -2.523 12.540 1.00 70.23 C ANISOU 2165 CA GLN C 965 8509 10247 7929 -643 -210 169 C ATOM 2166 C GLN C 965 6.967 -3.018 13.427 1.00 64.77 C ANISOU 2166 C GLN C 965 8004 9280 7327 -547 -159 119 C ATOM 2167 O GLN C 965 7.024 -2.764 14.636 1.00 65.19 O ANISOU 2167 O GLN C 965 8097 9389 7285 -671 -174 91 O ATOM 2168 CB GLN C 965 7.896 -1.128 11.959 1.00 70.52 C ANISOU 2168 CB GLN C 965 8627 10145 8022 -915 -200 98 C ATOM 2169 CG GLN C 965 8.421 -0.026 12.867 1.00 83.10 C ANISOU 2169 CG GLN C 965 10225 11872 9477 -1228 -239 54 C ATOM 2170 CD GLN C 965 8.897 1.185 12.098 1.00 90.51 C ANISOU 2170 CD GLN C 965 11160 12852 10376 -1501 -264 36 C ATOM 2171 OE1 GLN C 965 8.661 1.334 10.893 1.00 85.64 O ANISOU 2171 OE1 GLN C 965 10576 12108 9855 -1474 -249 45 O ATOM 2172 NE2 GLN C 965 9.581 2.071 12.807 1.00 93.41 N ANISOU 2172 NE2 GLN C 965 11500 13399 10591 -1782 -303 10 N ATOM 2173 N LEU C 966 5.985 -3.725 12.856 1.00 61.76 N ANISOU 2173 N LEU C 966 7724 8633 7108 -342 -98 105 N ATOM 2174 CA LEU C 966 4.836 -4.282 13.615 1.00 58.81 C ANISOU 2174 CA LEU C 966 7527 8007 6813 -258 -36 47 C ATOM 2175 C LEU C 966 5.327 -5.385 14.553 1.00 64.35 C ANISOU 2175 C LEU C 966 8197 8883 7370 -116 -72 137 C ATOM 2176 O LEU C 966 4.928 -5.374 15.733 1.00 70.73 O ANISOU 2176 O LEU C 966 9112 9639 8124 -203 -57 95 O ATOM 2177 CB LEU C 966 3.775 -4.829 12.658 1.00 58.68 C ANISOU 2177 CB LEU C 966 7603 7704 6988 -74 38 11 C ATOM 2178 CG LEU C 966 2.871 -3.792 11.993 1.00 54.23 C ANISOU 2178 CG LEU C 966 7146 6876 6584 -194 79 -115 C ATOM 2179 CD1 LEU C 966 1.821 -4.473 11.128 1.00 47.54 C ANISOU 2179 CD1 LEU C 966 6376 5773 5914 13 153 -157 C ATOM 2180 CD2 LEU C 966 2.197 -2.899 13.016 1.00 53.18 C ANISOU 2180 CD2 LEU C 966 7146 6608 6453 -402 94 -250 C ATOM 2181 N SER C 967 6.149 -6.308 14.053 1.00 57.43 N ANISOU 2181 N SER C 967 7188 8204 6428 100 -125 248 N ATOM 2182 CA SER C 967 6.716 -7.410 14.870 1.00 60.46 C ANISOU 2182 CA SER C 967 7553 8758 6661 274 -187 340 C ATOM 2183 C SER C 967 7.531 -6.801 16.013 1.00 63.04 C ANISOU 2183 C SER C 967 7811 9342 6800 83 -253 342 C ATOM 2184 O SER C 967 7.478 -7.343 17.116 1.00 56.37 O ANISOU 2184 O SER C 967 7053 8513 5852 118 -276 369 O ATOM 2185 CB SER C 967 7.518 -8.382 14.047 1.00 59.56 C ANISOU 2185 CB SER C 967 7295 8826 6508 548 -252 437 C ATOM 2186 OG SER C 967 8.512 -7.711 13.296 1.00 84.27 O ANISOU 2186 OG SER C 967 10206 12225 9587 466 -298 443 O ATOM 2187 N SER C 968 8.209 -5.681 15.759 1.00 60.99 N ANISOU 2187 N SER C 968 7416 9264 6495 -133 -279 311 N ATOM 2188 CA SER C 968 9.023 -4.945 16.761 1.00 63.08 C ANISOU 2188 CA SER C 968 7597 9790 6580 -352 -336 297 C ATOM 2189 C SER C 968 8.103 -4.385 17.850 1.00 65.32 C ANISOU 2189 C SER C 968 8068 9855 6894 -542 -282 210 C ATOM 2190 O SER C 968 8.430 -4.532 19.038 1.00 73.86 O ANISOU 2190 O SER C 968 9157 11076 7830 -588 -322 226 O ATOM 2191 CB SER C 968 9.832 -3.863 16.110 1.00 70.04 C ANISOU 2191 CB SER C 968 8319 10876 7418 -563 -360 273 C ATOM 2192 OG SER C 968 10.232 -2.909 17.073 1.00 72.44 O ANISOU 2192 OG SER C 968 8607 11319 7598 -838 -384 225 O ATOM 2193 N ASN C 969 6.987 -3.777 17.447 1.00 66.90 N ANISOU 2193 N ASN C 969 8412 9734 7274 -639 -201 112 N ATOM 2194 CA ASN C 969 6.001 -3.157 18.368 1.00 64.66 C ANISOU 2194 CA ASN C 969 8297 9232 7037 -819 -147 -8 C ATOM 2195 C ASN C 969 5.345 -4.245 19.217 1.00 68.16 C ANISOU 2195 C ASN C 969 8868 9569 7459 -677 -114 8 C ATOM 2196 O ASN C 969 5.126 -3.994 20.405 1.00 71.98 O ANISOU 2196 O ASN C 969 9424 10064 7861 -819 -108 -44 O ATOM 2197 CB ASN C 969 4.938 -2.338 17.632 1.00 64.18 C ANISOU 2197 CB ASN C 969 8355 8856 7173 -906 -83 -133 C ATOM 2198 CG ASN C 969 5.441 -0.991 17.156 1.00 61.81 C ANISOU 2198 CG ASN C 969 8004 8614 6867 -1136 -121 -175 C ATOM 2199 OD1 ASN C 969 6.623 -0.677 17.272 1.00 70.48 O ANISOU 2199 OD1 ASN C 969 8956 10008 7814 -1243 -184 -110 O ATOM 2200 ND2 ASN C 969 4.546 -0.182 16.616 1.00 49.95 N ANISOU 2200 ND2 ASN C 969 6630 6830 5518 -1218 -87 -291 N ATOM 2201 N PHE C 970 5.026 -5.403 18.643 1.00 68.13 N ANISOU 2201 N PHE C 970 8904 9463 7519 -422 -91 74 N ATOM 2202 CA PHE C 970 4.345 -6.498 19.386 1.00 74.23 C ANISOU 2202 CA PHE C 970 9835 10106 8264 -302 -55 94 C ATOM 2203 C PHE C 970 5.316 -7.132 20.377 1.00 72.90 C ANISOU 2203 C PHE C 970 9627 10199 7874 -245 -148 208 C ATOM 2204 O PHE C 970 4.888 -7.529 21.469 1.00 82.02 O ANISOU 2204 O PHE C 970 10921 11299 8945 -288 -132 200 O ATOM 2205 CB PHE C 970 3.775 -7.553 18.445 1.00 73.75 C ANISOU 2205 CB PHE C 970 9839 9858 8325 -52 -9 133 C ATOM 2206 CG PHE C 970 2.496 -7.138 17.770 1.00 68.28 C ANISOU 2206 CG PHE C 970 9241 8862 7840 -97 97 -3 C ATOM 2207 CD1 PHE C 970 1.396 -6.762 18.520 1.00 68.33 C ANISOU 2207 CD1 PHE C 970 9390 8686 7887 -254 175 -145 C ATOM 2208 CD2 PHE C 970 2.388 -7.144 16.392 1.00 61.00 C ANISOU 2208 CD2 PHE C 970 8260 7853 7064 26 116 0 C ATOM 2209 CE1 PHE C 970 0.211 -6.390 17.907 1.00 65.11 C ANISOU 2209 CE1 PHE C 970 9058 8019 7662 -275 263 -292 C ATOM 2210 CE2 PHE C 970 1.205 -6.767 15.780 1.00 62.56 C ANISOU 2210 CE2 PHE C 970 8546 7779 7445 1 204 -132 C ATOM 2211 CZ PHE C 970 0.119 -6.389 16.538 1.00 64.68 C ANISOU 2211 CZ PHE C 970 8950 7873 7752 -142 274 -283 C ATOM 2212 N GLY C 971 6.585 -7.233 19.994 1.00 75.29 N ANISOU 2212 N GLY C 971 9742 10789 8075 -149 -246 301 N ATOM 2213 CA GLY C 971 7.669 -7.692 20.884 1.00 77.98 C ANISOU 2213 CA GLY C 971 10007 11431 8189 -88 -358 394 C ATOM 2214 C GLY C 971 7.779 -6.803 22.110 1.00 68.78 C ANISOU 2214 C GLY C 971 8851 10370 6913 -360 -363 331 C ATOM 2215 O GLY C 971 7.872 -7.336 23.227 1.00 72.92 O ANISOU 2215 O GLY C 971 9461 10955 7290 -341 -402 373 O ATOM 2216 N ALA C 972 7.762 -5.487 21.900 1.00 69.18 N ANISOU 2216 N ALA C 972 8829 10430 7025 -608 -329 233 N ATOM 2217 CA ALA C 972 7.861 -4.454 22.956 1.00 68.16 C ANISOU 2217 CA ALA C 972 8698 10392 6807 -894 -331 152 C ATOM 2218 C ALA C 972 6.605 -4.496 23.844 1.00 73.48 C ANISOU 2218 C ALA C 972 9586 10802 7532 -987 -249 64 C ATOM 2219 O ALA C 972 6.752 -4.360 25.071 1.00 74.85 O ANISOU 2219 O ALA C 972 9790 11086 7564 -1113 -272 49 O ATOM 2220 CB ALA C 972 8.076 -3.099 22.321 1.00 59.05 C ANISOU 2220 CB ALA C 972 7450 9263 5724 -1115 -319 69 C ATOM 2221 N ILE C 973 5.418 -4.709 23.264 1.00 74.19 N ANISOU 2221 N ILE C 973 9810 10575 7804 -929 -157 -1 N ATOM 2222 CA ILE C 973 4.128 -4.753 24.016 1.00 61.90 C ANISOU 2222 CA ILE C 973 8443 8778 6298 -1025 -66 -116 C ATOM 2223 C ILE C 973 4.128 -5.981 24.931 1.00 74.35 C ANISOU 2223 C ILE C 973 10131 10393 7724 -913 -83 -19 C ATOM 2224 O ILE C 973 3.871 -5.820 26.131 1.00 82.81 O ANISOU 2224 O ILE C 973 11281 11494 8689 -1072 -70 -69 O ATOM 2225 CB ILE C 973 2.910 -4.737 23.070 1.00 57.27 C ANISOU 2225 CB ILE C 973 7951 7876 5934 -970 31 -219 C ATOM 2226 CG1 ILE C 973 2.791 -3.408 22.320 1.00 60.35 C ANISOU 2226 CG1 ILE C 973 8279 8192 6458 -1107 38 -332 C ATOM 2227 CG2 ILE C 973 1.636 -5.049 23.835 1.00 56.17 C ANISOU 2227 CG2 ILE C 973 7989 7536 5818 -1036 125 -334 C ATOM 2228 CD1 ILE C 973 1.862 -3.440 21.127 1.00 59.46 C ANISOU 2228 CD1 ILE C 973 8224 7812 6557 -997 105 -404 C ATOM 2229 N SER C 974 4.402 -7.168 24.391 1.00 80.59 N ANISOU 2229 N SER C 974 10942 11178 8499 -652 -117 114 N ATOM 2230 CA SER C 974 4.336 -8.444 25.155 1.00 86.71 C ANISOU 2230 CA SER C 974 11876 11938 9132 -522 -143 217 C ATOM 2231 C SER C 974 5.380 -8.422 26.286 1.00 81.49 C ANISOU 2231 C SER C 974 11160 11568 8235 -571 -254 294 C ATOM 2232 O SER C 974 5.083 -8.965 27.362 1.00 83.08 O ANISOU 2232 O SER C 974 11523 11741 8301 -614 -255 319 O ATOM 2233 CB SER C 974 4.448 -9.665 24.248 1.00 85.49 C ANISOU 2233 CB SER C 974 11762 11703 9017 -218 -170 335 C ATOM 2234 OG SER C 974 5.797 -10.054 24.034 1.00 88.53 O ANISOU 2234 OG SER C 974 12001 12356 9279 -29 -308 466 O ATOM 2235 N SER C 975 6.529 -7.770 26.072 1.00 76.53 N ANISOU 2235 N SER C 975 10313 11215 7550 -589 -339 319 N ATOM 2236 CA SER C 975 7.587 -7.543 27.093 1.00 77.99 C ANISOU 2236 CA SER C 975 10401 11717 7513 -659 -444 365 C ATOM 2237 C SER C 975 7.038 -6.689 28.243 1.00 78.73 C ANISOU 2237 C SER C 975 10564 11783 7567 -963 -385 249 C ATOM 2238 O SER C 975 7.290 -7.043 29.411 1.00 80.70 O ANISOU 2238 O SER C 975 10883 12150 7629 -996 -436 293 O ATOM 2239 CB SER C 975 8.812 -6.907 26.486 1.00 78.97 C ANISOU 2239 CB SER C 975 10262 12139 7604 -653 -523 381 C ATOM 2240 OG SER C 975 9.652 -6.345 27.483 1.00 81.56 O ANISOU 2240 OG SER C 975 10483 12760 7746 -805 -594 373 O ATOM 2241 N VAL C 976 6.340 -5.599 27.918 1.00 70.52 N ANISOU 2241 N VAL C 976 9508 10598 6689 -1166 -293 100 N ATOM 2242 CA VAL C 976 5.758 -4.637 28.900 1.00 68.30 C ANISOU 2242 CA VAL C 976 9277 10280 6395 -1458 -236 -46 C ATOM 2243 C VAL C 976 4.612 -5.320 29.648 1.00 74.68 C ANISOU 2243 C VAL C 976 10304 10881 7189 -1482 -156 -88 C ATOM 2244 O VAL C 976 4.470 -5.068 30.856 1.00 77.43 O ANISOU 2244 O VAL C 976 10706 11302 7412 -1660 -150 -140 O ATOM 2245 CB VAL C 976 5.262 -3.350 28.215 1.00 67.03 C ANISOU 2245 CB VAL C 976 9065 9982 6421 -1626 -174 -202 C ATOM 2246 CG1 VAL C 976 4.475 -2.460 29.167 1.00 67.64 C ANISOU 2246 CG1 VAL C 976 9218 9976 6506 -1889 -115 -378 C ATOM 2247 CG2 VAL C 976 6.410 -2.579 27.585 1.00 67.51 C ANISOU 2247 CG2 VAL C 976 8927 10260 6463 -1668 -248 -167 C ATOM 2248 N LEU C 977 3.812 -6.130 28.956 1.00 66.58 N ANISOU 2248 N LEU C 977 9400 9618 6281 -1328 -92 -74 N ATOM 2249 CA LEU C 977 2.652 -6.827 29.567 1.00 77.48 C ANISOU 2249 CA LEU C 977 10997 10798 7645 -1370 -2 -125 C ATOM 2250 C LEU C 977 3.149 -7.893 30.552 1.00 81.04 C ANISOU 2250 C LEU C 977 11567 11366 7857 -1298 -76 29 C ATOM 2251 O LEU C 977 2.617 -7.936 31.673 1.00 81.21 O ANISOU 2251 O LEU C 977 11715 11375 7766 -1473 -34 -28 O ATOM 2252 CB LEU C 977 1.773 -7.418 28.464 1.00 72.81 C ANISOU 2252 CB LEU C 977 10488 9942 7236 -1219 80 -147 C ATOM 2253 CG LEU C 977 0.866 -6.411 27.760 1.00 66.37 C ANISOU 2253 CG LEU C 977 9624 8952 6640 -1325 173 -345 C ATOM 2254 CD1 LEU C 977 0.076 -7.072 26.645 1.00 61.69 C ANISOU 2254 CD1 LEU C 977 9102 8123 6214 -1154 247 -357 C ATOM 2255 CD2 LEU C 977 -0.082 -5.746 28.736 1.00 63.39 C ANISOU 2255 CD2 LEU C 977 9317 8519 6250 -1580 253 -543 C ATOM 2256 N ASN C 978 4.161 -8.680 30.179 1.00 88.53 N ANISOU 2256 N ASN C 978 12477 12439 8722 -1051 -191 207 N ATOM 2257 CA ASN C 978 4.744 -9.739 31.053 1.00 95.10 C ANISOU 2257 CA ASN C 978 13438 13380 9315 -935 -295 365 C ATOM 2258 C ASN C 978 5.352 -9.111 32.318 1.00100.50 C ANISOU 2258 C ASN C 978 14059 14315 9811 -1122 -355 349 C ATOM 2259 O ASN C 978 5.242 -9.746 33.386 1.00101.05 O ANISOU 2259 O ASN C 978 14308 14394 9694 -1161 -382 408 O ATOM 2260 CB ASN C 978 5.758 -10.613 30.306 1.00 93.52 C ANISOU 2260 CB ASN C 978 13181 13281 9072 -602 -425 532 C ATOM 2261 CG ASN C 978 5.109 -11.647 29.405 1.00 93.09 C ANISOU 2261 CG ASN C 978 13278 12960 9132 -398 -382 582 C ATOM 2262 OD1 ASN C 978 5.663 -12.006 28.362 1.00100.90 O ANISOU 2262 OD1 ASN C 978 14163 13981 10193 -158 -441 650 O ATOM 2263 ND2 ASN C 978 3.939 -12.138 29.796 1.00 83.30 N ANISOU 2263 ND2 ASN C 978 12278 11471 7900 -501 -276 540 N ATOM 2264 N ASP C 979 5.932 -7.920 32.206 1.00105.37 N ANISOU 2264 N ASP C 979 14449 15117 10469 -1247 -372 271 N ATOM 2265 CA ASP C 979 6.471 -7.216 33.362 1.00110.12 C ANISOU 2265 CA ASP C 979 14975 15957 10908 -1447 -418 236 C ATOM 2266 C ASP C 979 5.347 -6.740 34.277 1.00106.54 C ANISOU 2266 C ASP C 979 14650 15368 10461 -1726 -303 86 C ATOM 2267 O ASP C 979 5.438 -6.860 35.499 1.00107.16 O ANISOU 2267 O ASP C 979 14807 15558 10351 -1844 -329 99 O ATOM 2268 CB ASP C 979 7.326 -6.029 32.916 1.00110.86 C ANISOU 2268 CB ASP C 979 14805 16266 11052 -1533 -455 178 C ATOM 2269 CG ASP C 979 8.766 -6.141 33.378 1.00113.05 C ANISOU 2269 CG ASP C 979 14932 16906 11116 -1450 -603 284 C ATOM 2270 OD1 ASP C 979 8.991 -6.596 34.519 1.00114.03 O ANISOU 2270 OD1 ASP C 979 15146 17142 11037 -1462 -662 340 O ATOM 2271 OD2 ASP C 979 9.672 -5.773 32.601 1.00110.77 O ANISOU 2271 OD2 ASP C 979 14433 16802 10851 -1377 -661 303 O ATOM 2272 N ILE C 980 4.287 -6.200 33.681 1.00102.36 N ANISOU 2272 N ILE C 980 14139 14609 10143 -1825 -179 -67 N ATOM 2273 CA ILE C 980 3.116 -5.717 34.469 1.00 91.40 C ANISOU 2273 CA ILE C 980 12855 13096 8775 -2082 -64 -250 C ATOM 2274 C ILE C 980 2.524 -6.906 35.232 1.00 87.24 C ANISOU 2274 C ILE C 980 12568 12478 8102 -2072 -33 -184 C ATOM 2275 O ILE C 980 2.269 -6.737 36.429 1.00 91.80 O ANISOU 2275 O ILE C 980 13213 13133 8535 -2276 -12 -245 O ATOM 2276 CB ILE C 980 2.087 -5.002 33.576 1.00 80.29 C ANISOU 2276 CB ILE C 980 11423 11460 7622 -2140 46 -435 C ATOM 2277 CG1 ILE C 980 2.618 -3.645 33.114 1.00 85.23 C ANISOU 2277 CG1 ILE C 980 11856 12175 8352 -2229 11 -521 C ATOM 2278 CG2 ILE C 980 0.761 -4.845 34.290 1.00 86.55 C ANISOU 2278 CG2 ILE C 980 12342 12114 8428 -2343 166 -627 C ATOM 2279 CD1 ILE C 980 1.885 -3.066 31.927 1.00 88.84 C ANISOU 2279 CD1 ILE C 980 12290 12407 9060 -2200 77 -649 C ATOM 2280 N LEU C 981 2.369 -8.067 34.584 1.00 92.53 N ANISOU 2280 N LEU C 981 13368 12998 8792 -1852 -36 -60 N ATOM 2281 CA LEU C 981 1.773 -9.300 35.184 1.00 90.99 C ANISOU 2281 CA LEU C 981 13444 12675 8454 -1842 -7 16 C ATOM 2282 C LEU C 981 2.638 -9.815 36.342 1.00 95.74 C ANISOU 2282 C LEU C 981 14130 13474 8771 -1836 -131 169 C ATOM 2283 O LEU C 981 2.063 -10.253 37.353 1.00100.98 O ANISOU 2283 O LEU C 981 14994 14097 9277 -1996 -89 158 O ATOM 2284 CB LEU C 981 1.604 -10.379 34.106 1.00 91.37 C ANISOU 2284 CB LEU C 981 13599 12526 8590 -1580 -7 128 C ATOM 2285 CG LEU C 981 0.535 -10.088 33.049 1.00 90.96 C ANISOU 2285 CG LEU C 981 13518 12247 8795 -1590 129 -25 C ATOM 2286 CD1 LEU C 981 0.526 -11.150 31.960 1.00 76.39 C ANISOU 2286 CD1 LEU C 981 11758 10236 7031 -1315 115 98 C ATOM 2287 CD2 LEU C 981 -0.846 -9.956 33.679 1.00 89.50 C ANISOU 2287 CD2 LEU C 981 13463 11930 8612 -1849 280 -215 C ATOM 2288 N SER C 982 3.965 -9.763 36.210 1.00104.03 N ANISOU 2288 N SER C 982 15034 14744 9749 -1664 -279 296 N ATOM 2289 CA SER C 982 4.921 -10.189 37.268 1.00112.52 C ANISOU 2289 CA SER C 982 16159 16042 10550 -1624 -421 435 C ATOM 2290 C SER C 982 4.849 -9.224 38.462 1.00113.04 C ANISOU 2290 C SER C 982 16159 16276 10515 -1932 -388 313 C ATOM 2291 O SER C 982 4.846 -9.722 39.604 1.00125.24 O ANISOU 2291 O SER C 982 17875 17876 11835 -2015 -425 373 O ATOM 2292 CB SER C 982 6.330 -10.329 36.740 1.00117.49 C ANISOU 2292 CB SER C 982 16612 16891 11136 -1354 -584 566 C ATOM 2293 OG SER C 982 7.082 -9.143 36.956 1.00116.75 O ANISOU 2293 OG SER C 982 16253 17069 11039 -1481 -616 488 O ATOM 2294 N ARG C 983 4.783 -7.909 38.211 1.00111.92 N ANISOU 2294 N ARG C 983 15796 16201 10526 -2095 -327 147 N ATOM 2295 CA ARG C 983 4.584 -6.861 39.255 1.00106.76 C ANISOU 2295 CA ARG C 983 15071 15680 9813 -2402 -282 -7 C ATOM 2296 C ARG C 983 3.281 -7.138 40.019 1.00112.00 C ANISOU 2296 C ARG C 983 15946 16175 10433 -2611 -156 -114 C ATOM 2297 O ARG C 983 3.328 -7.144 41.265 1.00112.95 O ANISOU 2297 O ARG C 983 16139 16428 10350 -2780 -173 -118 O ATOM 2298 CB ARG C 983 4.554 -5.451 38.654 1.00104.03 C ANISOU 2298 CB ARG C 983 14499 15357 9672 -2524 -232 -178 C ATOM 2299 CG ARG C 983 5.928 -4.867 38.360 1.00103.88 C ANISOU 2299 CG ARG C 983 14248 15601 9622 -2451 -350 -113 C ATOM 2300 CD ARG C 983 5.870 -3.510 37.677 1.00110.65 C ANISOU 2300 CD ARG C 983 14926 16441 10676 -2582 -303 -271 C ATOM 2301 NE ARG C 983 7.188 -3.069 37.226 1.00123.02 N ANISOU 2301 NE ARG C 983 16279 18254 12208 -2512 -407 -198 N ATOM 2302 CZ ARG C 983 7.471 -1.868 36.721 1.00126.03 C ANISOU 2302 CZ ARG C 983 16499 18685 12700 -2642 -399 -302 C ATOM 2303 NH1 ARG C 983 6.525 -0.948 36.597 1.00124.56 N ANISOU 2303 NH1 ARG C 983 16348 18302 12679 -2828 -304 -488 N ATOM 2304 NH2 ARG C 983 8.710 -1.590 36.346 1.00123.51 N ANISOU 2304 NH2 ARG C 983 15992 18621 12317 -2590 -491 -229 N ATOM 2305 N LEU C 984 2.172 -7.366 39.303 1.00110.24 N ANISOU 2305 N LEU C 984 15812 15691 10382 -2607 -36 -205 N ATOM 2306 CA LEU C 984 0.820 -7.595 39.894 1.00107.18 C ANISOU 2306 CA LEU C 984 15603 15152 9969 -2822 104 -347 C ATOM 2307 C LEU C 984 0.811 -8.865 40.752 1.00107.16 C ANISOU 2307 C LEU C 984 15871 15139 9707 -2821 70 -185 C ATOM 2308 O LEU C 984 0.082 -8.872 41.758 1.00103.68 O ANISOU 2308 O LEU C 984 15548 14709 9136 -3074 149 -286 O ATOM 2309 CB LEU C 984 -0.238 -7.685 38.791 1.00 97.77 C ANISOU 2309 CB LEU C 984 14435 13700 9012 -2768 225 -464 C ATOM 2310 CG LEU C 984 -1.032 -6.403 38.555 1.00 87.63 C ANISOU 2310 CG LEU C 984 12997 12372 7925 -2938 325 -742 C ATOM 2311 CD1 LEU C 984 -0.107 -5.236 38.281 1.00 93.15 C ANISOU 2311 CD1 LEU C 984 13463 13220 8708 -2921 240 -761 C ATOM 2312 CD2 LEU C 984 -2.003 -6.570 37.405 1.00 92.75 C ANISOU 2312 CD2 LEU C 984 13669 12774 8797 -2844 426 -844 C ATOM 2313 N ASP C 985 1.564 -9.898 40.364 1.00112.63 N ANISOU 2313 N ASP C 985 16667 15807 10320 -2550 -48 48 N ATOM 2314 CA ASP C 985 1.696 -11.155 41.152 1.00115.41 C ANISOU 2314 CA ASP C 985 17313 16132 10404 -2512 -117 230 C ATOM 2315 C ASP C 985 2.481 -10.886 42.442 1.00118.59 C ANISOU 2315 C ASP C 985 17699 16799 10562 -2622 -221 284 C ATOM 2316 O ASP C 985 2.193 -11.557 43.459 1.00109.44 O ANISOU 2316 O ASP C 985 16789 15626 9168 -2753 -225 345 O ATOM 2317 CB ASP C 985 2.352 -12.269 40.336 1.00115.75 C ANISOU 2317 CB ASP C 985 17463 16078 10437 -2157 -239 450 C ATOM 2318 CG ASP C 985 1.343 -13.209 39.708 1.00110.34 C ANISOU 2318 CG ASP C 985 17009 15089 9826 -2116 -140 459 C ATOM 2319 OD1 ASP C 985 0.342 -12.707 39.168 1.00107.38 O ANISOU 2319 OD1 ASP C 985 16558 14588 9652 -2246 18 273 O ATOM 2320 OD2 ASP C 985 1.552 -14.435 39.789 1.00107.33 O ANISOU 2320 OD2 ASP C 985 16892 14599 9290 -1957 -227 644 O ATOM 2321 N LYS C 986 3.441 -9.955 42.395 1.00125.26 N ANISOU 2321 N LYS C 986 18268 17877 11448 -2581 -301 263 N ATOM 2322 CA LYS C 986 4.296 -9.572 43.552 1.00130.65 C ANISOU 2322 CA LYS C 986 18883 18846 11911 -2675 -405 299 C ATOM 2323 C LYS C 986 3.545 -8.603 44.472 1.00131.47 C ANISOU 2323 C LYS C 986 18933 19017 12003 -3043 -281 84 C ATOM 2324 O LYS C 986 3.907 -8.535 45.666 1.00138.41 O ANISOU 2324 O LYS C 986 19849 20084 12655 -3180 -336 109 O ATOM 2325 CB LYS C 986 5.630 -8.993 43.069 1.00131.71 C ANISOU 2325 CB LYS C 986 18738 19218 12088 -2491 -534 351 C ATOM 2326 CG LYS C 986 6.578 -10.049 42.518 1.00135.49 C ANISOU 2326 CG LYS C 986 19274 19718 12487 -2123 -697 570 C ATOM 2327 CD LYS C 986 7.992 -9.588 42.256 1.00136.63 C ANISOU 2327 CD LYS C 986 19144 20166 12603 -1955 -841 619 C ATOM 2328 CE LYS C 986 8.952 -10.759 42.262 1.00137.36 C ANISOU 2328 CE LYS C 986 19344 20341 12505 -1617 -1034 828 C ATOM 2329 NZ LYS C 986 10.325 -10.348 41.898 1.00137.15 N ANISOU 2329 NZ LYS C 986 19021 20636 12453 -1438 -1171 853 N ATOM 2330 N VAL C 987 2.546 -7.882 43.954 1.00129.93 N ANISOU 2330 N VAL C 987 18651 18682 12034 -3187 -130 -129 N ATOM 2331 CA VAL C 987 1.687 -6.980 44.775 1.00121.29 C ANISOU 2331 CA VAL C 987 17509 17634 10942 -3524 -8 -370 C ATOM 2332 C VAL C 987 0.583 -7.818 45.435 1.00121.48 C ANISOU 2332 C VAL C 987 17805 17524 10827 -3696 96 -401 C ATOM 2333 O VAL C 987 0.358 -7.618 46.636 1.00124.23 O ANISOU 2333 O VAL C 987 18202 18006 10992 -3944 122 -473 O ATOM 2334 CB VAL C 987 1.133 -5.808 43.946 1.00113.22 C ANISOU 2334 CB VAL C 987 16279 16529 10210 -3583 87 -600 C ATOM 2335 CG1 VAL C 987 0.024 -5.073 44.677 1.00106.84 C ANISOU 2335 CG1 VAL C 987 15459 15720 9415 -3894 218 -873 C ATOM 2336 CG2 VAL C 987 2.237 -4.839 43.551 1.00114.30 C ANISOU 2336 CG2 VAL C 987 16162 16834 10431 -3503 -11 -588 C ATOM 2337 N GLU C 988 -0.062 -8.730 44.696 1.00123.89 N ATOM 2338 CA GLU C 988 -1.091 -9.671 45.230 1.00115.36 C ATOM 2339 C GLU C 988 -0.404 -10.738 46.094 1.00116.60 C ATOM 2340 O GLU C 988 -0.503 -11.935 45.733 1.00124.46 O ATOM 2341 CB GLU C 988 -1.882 -10.342 44.102 1.00110.21 C ATOM 2342 CG GLU C 988 -2.725 -9.384 43.278 1.00110.50 C ATOM 2343 CD GLU C 988 -3.444 -10.024 42.101 1.00114.23 C ATOM 2344 OE1 GLU C 988 -3.003 -11.101 41.647 1.00117.91 O ATOM 2345 OE2 GLU C 988 -4.441 -9.442 41.638 1.00112.58 O