>>6LXT:HELIX   10 AB1 GLN D  913  LEU D  984  1                                  72    
QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 10 AB1 GLN D 913 LEU D 984 1 72 ATOM 2661 N GLN D 913 -22.492 9.001 -65.459 1.00134.78 N ANISOU 2661 N GLN D 913 20149 19069 11992 -1006 1 -272 N ATOM 2662 CA GLN D 913 -23.554 9.807 -64.791 1.00140.80 C ANISOU 2662 CA GLN D 913 20025 20929 12545 -752 -190 -162 C ATOM 2663 C GLN D 913 -24.580 8.909 -64.067 1.00145.34 C ANISOU 2663 C GLN D 913 20411 22207 12605 -1725 -304 -364 C ATOM 2664 O GLN D 913 -25.387 9.462 -63.283 1.00137.57 O ANISOU 2664 O GLN D 913 18756 22008 11505 -1546 -437 -263 O ATOM 2665 CB GLN D 913 -24.208 10.733 -65.821 1.00140.84 C ANISOU 2665 CB GLN D 913 19398 21942 12172 -256 -304 -4 C ATOM 2666 CG GLN D 913 -24.822 11.994 -65.223 1.00138.85 C ANISOU 2666 CG GLN D 913 18341 22436 11980 518 -389 246 C ATOM 2667 CD GLN D 913 -24.738 13.190 -66.146 1.00137.25 C ANISOU 2667 CD GLN D 913 17787 22532 11831 1461 -362 492 C ATOM 2668 OE1 GLN D 913 -23.687 13.498 -66.709 1.00135.05 O ANISOU 2668 OE1 GLN D 913 17946 21353 12013 1975 -230 557 O ATOM 2669 NE2 GLN D 913 -25.850 13.895 -66.299 1.00137.90 N ANISOU 2669 NE2 GLN D 913 17059 23902 11435 1729 -470 660 N ATOM 2670 N ASN D 914 -24.574 7.591 -64.309 1.00144.22 N ANISOU 2670 N ASN D 914 20845 21805 12147 -2709 -239 -628 N ATOM 2671 CA ASN D 914 -25.330 6.597 -63.493 1.00142.70 C ANISOU 2671 CA ASN D 914 20649 22001 11570 -3688 -295 -841 C ATOM 2672 C ASN D 914 -24.649 6.473 -62.125 1.00133.12 C ANISOU 2672 C ASN D 914 19713 19873 10992 -3504 -174 -816 C ATOM 2673 O ASN D 914 -25.348 6.629 -61.099 1.00130.26 O ANISOU 2673 O ASN D 914 18858 20074 10562 -3589 -293 -796 O ATOM 2674 CB ASN D 914 -25.439 5.224 -64.173 1.00144.15 C ANISOU 2674 CB ASN D 914 21475 22058 11239 -4791 -208 -1137 C ATOM 2675 CG ASN D 914 -26.675 5.065 -65.034 1.00146.99 C ANISOU 2675 CG ASN D 914 21352 23786 10711 -5422 -414 -1231 C ATOM 2676 OD1 ASN D 914 -27.719 5.648 -64.750 1.00147.16 O ANISOU 2676 OD1 ASN D 914 20510 25011 10394 -5334 -636 -1114 O ATOM 2677 ND2 ASN D 914 -26.581 4.251 -66.072 1.00150.42 N ANISOU 2677 ND2 ASN D 914 22346 24074 10732 -6087 -331 -1429 N ATOM 2678 N VAL D 915 -23.333 6.222 -62.130 1.00132.25 N ANISOU 2678 N VAL D 915 20346 18440 11463 -3240 58 -790 N ATOM 2679 CA VAL D 915 -22.467 6.075 -60.920 1.00129.93 C ANISOU 2679 CA VAL D 915 20401 17147 11818 -3027 208 -731 C ATOM 2680 C VAL D 915 -22.650 7.311 -60.020 1.00128.34 C ANISOU 2680 C VAL D 915 19520 17279 11966 -2227 71 -518 C ATOM 2681 O VAL D 915 -22.773 7.115 -58.792 1.00130.17 O ANISOU 2681 O VAL D 915 19668 17425 12366 -2386 64 -541 O ATOM 2682 CB VAL D 915 -20.994 5.839 -61.323 1.00131.29 C ANISOU 2682 CB VAL D 915 21379 15977 12529 -2694 473 -645 C ATOM 2683 CG1 VAL D 915 -20.037 5.909 -60.140 1.00130.46 C ANISOU 2683 CG1 VAL D 915 21525 14929 13116 -2322 611 -507 C ATOM 2684 CG2 VAL D 915 -20.818 4.518 -62.059 1.00131.83 C ANISOU 2684 CG2 VAL D 915 22215 15634 12242 -3522 666 -858 C ATOM 2685 N LEU D 916 -22.693 8.520 -60.602 1.00125.93 N ANISOU 2685 N LEU D 916 18768 17342 11738 -1414 -15 -320 N ATOM 2686 CA LEU D 916 -22.909 9.810 -59.882 1.00121.70 C ANISOU 2686 CA LEU D 916 17613 17152 11476 -590 -109 -102 C ATOM 2687 C LEU D 916 -24.234 9.774 -59.122 1.00130.10 C ANISOU 2687 C LEU D 916 18033 19325 12075 -966 -281 -152 C ATOM 2688 O LEU D 916 -24.240 10.196 -57.952 1.00130.03 O ANISOU 2688 O LEU D 916 17821 19217 12369 -673 -292 -70 O ATOM 2689 CB LEU D 916 -22.925 10.983 -60.866 1.00119.89 C ANISOU 2689 CB LEU D 916 17027 17288 11236 227 -143 96 C ATOM 2690 CG LEU D 916 -21.556 11.491 -61.310 1.00117.77 C ANISOU 2690 CG LEU D 916 17234 15919 11596 929 16 243 C ATOM 2691 CD1 LEU D 916 -21.701 12.518 -62.419 1.00114.77 C ANISOU 2691 CD1 LEU D 916 16506 16000 11103 1628 -12 410 C ATOM 2692 CD2 LEU D 916 -20.783 12.082 -60.142 1.00120.01 C ANISOU 2692 CD2 LEU D 916 17610 15449 12539 1467 89 383 C ATOM 2693 N TYR D 917 -25.318 9.331 -59.768 1.00130.94 N ANISOU 2693 N TYR D 917 17813 20483 11457 -1577 -413 -260 N ATOM 2694 CA TYR D 917 -26.654 9.268 -59.125 1.00126.27 C ANISOU 2694 CA TYR D 917 16554 21073 10349 -1973 -588 -274 C ATOM 2695 C TYR D 917 -26.646 8.164 -58.068 1.00122.05 C ANISOU 2695 C TYR D 917 16366 20143 9865 -2757 -552 -479 C ATOM 2696 O TYR D 917 -27.112 8.426 -56.950 1.00121.31 O ANISOU 2696 O TYR D 917 15889 20367 9838 -2657 -617 -416 O ATOM 2697 CB TYR D 917 -27.800 9.073 -60.118 1.00131.98 C ANISOU 2697 CB TYR D 917 16810 23087 10248 -2463 -747 -308 C ATOM 2698 CG TYR D 917 -29.123 9.499 -59.532 1.00139.32 C ANISOU 2698 CG TYR D 917 16871 25345 10719 -2473 -923 -173 C ATOM 2699 CD1 TYR D 917 -29.325 10.814 -59.136 1.00140.37 C ANISOU 2699 CD1 TYR D 917 16441 25836 11056 -1479 -927 124 C ATOM 2700 CD2 TYR D 917 -30.156 8.597 -59.323 1.00143.16 C ANISOU 2700 CD2 TYR D 917 17123 26702 10571 -3463 -1060 -322 C ATOM 2701 CE1 TYR D 917 -30.523 11.229 -58.576 1.00140.23 C ANISOU 2701 CE1 TYR D 917 15641 27022 10617 -1417 -1052 293 C ATOM 2702 CE2 TYR D 917 -31.362 8.996 -58.765 1.00143.44 C ANISOU 2702 CE2 TYR D 917 16335 27983 10182 -3442 -1216 -155 C ATOM 2703 CZ TYR D 917 -31.548 10.317 -58.390 1.00138.97 C ANISOU 2703 CZ TYR D 917 15208 27769 9826 -2392 -1206 167 C ATOM 2704 OH TYR D 917 -32.729 10.724 -57.838 1.00132.28 O ANISOU 2704 OH TYR D 917 13572 27940 8750 -2280 -1275 369 O ATOM 2705 N GLU D 918 -26.113 6.987 -58.405 1.00119.23 N ANISOU 2705 N GLU D 918 16737 19083 9482 -3474 -423 -704 N ATOM 2706 CA GLU D 918 -25.960 5.845 -57.463 1.00118.27 C ANISOU 2706 CA GLU D 918 17072 18426 9440 -4216 -322 -899 C ATOM 2707 C GLU D 918 -25.172 6.265 -56.220 1.00119.75 C ANISOU 2707 C GLU D 918 17365 17786 10347 -3630 -229 -772 C ATOM 2708 O GLU D 918 -25.525 5.801 -55.119 1.00124.07 O ANISOU 2708 O GLU D 918 17836 18413 10891 -4017 -244 -847 O ATOM 2709 CB GLU D 918 -25.210 4.695 -58.119 1.00121.61 C ANISOU 2709 CB GLU D 918 18395 17963 9850 -4823 -106 -1096 C ATOM 2710 CG GLU D 918 -26.042 3.939 -59.122 1.00131.16 C ANISOU 2710 CG GLU D 918 19639 19923 10274 -5709 -175 -1301 C ATOM 2711 CD GLU D 918 -25.456 2.570 -59.395 1.00134.18 C ANISOU 2711 CD GLU D 918 20983 19414 10585 -6506 84 -1539 C ATOM 2712 OE1 GLU D 918 -24.212 2.431 -59.294 1.00132.71 O ANISOU 2712 OE1 GLU D 918 21446 17994 10985 -6125 329 -1473 O ATOM 2713 OE2 GLU D 918 -26.244 1.645 -59.657 1.00135.11 O ANISOU 2713 OE2 GLU D 918 21206 20075 10055 -7508 56 -1772 O ATOM 2714 N ASN D 919 -24.124 7.072 -56.401 1.00114.48 N ANISOU 2714 N ASN D 919 16890 16348 10260 -2774 -133 -589 N ATOM 2715 CA ASN D 919 -23.309 7.629 -55.291 1.00112.74 C ANISOU 2715 CA ASN D 919 16747 15367 10723 -2158 -57 -438 C ATOM 2716 C ASN D 919 -24.186 8.559 -54.437 1.00110.82 C ANISOU 2716 C ASN D 919 15745 15958 10404 -1759 -227 -318 C ATOM 2717 O ASN D 919 -24.111 8.444 -53.205 1.00117.76 O ANISOU 2717 O ASN D 919 16616 16591 11538 -1805 -211 -320 O ATOM 2718 CB ASN D 919 -22.043 8.323 -55.803 1.00112.57 C ANISOU 2718 CB ASN D 919 17073 14434 11266 -1373 70 -257 C ATOM 2719 CG ASN D 919 -20.934 7.362 -56.185 1.00110.34 C ANISOU 2719 CG ASN D 919 17625 13068 11232 -1682 298 -316 C ATOM 2720 OD1 ASN D 919 -20.995 6.171 -55.880 1.00107.76 O ANISOU 2720 OD1 ASN D 919 17687 12521 10736 -2446 402 -490 O ATOM 2721 ND2 ASN D 919 -19.903 7.873 -56.842 1.00108.43 N ANISOU 2721 ND2 ASN D 919 17682 12130 11388 -1072 403 -151 N ATOM 2722 N GLN D 920 -25.001 9.425 -55.054 1.00105.33 N ANISOU 2722 N GLN D 920 14442 16229 9351 -1377 -363 -201 N ATOM 2723 CA GLN D 920 -25.875 10.397 -54.334 1.00 99.58 C ANISOU 2723 CA GLN D 920 12988 16343 8505 -899 -483 -35 C ATOM 2724 C GLN D 920 -26.959 9.667 -53.530 1.00107.19 C ANISOU 2724 C GLN D 920 13624 18077 9028 -1636 -599 -154 C ATOM 2725 O GLN D 920 -27.437 10.244 -52.537 1.00 99.15 O ANISOU 2725 O GLN D 920 12182 17427 8064 -1310 -651 -36 O ATOM 2726 CB GLN D 920 -26.592 11.344 -55.293 1.00108.29 C ANISOU 2726 CB GLN D 920 13516 18410 9219 -392 -567 140 C ATOM 2727 CG GLN D 920 -25.687 12.342 -55.993 1.00110.65 C ANISOU 2727 CG GLN D 920 13992 18112 9938 498 -457 308 C ATOM 2728 CD GLN D 920 -26.495 13.434 -56.654 1.00116.85 C ANISOU 2728 CD GLN D 920 14119 19915 10362 1127 -509 529 C ATOM 2729 OE1 GLN D 920 -27.551 13.199 -57.240 1.00118.52 O ANISOU 2729 OE1 GLN D 920 13874 21236 9923 760 -629 528 O ATOM 2730 NE2 GLN D 920 -26.005 14.657 -56.551 1.00118.81 N ANISOU 2730 NE2 GLN D 920 14316 19814 11014 2088 -403 740 N ATOM 2731 N LYS D 921 -27.383 8.487 -53.997 1.00106.04 N ANISOU 2731 N LYS D 921 13656 18216 8418 -2586 -635 -371 N ATOM 2732 CA LYS D 921 -28.353 7.593 -53.300 1.00102.27 C ANISOU 2732 CA LYS D 921 12963 18396 7498 -3446 -732 -520 C ATOM 2733 C LYS D 921 -27.660 6.881 -52.130 1.00 96.63 C ANISOU 2733 C LYS D 921 12755 16709 7251 -3725 -602 -641 C ATOM 2734 O LYS D 921 -28.288 6.727 -51.068 1.00 97.21 O ANISOU 2734 O LYS D 921 12517 17182 7238 -3942 -672 -650 O ATOM 2735 CB LYS D 921 -28.933 6.540 -54.255 1.00105.53 C ANISOU 2735 CB LYS D 921 13504 19336 7256 -4425 -783 -730 C ATOM 2736 CG LYS D 921 -30.141 6.976 -55.076 1.00111.23 C ANISOU 2736 CG LYS D 921 13496 21497 7270 -4481 -980 -621 C ATOM 2737 CD LYS D 921 -30.820 5.830 -55.797 1.00117.27 C ANISOU 2737 CD LYS D 921 14371 22861 7326 -5619 -1051 -852 C ATOM 2738 CE LYS D 921 -32.275 6.108 -56.106 1.00123.65 C ANISOU 2738 CE LYS D 921 14266 25024 7690 -5718 -1195 -679 C ATOM 2739 NZ LYS D 921 -32.855 5.065 -56.982 1.00129.79 N ANISOU 2739 NZ LYS D 921 15131 26035 8150 -6632 -1152 -828 N ATOM 2740 N LEU D 922 -26.428 6.420 -52.339 1.00 94.94 N ANISOU 2740 N LEU D 922 13289 15298 7485 -3732 -408 -715 N ATOM 2741 CA LEU D 922 -25.600 5.773 -51.290 1.00 91.23 C ANISOU 2741 CA LEU D 922 13339 13821 7502 -3907 -242 -781 C ATOM 2742 C LEU D 922 -25.393 6.766 -50.138 1.00 87.25 C ANISOU 2742 C LEU D 922 12510 13174 7466 -3156 -280 -592 C ATOM 2743 O LEU D 922 -25.795 6.426 -49.006 1.00 88.08 O ANISOU 2743 O LEU D 922 12465 13432 7571 -3440 -308 -640 O ATOM 2744 CB LEU D 922 -24.273 5.342 -51.920 1.00 88.30 C ANISOU 2744 CB LEU D 922 13759 12275 7515 -3848 -14 -798 C ATOM 2745 CG LEU D 922 -23.290 4.604 -51.009 1.00 91.14 C ANISOU 2745 CG LEU D 922 14717 11552 8359 -4011 206 -822 C ATOM 2746 CD1 LEU D 922 -23.929 3.367 -50.385 1.00 87.95 C ANISOU 2746 CD1 LEU D 922 14444 11363 7611 -4955 252 -1040 C ATOM 2747 CD2 LEU D 922 -22.027 4.228 -51.776 1.00 82.47 C ANISOU 2747 CD2 LEU D 922 14362 9395 7576 -3896 446 -781 C ATOM 2748 N ILE D 923 -24.832 7.951 -50.430 1.00 88.16 N ANISOU 2748 N ILE D 923 12527 13038 7932 -2258 -275 -391 N ATOM 2749 CA ILE D 923 -24.493 9.018 -49.434 1.00 84.30 C ANISOU 2749 CA ILE D 923 11826 12297 7908 -1487 -279 -206 C ATOM 2750 C ILE D 923 -25.742 9.328 -48.602 1.00 87.04 C ANISOU 2750 C ILE D 923 11514 13647 7909 -1527 -429 -176 C ATOM 2751 O ILE D 923 -25.650 9.249 -47.364 1.00 85.08 O ANISOU 2751 O ILE D 923 11270 13146 7909 -1544 -412 -177 O ATOM 2752 CB ILE D 923 -23.913 10.286 -50.107 1.00 81.94 C ANISOU 2752 CB ILE D 923 11480 11764 7889 -571 -253 -5 C ATOM 2753 CG1 ILE D 923 -22.501 10.050 -50.655 1.00 78.30 C ANISOU 2753 CG1 ILE D 923 11690 10166 7896 -441 -91 14 C ATOM 2754 CG2 ILE D 923 -23.939 11.482 -49.158 1.00 79.65 C ANISOU 2754 CG2 ILE D 923 10867 11517 7881 165 -272 173 C ATOM 2755 CD1 ILE D 923 -22.046 11.091 -51.654 1.00 77.08 C ANISOU 2755 CD1 ILE D 923 11509 9888 7889 302 -70 178 C ATOM 2756 N ALA D 924 -26.859 9.655 -49.258 1.00 87.03 N ANISOU 2756 N ALA D 924 10962 14765 7342 -1536 -561 -128 N ATOM 2757 CA ALA D 924 -28.148 10.014 -48.618 1.00 90.40 C ANISOU 2757 CA ALA D 924 10689 16302 7357 -1518 -698 -38 C ATOM 2758 C ALA D 924 -28.622 8.895 -47.677 1.00 91.88 C ANISOU 2758 C ALA D 924 10901 16626 7382 -2349 -739 -213 C ATOM 2759 O ALA D 924 -29.043 9.216 -46.548 1.00 92.97 O ANISOU 2759 O ALA D 924 10731 17011 7584 -2164 -775 -133 O ATOM 2760 CB ALA D 924 -29.178 10.300 -49.677 1.00 95.57 C ANISOU 2760 CB ALA D 924 10810 18128 7374 -1537 -815 48 C ATOM 2761 N ASN D 925 -28.573 7.635 -48.118 1.00100.60 N ANISOU 2761 N ASN D 925 12382 17573 8269 -3228 -714 -440 N ATOM 2762 CA ASN D 925 -29.039 6.480 -47.307 1.00100.50 C ANISOU 2762 CA ASN D 925 12442 17683 8062 -4090 -725 -623 C ATOM 2763 C ASN D 925 -28.133 6.354 -46.080 1.00 97.52 C ANISOU 2763 C ASN D 925 12449 16290 8315 -3904 -591 -633 C ATOM 2764 O ASN D 925 -28.673 6.339 -44.959 1.00107.43 O ANISOU 2764 O ASN D 925 13398 17868 9551 -3971 -649 -613 O ATOM 2765 CB ASN D 925 -29.136 5.189 -48.128 1.00106.48 C ANISOU 2765 CB ASN D 925 13605 18425 8427 -5067 -681 -868 C ATOM 2766 CG ASN D 925 -30.510 4.992 -48.738 1.00114.70 C ANISOU 2766 CG ASN D 925 14086 20823 8673 -5611 -872 -893 C ATOM 2767 OD1 ASN D 925 -31.349 5.892 -48.706 1.00123.18 O ANISOU 2767 OD1 ASN D 925 14443 22872 9489 -5162 -1028 -686 O ATOM 2768 ND2 ASN D 925 -30.760 3.808 -49.275 1.00114.18 N ANISOU 2768 ND2 ASN D 925 14349 20848 8185 -6593 -845 -1129 N ATOM 2769 N GLN D 926 -26.813 6.306 -46.285 1.00 93.17 N ANISOU 2769 N GLN D 926 12511 14602 8287 -3649 -421 -635 N ATOM 2770 CA GLN D 926 -25.806 6.211 -45.192 1.00 88.33 C ANISOU 2770 CA GLN D 926 12282 12993 8288 -3443 -281 -606 C ATOM 2771 C GLN D 926 -26.017 7.363 -44.206 1.00 89.94 C ANISOU 2771 C GLN D 926 12029 13431 8715 -2735 -371 -428 C ATOM 2772 O GLN D 926 -25.926 7.124 -42.997 1.00 86.32 O ANISOU 2772 O GLN D 926 11594 12729 8476 -2830 -343 -442 O ATOM 2773 CB GLN D 926 -24.379 6.259 -45.740 1.00 84.52 C ANISOU 2773 CB GLN D 926 12414 11403 8295 -3116 -104 -549 C ATOM 2774 CG GLN D 926 -24.005 5.068 -46.609 1.00 93.25 C ANISOU 2774 CG GLN D 926 14103 12087 9240 -3776 50 -708 C ATOM 2775 CD GLN D 926 -24.176 3.759 -45.884 1.00 95.30 C ANISOU 2775 CD GLN D 926 14648 12177 9385 -4585 166 -882 C ATOM 2776 OE1 GLN D 926 -23.256 3.266 -45.238 1.00 96.43 O ANISOU 2776 OE1 GLN D 926 15251 11444 9945 -4608 361 -855 O ATOM 2777 NE2 GLN D 926 -25.364 3.186 -45.986 1.00 95.21 N ANISOU 2777 NE2 GLN D 926 14355 13035 8787 -5262 56 -1045 N ATOM 2778 N PHE D 927 -26.280 8.566 -44.715 1.00 94.43 N ANISOU 2778 N PHE D 927 12226 14437 9215 -2044 -451 -261 N ATOM 2779 CA PHE D 927 -26.492 9.793 -43.908 1.00 81.96 C ANISOU 2779 CA PHE D 927 10263 13073 7804 -1292 -494 -73 C ATOM 2780 C PHE D 927 -27.781 9.665 -43.097 1.00 92.43 C ANISOU 2780 C PHE D 927 11038 15361 8719 -1550 -614 -71 C ATOM 2781 O PHE D 927 -27.755 9.943 -41.889 1.00 93.18 O ANISOU 2781 O PHE D 927 11062 15294 9048 -1341 -602 -22 O ATOM 2782 CB PHE D 927 -26.558 11.024 -44.807 1.00 82.63 C ANISOU 2782 CB PHE D 927 10111 13457 7827 -534 -507 107 C ATOM 2783 CG PHE D 927 -26.823 12.308 -44.070 1.00 81.61 C ANISOU 2783 CG PHE D 927 9645 13553 7810 250 -502 306 C ATOM 2784 CD1 PHE D 927 -25.894 12.808 -43.173 1.00 79.63 C ANISOU 2784 CD1 PHE D 927 9707 12440 8109 653 -410 355 C ATOM 2785 CD2 PHE D 927 -27.996 13.016 -44.276 1.00 88.46 C ANISOU 2785 CD2 PHE D 927 9901 15503 8206 581 -569 461 C ATOM 2786 CE1 PHE D 927 -26.133 13.991 -42.492 1.00 83.42 C ANISOU 2786 CE1 PHE D 927 9951 13082 8664 1346 -377 524 C ATOM 2787 CE2 PHE D 927 -28.226 14.206 -43.605 1.00 88.91 C ANISOU 2787 CE2 PHE D 927 9717 15715 8349 1338 -511 659 C ATOM 2788 CZ PHE D 927 -27.294 14.692 -42.717 1.00 87.99 C ANISOU 2788 CZ PHE D 927 9974 14680 8779 1707 -412 674 C ATOM 2789 N ASN D 928 -28.875 9.262 -43.749 1.00 94.93 N ANISOU 2789 N ASN D 928 10969 16677 8422 -2001 -729 -109 N ATOM 2790 CA ASN D 928 -30.206 9.065 -43.112 1.00103.66 C ANISOU 2790 CA ASN D 928 11492 18847 9046 -2318 -858 -79 C ATOM 2791 C ASN D 928 -30.095 7.959 -42.053 1.00103.66 C ANISOU 2791 C ASN D 928 11748 18455 9184 -2996 -829 -262 C ATOM 2792 O ASN D 928 -30.637 8.144 -40.945 1.00106.78 O ANISOU 2792 O ASN D 928 11823 19183 9565 -2899 -874 -193 O ATOM 2793 CB ASN D 928 -31.300 8.755 -44.141 1.00110.27 C ANISOU 2793 CB ASN D 928 11899 20824 9173 -2766 -988 -79 C ATOM 2794 CG ASN D 928 -31.675 9.928 -45.030 1.00108.26 C ANISOU 2794 CG ASN D 928 11224 21216 8693 -2038 -1019 160 C ATOM 2795 OD1 ASN D 928 -31.397 11.088 -44.722 1.00109.86 O ANISOU 2795 OD1 ASN D 928 11338 21215 9189 -1151 -946 356 O ATOM 2796 ND2 ASN D 928 -32.321 9.631 -46.146 1.00101.29 N ANISOU 2796 ND2 ASN D 928 10092 21132 7260 -2421 -1112 150 N ATOM 2797 N SER D 929 -29.405 6.861 -42.381 1.00104.83 N ANISOU 2797 N SER D 929 12472 17901 9458 -3625 -732 -471 N ATOM 2798 CA SER D 929 -29.048 5.759 -41.447 1.00101.08 C ANISOU 2798 CA SER D 929 12379 16835 9192 -4225 -633 -639 C ATOM 2799 C SER D 929 -28.335 6.351 -40.219 1.00 97.42 C ANISOU 2799 C SER D 929 12013 15695 9309 -3640 -566 -531 C ATOM 2800 O SER D 929 -28.887 6.226 -39.113 1.00 99.66 O ANISOU 2800 O SER D 929 12029 16288 9549 -3757 -613 -526 O ATOM 2801 CB SER D 929 -28.224 4.702 -42.160 1.00 97.99 C ANISOU 2801 CB SER D 929 12676 15663 8892 -4781 -470 -820 C ATOM 2802 OG SER D 929 -27.780 3.694 -41.268 1.00 96.56 O ANISOU 2802 OG SER D 929 12905 14838 8945 -5262 -321 -944 O ATOM 2803 N ALA D 930 -27.197 7.030 -40.419 1.00 93.38 N ANISOU 2803 N ALA D 930 11837 14355 9287 -3027 -470 -435 N ATOM 2804 CA ALA D 930 -26.336 7.601 -39.353 1.00 90.81 C ANISOU 2804 CA ALA D 930 11686 13291 9526 -2506 -396 -333 C ATOM 2805 C ALA D 930 -27.170 8.493 -38.431 1.00 96.77 C ANISOU 2805 C ALA D 930 11901 14696 10172 -2069 -505 -208 C ATOM 2806 O ALA D 930 -27.062 8.322 -37.198 1.00100.76 O ANISOU 2806 O ALA D 930 12430 14962 10894 -2122 -482 -217 O ATOM 2807 CB ALA D 930 -25.178 8.368 -39.947 1.00 94.99 C ANISOU 2807 CB ALA D 930 12552 13065 10473 -1897 -311 -218 C ATOM 2808 N ILE D 931 -27.960 9.410 -38.998 1.00 97.64 N ANISOU 2808 N ILE D 931 11556 15594 9949 -1629 -597 -76 N ATOM 2809 CA ILE D 931 -28.770 10.382 -38.205 1.00 95.82 C ANISOU 2809 CA ILE D 931 10829 15997 9580 -1097 -655 94 C ATOM 2810 C ILE D 931 -29.752 9.600 -37.329 1.00 93.53 C ANISOU 2810 C ILE D 931 10214 16341 8981 -1662 -738 27 C ATOM 2811 O ILE D 931 -29.838 9.915 -36.129 1.00 98.53 O ANISOU 2811 O ILE D 931 10755 16898 9785 -1428 -727 86 O ATOM 2812 CB ILE D 931 -29.485 11.409 -39.098 1.00 92.25 C ANISOU 2812 CB ILE D 931 9947 16340 8762 -538 -696 281 C ATOM 2813 CG1 ILE D 931 -28.489 12.384 -39.729 1.00 96.86 C ANISOU 2813 CG1 ILE D 931 10849 16239 9715 156 -591 375 C ATOM 2814 CG2 ILE D 931 -30.559 12.142 -38.308 1.00 94.11 C ANISOU 2814 CG2 ILE D 931 9636 17407 8715 -132 -732 470 C ATOM 2815 CD1 ILE D 931 -29.136 13.436 -40.591 1.00108.92 C ANISOU 2815 CD1 ILE D 931 11982 18497 10907 773 -589 577 C ATOM 2816 N GLY D 932 -30.454 8.623 -37.908 1.00 88.77 N ANISOU 2816 N GLY D 932 9464 16334 7931 -2395 -815 -92 N ATOM 2817 CA GLY D 932 -31.390 7.742 -37.185 1.00 96.79 C ANISOU 2817 CA GLY D 932 10195 17965 8616 -3053 -894 -173 C ATOM 2818 C GLY D 932 -30.765 7.155 -35.929 1.00 92.66 C ANISOU 2818 C GLY D 932 10014 16669 8524 -3269 -807 -281 C ATOM 2819 O GLY D 932 -31.400 7.259 -34.855 1.00 90.40 O ANISOU 2819 O GLY D 932 9401 16780 8168 -3216 -856 -218 O ATOM 2820 N LYS D 933 -29.567 6.569 -36.061 1.00 90.13 N ANISOU 2820 N LYS D 933 10317 15309 8621 -3475 -669 -412 N ATOM 2821 CA LYS D 933 -28.754 6.005 -34.944 1.00 87.18 C ANISOU 2821 CA LYS D 933 10329 14089 8707 -3634 -547 -484 C ATOM 2822 C LYS D 933 -28.410 7.101 -33.927 1.00 87.96 C ANISOU 2822 C LYS D 933 10330 13920 9171 -2886 -549 -325 C ATOM 2823 O LYS D 933 -28.511 6.843 -32.716 1.00 88.78 O ANISOU 2823 O LYS D 933 10379 13949 9403 -2991 -538 -339 O ATOM 2824 CB LYS D 933 -27.442 5.384 -35.440 1.00 79.25 C ANISOU 2824 CB LYS D 933 9997 12037 8076 -3823 -371 -570 C ATOM 2825 CG LYS D 933 -27.593 4.274 -36.472 1.00 86.27 C ANISOU 2825 CG LYS D 933 11143 12995 8641 -4559 -313 -740 C ATOM 2826 CD LYS D 933 -26.435 3.294 -36.512 1.00 87.70 C ANISOU 2826 CD LYS D 933 12020 12142 9161 -4905 -74 -827 C ATOM 2827 CE LYS D 933 -26.334 2.566 -37.840 1.00 89.43 C ANISOU 2827 CE LYS D 933 12599 12267 9112 -5386 15 -951 C ATOM 2828 NZ LYS D 933 -25.024 1.896 -38.030 1.00 80.07 N ANISOU 2828 NZ LYS D 933 12128 9984 8311 -5477 283 -955 N ATOM 2829 N ILE D 934 -27.981 8.267 -34.403 1.00 82.40 N ANISOU 2829 N ILE D 934 9644 13035 8628 -2175 -546 -187 N ATOM 2830 CA ILE D 934 -27.588 9.410 -33.534 1.00 85.69 C ANISOU 2830 CA ILE D 934 10050 13137 9372 -1454 -522 -41 C ATOM 2831 C ILE D 934 -28.817 9.851 -32.726 1.00 86.95 C ANISOU 2831 C ILE D 934 9670 14165 9201 -1273 -609 52 C ATOM 2832 O ILE D 934 -28.679 10.031 -31.495 1.00 92.52 O ANISOU 2832 O ILE D 934 10398 14626 10128 -1127 -585 76 O ATOM 2833 CB ILE D 934 -26.966 10.537 -34.380 1.00 84.29 C ANISOU 2833 CB ILE D 934 10018 12648 9362 -781 -481 81 C ATOM 2834 CG1 ILE D 934 -25.599 10.116 -34.921 1.00 76.72 C ANISOU 2834 CG1 ILE D 934 9625 10713 8813 -915 -379 24 C ATOM 2835 CG2 ILE D 934 -26.883 11.845 -33.600 1.00 83.94 C ANISOU 2835 CG2 ILE D 934 9898 12505 9492 -37 -452 236 C ATOM 2836 CD1 ILE D 934 -25.142 10.918 -36.120 1.00 77.85 C ANISOU 2836 CD1 ILE D 934 9884 10686 9008 -439 -354 112 C ATOM 2837 N GLN D 935 -29.974 9.984 -33.385 1.00 95.58 N ANISOU 2837 N GLN D 935 10291 16259 9766 -1298 -702 118 N ATOM 2838 CA GLN D 935 -31.270 10.384 -32.763 1.00103.61 C ANISOU 2838 CA GLN D 935 10728 18259 10381 -1114 -778 263 C ATOM 2839 C GLN D 935 -31.603 9.457 -31.585 1.00104.40 C ANISOU 2839 C GLN D 935 10763 18416 10488 -1657 -811 159 C ATOM 2840 O GLN D 935 -31.974 9.976 -30.519 1.00111.05 O ANISOU 2840 O GLN D 935 11408 19429 11357 -1304 -806 270 O ATOM 2841 CB GLN D 935 -32.403 10.352 -33.796 1.00105.51 C ANISOU 2841 CB GLN D 935 10473 19607 10009 -1257 -879 349 C ATOM 2842 CG GLN D 935 -32.343 11.495 -34.802 1.00 98.42 C ANISOU 2842 CG GLN D 935 9494 18876 9027 -554 -836 524 C ATOM 2843 CD GLN D 935 -33.342 11.368 -35.928 1.00101.70 C ANISOU 2843 CD GLN D 935 9441 20361 8839 -754 -933 608 C ATOM 2844 OE1 GLN D 935 -33.981 12.339 -36.325 1.00110.79 O ANISOU 2844 OE1 GLN D 935 10200 22204 9693 -146 -915 856 O ATOM 2845 NE2 GLN D 935 -33.471 10.169 -36.471 1.00101.84 N ANISOU 2845 NE2 GLN D 935 9516 20526 8651 -1614 -1019 413 N ATOM 2846 N ASP D 936 -31.491 8.141 -31.781 1.00100.26 N ANISOU 2846 N ASP D 936 10420 17750 9925 -2476 -821 -42 N ATOM 2847 CA ASP D 936 -31.732 7.121 -30.724 1.00100.80 C ANISOU 2847 CA ASP D 936 10485 17800 10015 -3061 -822 -161 C ATOM 2848 C ASP D 936 -30.653 7.241 -29.638 1.00100.64 C ANISOU 2848 C ASP D 936 10867 16795 10577 -2816 -711 -184 C ATOM 2849 O ASP D 936 -30.995 7.046 -28.454 1.00 99.21 O ANISOU 2849 O ASP D 936 10535 16727 10433 -2887 -721 -177 O ATOM 2850 CB ASP D 936 -31.786 5.706 -31.307 1.00105.12 C ANISOU 2850 CB ASP D 936 11226 18342 10371 -3986 -807 -372 C ATOM 2851 CG ASP D 936 -33.152 5.297 -31.845 1.00111.97 C ANISOU 2851 CG ASP D 936 11588 20380 10575 -4473 -946 -367 C ATOM 2852 OD1 ASP D 936 -33.919 6.198 -32.264 1.00113.44 O ANISOU 2852 OD1 ASP D 936 11294 21378 10429 -4023 -1050 -172 O ATOM 2853 OD2 ASP D 936 -33.448 4.075 -31.837 1.00108.84 O ANISOU 2853 OD2 ASP D 936 11282 20097 9975 -5310 -936 -542 O ATOM 2854 N SER D 937 -29.408 7.546 -30.027 1.00 96.04 N ANISOU 2854 N SER D 937 10755 15321 10414 -2548 -614 -195 N ATOM 2855 CA SER D 937 -28.249 7.752 -29.117 1.00 86.67 C ANISOU 2855 CA SER D 937 9958 13196 9776 -2296 -512 -182 C ATOM 2856 C SER D 937 -28.501 8.973 -28.218 1.00 83.93 C ANISOU 2856 C SER D 937 9395 13005 9489 -1614 -543 -30 C ATOM 2857 O SER D 937 -28.246 8.853 -27.001 1.00 78.40 O ANISOU 2857 O SER D 937 8768 12000 9022 -1628 -513 -38 O ATOM 2858 CB SER D 937 -26.960 7.884 -29.895 1.00 80.41 C ANISOU 2858 CB SER D 937 9653 11561 9340 -2149 -414 -182 C ATOM 2859 OG SER D 937 -25.970 7.001 -29.394 1.00 83.59 O ANISOU 2859 OG SER D 937 10473 11178 10108 -2510 -288 -250 O ATOM 2860 N LEU D 938 -29.007 10.081 -28.783 1.00 84.59 N ANISOU 2860 N LEU D 938 9236 13556 9347 -1042 -580 110 N ATOM 2861 CA LEU D 938 -29.256 11.370 -28.065 1.00 77.37 C ANISOU 2861 CA LEU D 938 8186 12766 8445 -314 -556 275 C ATOM 2862 C LEU D 938 -30.442 11.250 -27.105 1.00 87.73 C ANISOU 2862 C LEU D 938 9052 14838 9442 -369 -613 335 C ATOM 2863 O LEU D 938 -30.472 12.022 -26.115 1.00 93.82 O ANISOU 2863 O LEU D 938 9830 15504 10314 93 -564 430 O ATOM 2864 CB LEU D 938 -29.517 12.498 -29.066 1.00 79.09 C ANISOU 2864 CB LEU D 938 8283 13306 8460 303 -532 426 C ATOM 2865 CG LEU D 938 -28.373 13.492 -29.247 1.00 84.44 C ANISOU 2865 CG LEU D 938 9399 13155 9530 850 -427 474 C ATOM 2866 CD1 LEU D 938 -27.068 12.800 -29.622 1.00 79.86 C ANISOU 2866 CD1 LEU D 938 9288 11689 9367 467 -406 341 C ATOM 2867 CD2 LEU D 938 -28.739 14.523 -30.296 1.00 82.06 C ANISOU 2867 CD2 LEU D 938 8953 13242 8985 1436 -382 625 C ATOM 2868 N SER D 939 -31.404 10.372 -27.415 1.00 88.70 N ANISOU 2868 N SER D 939 8809 15723 9170 -902 -705 293 N ATOM 2869 CA SER D 939 -32.594 10.095 -26.566 1.00 93.55 C ANISOU 2869 CA SER D 939 8954 17143 9447 -1053 -774 361 C ATOM 2870 C SER D 939 -32.175 9.238 -25.362 1.00 87.56 C ANISOU 2870 C SER D 939 8396 15877 8994 -1485 -754 218 C ATOM 2871 O SER D 939 -32.614 9.550 -24.238 1.00 93.41 O ANISOU 2871 O SER D 939 8959 16814 9720 -1249 -753 303 O ATOM 2872 CB SER D 939 -33.716 9.460 -27.362 1.00 97.80 C ANISOU 2872 CB SER D 939 9035 18684 9439 -1522 -885 376 C ATOM 2873 OG SER D 939 -34.425 10.435 -28.121 1.00 99.43 O ANISOU 2873 OG SER D 939 8883 19624 9273 -977 -900 599 O ATOM 2874 N SER D 940 -31.344 8.214 -25.583 1.00 79.22 N ANISOU 2874 N SER D 940 7715 14186 8200 -2059 -715 28 N ATOM 2875 CA SER D 940 -30.788 7.334 -24.521 1.00 78.89 C ANISOU 2875 CA SER D 940 7917 13578 8480 -2467 -653 -94 C ATOM 2876 C SER D 940 -29.914 8.153 -23.557 1.00 80.68 C ANISOU 2876 C SER D 940 8409 13109 9137 -1933 -586 -28 C ATOM 2877 O SER D 940 -29.948 7.874 -22.337 1.00 68.97 O ANISOU 2877 O SER D 940 6897 11526 7783 -2023 -571 -41 O ATOM 2878 CB SER D 940 -30.008 6.196 -25.112 1.00 79.45 C ANISOU 2878 CB SER D 940 8384 13080 8723 -3080 -570 -263 C ATOM 2879 OG SER D 940 -30.764 5.540 -26.111 1.00 80.75 O ANISOU 2879 OG SER D 940 8366 13852 8462 -3576 -625 -336 O ATOM 2880 N THR D 941 -29.140 9.112 -24.082 1.00 75.34 N ANISOU 2880 N THR D 941 7994 11965 8666 -1426 -545 40 N ATOM 2881 CA THR D 941 -28.283 10.031 -23.281 1.00 75.50 C ANISOU 2881 CA THR D 941 8298 11339 9051 -922 -483 108 C ATOM 2882 C THR D 941 -29.197 10.853 -22.365 1.00 81.37 C ANISOU 2882 C THR D 941 8735 12606 9575 -474 -505 227 C ATOM 2883 O THR D 941 -28.984 10.821 -21.134 1.00 71.00 O ANISOU 2883 O THR D 941 7498 11031 8447 -470 -483 217 O ATOM 2884 CB THR D 941 -27.386 10.898 -24.177 1.00 76.31 C ANISOU 2884 CB THR D 941 8720 10926 9350 -505 -434 162 C ATOM 2885 OG1 THR D 941 -26.574 10.025 -24.961 1.00 77.79 O ANISOU 2885 OG1 THR D 941 9187 10644 9727 -942 -399 69 O ATOM 2886 CG2 THR D 941 -26.481 11.830 -23.401 1.00 76.01 C ANISOU 2886 CG2 THR D 941 9000 10227 9653 -66 -371 225 C ATOM 2887 N ALA D 942 -30.197 11.521 -22.954 1.00 86.24 N ANISOU 2887 N ALA D 942 9012 13967 9789 -113 -534 353 N ATOM 2888 CA ALA D 942 -31.204 12.361 -22.258 1.00 91.15 C ANISOU 2888 CA ALA D 942 9316 15199 10117 395 -518 523 C ATOM 2889 C ALA D 942 -31.913 11.554 -21.168 1.00 87.68 C ANISOU 2889 C ALA D 942 8594 15156 9566 17 -576 495 C ATOM 2890 O ALA D 942 -32.165 12.129 -20.095 1.00 91.63 O ANISOU 2890 O ALA D 942 9066 15681 10069 381 -531 583 O ATOM 2891 CB ALA D 942 -32.206 12.905 -23.245 1.00 95.72 C ANISOU 2891 CB ALA D 942 9513 16625 10230 719 -531 688 C ATOM 2892 N SER D 943 -32.251 10.289 -21.452 1.00 81.47 N ANISOU 2892 N SER D 943 7621 14673 8661 -684 -657 378 N ATOM 2893 CA SER D 943 -32.855 9.340 -20.480 1.00 82.28 C ANISOU 2893 CA SER D 943 7481 15102 8678 -1154 -705 324 C ATOM 2894 C SER D 943 -31.904 9.194 -19.288 1.00 76.15 C ANISOU 2894 C SER D 943 7065 13505 8362 -1180 -638 239 C ATOM 2895 O SER D 943 -32.303 9.579 -18.181 1.00 84.42 O ANISOU 2895 O SER D 943 7987 14705 9383 -907 -628 320 O ATOM 2896 CB SER D 943 -33.181 8.010 -21.124 1.00 85.46 C ANISOU 2896 CB SER D 943 7754 15814 8903 -1948 -766 186 C ATOM 2897 OG SER D 943 -33.672 7.077 -20.170 1.00 91.04 O ANISOU 2897 OG SER D 943 8279 16752 9560 -2417 -788 124 O ATOM 2898 N ALA D 944 -30.676 8.720 -19.529 1.00 75.03 N ANISOU 2898 N ALA D 944 7358 12540 8610 -1455 -582 108 N ATOM 2899 CA ALA D 944 -29.645 8.471 -18.494 1.00 67.44 C ANISOU 2899 CA ALA D 944 6736 10802 8087 -1543 -511 48 C ATOM 2900 C ALA D 944 -29.463 9.733 -17.629 1.00 68.05 C ANISOU 2900 C ALA D 944 6912 10677 8265 -901 -487 158 C ATOM 2901 O ALA D 944 -29.547 9.619 -16.390 1.00 71.30 O ANISOU 2901 O ALA D 944 7286 11043 8761 -913 -477 160 O ATOM 2902 CB ALA D 944 -28.360 8.020 -19.155 1.00 69.15 C ANISOU 2902 CB ALA D 944 7384 10244 8645 -1792 -438 -31 C ATOM 2903 N LEU D 945 -29.271 10.903 -18.248 1.00 67.13 N ANISOU 2903 N LEU D 945 6930 10462 8115 -359 -461 246 N ATOM 2904 CA LEU D 945 -29.045 12.190 -17.531 1.00 74.33 C ANISOU 2904 CA LEU D 945 8036 11111 9096 256 -398 342 C ATOM 2905 C LEU D 945 -30.252 12.544 -16.656 1.00 80.33 C ANISOU 2905 C LEU D 945 8457 12532 9531 538 -399 449 C ATOM 2906 O LEU D 945 -30.055 13.203 -15.610 1.00 82.60 O ANISOU 2906 O LEU D 945 8927 12544 9912 850 -339 487 O ATOM 2907 CB LEU D 945 -28.782 13.307 -18.543 1.00 76.61 C ANISOU 2907 CB LEU D 945 8507 11265 9335 762 -344 423 C ATOM 2908 CG LEU D 945 -27.441 13.227 -19.266 1.00 79.82 C ANISOU 2908 CG LEU D 945 9317 10908 10102 614 -325 353 C ATOM 2909 CD1 LEU D 945 -27.412 14.189 -20.441 1.00 83.22 C ANISOU 2909 CD1 LEU D 945 9834 11367 10417 1075 -279 433 C ATOM 2910 CD2 LEU D 945 -26.286 13.508 -18.313 1.00 69.44 C ANISOU 2910 CD2 LEU D 945 8403 8814 9166 626 -281 329 C ATOM 2911 N GLY D 946 -31.457 12.173 -17.090 1.00 86.47 N ANISOU 2911 N GLY D 946 8767 14171 9917 445 -457 516 N ATOM 2912 CA GLY D 946 -32.686 12.374 -16.304 1.00 89.65 C ANISOU 2912 CA GLY D 946 8780 15305 9978 678 -461 657 C ATOM 2913 C GLY D 946 -32.657 11.530 -15.045 1.00 86.56 C ANISOU 2913 C GLY D 946 8346 14793 9750 282 -495 566 C ATOM 2914 O GLY D 946 -32.880 12.081 -13.945 1.00 96.48 O ANISOU 2914 O GLY D 946 9629 16036 10992 628 -442 643 O ATOM 2915 N LYS D 947 -32.385 10.236 -15.205 1.00 86.49 N ANISOU 2915 N LYS D 947 8302 14680 9881 -411 -556 411 N ATOM 2916 CA LYS D 947 -32.418 9.241 -14.108 1.00 85.05 C ANISOU 2916 CA LYS D 947 8041 14440 9834 -860 -573 323 C ATOM 2917 C LYS D 947 -31.316 9.590 -13.099 1.00 85.16 C ANISOU 2917 C LYS D 947 8467 13634 10255 -705 -504 279 C ATOM 2918 O LYS D 947 -31.588 9.465 -11.884 1.00 80.43 O ANISOU 2918 O LYS D 947 7775 13105 9678 -690 -498 296 O ATOM 2919 CB LYS D 947 -32.281 7.823 -14.672 1.00 81.77 C ANISOU 2919 CB LYS D 947 7588 14017 9465 -1617 -599 172 C ATOM 2920 CG LYS D 947 -33.452 7.334 -15.516 1.00 86.82 C ANISOU 2920 CG LYS D 947 7794 15540 9653 -1908 -682 200 C ATOM 2921 CD LYS D 947 -33.205 5.943 -16.059 1.00 88.20 C ANISOU 2921 CD LYS D 947 8053 15583 9877 -2693 -670 23 C ATOM 2922 CE LYS D 947 -34.380 5.322 -16.781 1.00 83.53 C ANISOU 2922 CE LYS D 947 7044 15887 8808 -3122 -759 28 C ATOM 2923 NZ LYS D 947 -33.987 4.035 -17.404 1.00 84.01 N ANISOU 2923 NZ LYS D 947 7393 15600 8927 -3821 -686 -160 N ATOM 2924 N LEU D 948 -30.143 10.032 -13.581 1.00 76.60 N ANISOU 2924 N LEU D 948 7803 11845 9458 -595 -459 239 N ATOM 2925 CA LEU D 948 -29.020 10.502 -12.719 1.00 78.61 C ANISOU 2925 CA LEU D 948 8460 11344 10066 -446 -403 222 C ATOM 2926 C LEU D 948 -29.496 11.716 -11.914 1.00 78.54 C ANISOU 2926 C LEU D 948 8476 11476 9891 150 -366 328 C ATOM 2927 O LEU D 948 -29.426 11.633 -10.667 1.00 84.95 O ANISOU 2927 O LEU D 948 9320 12160 10796 124 -354 319 O ATOM 2928 CB LEU D 948 -27.763 10.789 -13.554 1.00 61.15 C ANISOU 2928 CB LEU D 948 6648 8453 8132 -440 -369 194 C ATOM 2929 CG LEU D 948 -26.984 9.537 -13.972 1.00 54.69 C ANISOU 2929 CG LEU D 948 5932 7279 7569 -1028 -351 108 C ATOM 2930 CD1 LEU D 948 -25.862 9.845 -14.948 1.00 53.51 C ANISOU 2930 CD1 LEU D 948 6135 6552 7644 -975 -316 118 C ATOM 2931 CD2 LEU D 948 -26.423 8.812 -12.765 1.00 55.48 C ANISOU 2931 CD2 LEU D 948 6103 7051 7926 -1339 -311 81 C ATOM 2932 N GLN D 949 -30.034 12.747 -12.582 1.00 80.02 N ANISOU 2932 N GLN D 949 8639 11955 9811 666 -329 437 N ATOM 2933 CA GLN D 949 -30.563 13.981 -11.931 1.00 89.44 C ANISOU 2933 CA GLN D 949 9907 13290 10785 1307 -235 568 C ATOM 2934 C GLN D 949 -31.545 13.607 -10.814 1.00 86.40 C ANISOU 2934 C GLN D 949 9190 13428 10210 1291 -252 625 C ATOM 2935 O GLN D 949 -31.388 14.140 -9.696 1.00 88.02 O ANISOU 2935 O GLN D 949 9611 13366 10465 1527 -187 642 O ATOM 2936 CB GLN D 949 -31.267 14.910 -12.927 1.00100.31 C ANISOU 2936 CB GLN D 949 11186 15106 11821 1843 -163 719 C ATOM 2937 CG GLN D 949 -31.851 16.166 -12.275 1.00 98.94 C ANISOU 2937 CG GLN D 949 11131 15073 11388 2546 -6 885 C ATOM 2938 CD GLN D 949 -32.517 17.129 -13.232 1.00 91.71 C ANISOU 2938 CD GLN D 949 10140 14582 10125 3144 117 1075 C ATOM 2939 OE1 GLN D 949 -33.039 16.747 -14.280 1.00 91.12 O ANISOU 2939 OE1 GLN D 949 9705 15051 9867 3043 50 1130 O ATOM 2940 NE2 GLN D 949 -32.531 18.399 -12.856 1.00 87.06 N ANISOU 2940 NE2 GLN D 949 9903 13763 9413 3778 318 1187 N ATOM 2941 N ASP D 950 -32.531 12.751 -11.119 1.00 89.24 N ANISOU 2941 N ASP D 950 9054 14518 10335 1015 -334 660 N ATOM 2942 CA ASP D 950 -33.592 12.315 -10.169 1.00 91.47 C ANISOU 2942 CA ASP D 950 8943 15414 10397 974 -362 740 C ATOM 2943 C ASP D 950 -32.907 11.713 -8.934 1.00 87.02 C ANISOU 2943 C ASP D 950 8557 14336 10171 640 -375 608 C ATOM 2944 O ASP D 950 -33.057 12.276 -7.824 1.00 88.69 O ANISOU 2944 O ASP D 950 8870 14474 10354 969 -314 669 O ATOM 2945 CB ASP D 950 -34.582 11.343 -10.831 1.00 96.40 C ANISOU 2945 CB ASP D 950 9033 16851 10745 572 -466 770 C ATOM 2946 CG ASP D 950 -35.460 11.937 -11.934 1.00101.43 C ANISOU 2946 CG ASP D 950 9386 18190 10964 923 -460 954 C ATOM 2947 OD1 ASP D 950 -35.464 13.189 -12.099 1.00106.32 O ANISOU 2947 OD1 ASP D 950 10196 18729 11471 1591 -341 1094 O ATOM 2948 OD2 ASP D 950 -36.144 11.141 -12.629 1.00 96.96 O ANISOU 2948 OD2 ASP D 950 8413 18263 10163 516 -559 963 O ATOM 2949 N VAL D 951 -32.129 10.649 -9.136 1.00 80.67 N ANISOU 2949 N VAL D 951 7825 13158 9667 37 -426 447 N ATOM 2950 CA VAL D 951 -31.511 9.862 -8.032 1.00 77.21 C ANISOU 2950 CA VAL D 951 7485 12315 9536 -343 -424 345 C ATOM 2951 C VAL D 951 -30.547 10.764 -7.259 1.00 82.36 C ANISOU 2951 C VAL D 951 8583 12293 10417 -37 -363 340 C ATOM 2952 O VAL D 951 -30.594 10.705 -6.025 1.00 91.50 O ANISOU 2952 O VAL D 951 9739 13398 11627 -20 -349 343 O ATOM 2953 CB VAL D 951 -30.820 8.583 -8.540 1.00 69.24 C ANISOU 2953 CB VAL D 951 6514 11016 8779 -998 -435 210 C ATOM 2954 CG1 VAL D 951 -30.085 7.854 -7.425 1.00 61.24 C ANISOU 2954 CG1 VAL D 951 5625 9559 8085 -1318 -393 145 C ATOM 2955 CG2 VAL D 951 -31.817 7.651 -9.212 1.00 64.44 C ANISOU 2955 CG2 VAL D 951 5502 11080 7902 -1380 -487 194 C ATOM 2956 N VAL D 952 -29.714 11.568 -7.928 1.00 71.15 N ANISOU 2956 N VAL D 952 7533 10389 9111 176 -328 333 N ATOM 2957 CA VAL D 952 -28.748 12.460 -7.215 1.00 74.89 C ANISOU 2957 CA VAL D 952 8465 10214 9774 404 -272 324 C ATOM 2958 C VAL D 952 -29.539 13.315 -6.219 1.00 81.70 C ANISOU 2958 C VAL D 952 9333 11331 10380 879 -211 409 C ATOM 2959 O VAL D 952 -29.145 13.349 -5.034 1.00 83.35 O ANISOU 2959 O VAL D 952 9700 11255 10713 822 -197 378 O ATOM 2960 CB VAL D 952 -27.906 13.338 -8.165 1.00 74.80 C ANISOU 2960 CB VAL D 952 8838 9729 9854 617 -234 325 C ATOM 2961 CG1 VAL D 952 -27.189 14.452 -7.414 1.00 71.81 C ANISOU 2961 CG1 VAL D 952 8924 8813 9546 903 -163 332 C ATOM 2962 CG2 VAL D 952 -26.894 12.521 -8.956 1.00 67.43 C ANISOU 2962 CG2 VAL D 952 7985 8411 9226 156 -274 258 C ATOM 2963 N ASN D 953 -30.627 13.942 -6.685 1.00 87.33 N ANISOU 2963 N ASN D 953 9864 12588 10728 1331 -163 533 N ATOM 2964 CA ASN D 953 -31.443 14.939 -5.930 1.00 89.89 C ANISOU 2964 CA ASN D 953 10245 13166 10745 1918 -47 667 C ATOM 2965 C ASN D 953 -32.199 14.253 -4.773 1.00 87.48 C ANISOU 2965 C ASN D 953 9603 13275 10359 1787 -86 697 C ATOM 2966 O ASN D 953 -32.365 14.910 -3.726 1.00 89.75 O ANISOU 2966 O ASN D 953 10091 13459 10551 2118 5 748 O ATOM 2967 CB ASN D 953 -32.403 15.708 -6.852 1.00 88.41 C ANISOU 2967 CB ASN D 953 9908 13513 10172 2453 42 843 C ATOM 2968 CG ASN D 953 -31.737 16.713 -7.778 1.00 85.27 C ANISOU 2968 CG ASN D 953 9925 12670 9804 2762 139 844 C ATOM 2969 OD1 ASN D 953 -30.719 17.315 -7.454 1.00 79.47 O ANISOU 2969 OD1 ASN D 953 9700 11218 9276 2791 196 755 O ATOM 2970 ND2 ASN D 953 -32.320 16.921 -8.944 1.00 86.27 N ANISOU 2970 ND2 ASN D 953 9829 13248 9703 2990 162 955 N ATOM 2971 N GLN D 954 -32.648 12.999 -4.948 1.00 90.36 N ANISOU 2971 N GLN D 954 9507 14079 10748 1321 -201 667 N ATOM 2972 CA GLN D 954 -33.300 12.176 -3.884 1.00 87.70 C ANISOU 2972 CA GLN D 954 8828 14120 10375 1106 -246 681 C ATOM 2973 C GLN D 954 -32.305 11.881 -2.760 1.00 86.90 C ANISOU 2973 C GLN D 954 9006 13395 10617 841 -248 554 C ATOM 2974 O GLN D 954 -32.703 11.963 -1.588 1.00 90.85 O ANISOU 2974 O GLN D 954 9459 14010 11048 987 -220 598 O ATOM 2975 CB GLN D 954 -33.801 10.835 -4.417 1.00 89.83 C ANISOU 2975 CB GLN D 954 8627 14878 10625 559 -353 641 C ATOM 2976 CG GLN D 954 -35.068 10.950 -5.247 1.00102.13 C ANISOU 2976 CG GLN D 954 9759 17285 11761 754 -376 803 C ATOM 2977 CD GLN D 954 -35.466 9.632 -5.862 1.00102.59 C ANISOU 2977 CD GLN D 954 9421 17776 11782 122 -481 735 C ATOM 2978 OE1 GLN D 954 -35.071 8.562 -5.402 1.00103.01 O ANISOU 2978 OE1 GLN D 954 9456 17604 12078 -413 -511 596 O ATOM 2979 NE2 GLN D 954 -36.255 9.708 -6.920 1.00102.61 N ANISOU 2979 NE2 GLN D 954 9121 18410 11455 173 -520 842 N ATOM 2980 N ASN D 955 -31.074 11.519 -3.124 1.00 79.91 N ANISOU 2980 N ASN D 955 8375 11915 10072 467 -275 426 N ATOM 2981 CA ASN D 955 -29.968 11.195 -2.183 1.00 79.02 C ANISOU 2981 CA ASN D 955 8512 11219 10294 173 -274 336 C ATOM 2982 C ASN D 955 -29.503 12.483 -1.485 1.00 74.61 C ANISOU 2982 C ASN D 955 8409 10240 9701 576 -206 354 C ATOM 2983 O ASN D 955 -29.183 12.416 -0.282 1.00 75.05 O ANISOU 2983 O ASN D 955 8564 10097 9854 495 -198 330 O ATOM 2984 CB ASN D 955 -28.824 10.459 -2.892 1.00 79.78 C ANISOU 2984 CB ASN D 955 8727 10866 10718 -300 -298 251 C ATOM 2985 CG ASN D 955 -29.177 9.033 -3.271 1.00 72.10 C ANISOU 2985 CG ASN D 955 7389 10208 9798 -785 -323 211 C ATOM 2986 OD1 ASN D 955 -30.275 8.556 -2.977 1.00 64.42 O ANISOU 2986 OD1 ASN D 955 6046 9810 8622 -819 -344 237 O ATOM 2987 ND2 ASN D 955 -28.249 8.344 -3.923 1.00 67.76 N ANISOU 2987 ND2 ASN D 955 6964 9280 9503 -1170 -303 159 N ATOM 2988 N ALA D 956 -29.479 13.616 -2.194 1.00 66.97 N ANISOU 2988 N ALA D 956 7725 9141 8580 986 -142 395 N ATOM 2989 CA ALA D 956 -29.174 14.944 -1.616 1.00 75.72 C ANISOU 2989 CA ALA D 956 9327 9864 9580 1399 -35 413 C ATOM 2990 C ALA D 956 -30.203 15.300 -0.532 1.00 83.85 C ANISOU 2990 C ALA D 956 10274 11257 10327 1768 41 500 C ATOM 2991 O ALA D 956 -29.777 15.766 0.544 1.00 97.00 O ANISOU 2991 O ALA D 956 12274 12566 12015 1814 89 463 O ATOM 2992 CB ALA D 956 -29.139 15.988 -2.698 1.00 76.83 C ANISOU 2992 CB ALA D 956 9738 9879 9573 1790 52 458 C ATOM 2993 N GLN D 957 -31.498 15.085 -0.793 1.00 81.16 N ANISOU 2993 N GLN D 957 9506 11619 9714 2007 53 626 N ATOM 2994 CA GLN D 957 -32.602 15.404 0.156 1.00 82.01 C ANISOU 2994 CA GLN D 957 9480 12163 9516 2416 139 762 C ATOM 2995 C GLN D 957 -32.578 14.443 1.350 1.00 80.13 C ANISOU 2995 C GLN D 957 9018 11979 9447 2039 51 699 C ATOM 2996 O GLN D 957 -32.748 14.923 2.490 1.00 82.11 O ANISOU 2996 O GLN D 957 9467 12138 9594 2286 131 730 O ATOM 2997 CB GLN D 957 -33.961 15.331 -0.539 1.00 94.39 C ANISOU 2997 CB GLN D 957 10572 14550 10741 2721 159 953 C ATOM 2998 CG GLN D 957 -34.210 16.471 -1.517 1.00101.65 C ANISOU 2998 CG GLN D 957 11708 15514 11401 3268 304 1080 C ATOM 2999 CD GLN D 957 -35.622 16.437 -2.051 1.00100.15 C ANISOU 2999 CD GLN D 957 11003 16232 10818 3610 337 1325 C ATOM 3000 OE1 GLN D 957 -36.506 15.807 -1.473 1.00 84.78 O ANISOU 3000 OE1 GLN D 957 8612 14866 8736 3553 284 1426 O ATOM 3001 NE2 GLN D 957 -35.840 17.109 -3.171 1.00103.86 N ANISOU 3001 NE2 GLN D 957 11508 16864 11090 3963 427 1440 N ATOM 3002 N ALA D 958 -32.405 13.141 1.097 1.00 71.38 N ANISOU 3002 N ALA D 958 7535 11015 8571 1479 -82 619 N ATOM 3003 CA ALA D 958 -32.267 12.091 2.135 1.00 75.12 C ANISOU 3003 CA ALA D 958 7790 11503 9248 1067 -148 555 C ATOM 3004 C ALA D 958 -31.173 12.497 3.130 1.00 77.81 C ANISOU 3004 C ALA D 958 8579 11195 9791 997 -121 467 C ATOM 3005 O ALA D 958 -31.406 12.332 4.336 1.00 77.45 O ANISOU 3005 O ALA D 958 8478 11220 9729 1016 -109 479 O ATOM 3006 CB ALA D 958 -31.971 10.750 1.507 1.00 63.92 C ANISOU 3006 CB ALA D 958 6062 10158 8068 471 -240 471 C ATOM 3007 N LEU D 959 -30.042 13.022 2.641 1.00 62.26 N ANISOU 3007 N LEU D 959 7026 8647 7983 911 -114 393 N ATOM 3008 CA LEU D 959 -28.884 13.453 3.477 1.00 63.19 C ANISOU 3008 CA LEU D 959 7583 8157 8270 774 -102 319 C ATOM 3009 C LEU D 959 -29.268 14.699 4.281 1.00 80.25 C ANISOU 3009 C LEU D 959 10128 10224 10140 1265 14 356 C ATOM 3010 O LEU D 959 -28.928 14.759 5.479 1.00 87.55 O ANISOU 3010 O LEU D 959 11216 10952 11098 1172 20 320 O ATOM 3011 CB LEU D 959 -27.662 13.719 2.589 1.00 71.67 C ANISOU 3011 CB LEU D 959 8970 8712 9550 564 -124 263 C ATOM 3012 CG LEU D 959 -26.378 14.153 3.306 1.00 68.42 C ANISOU 3012 CG LEU D 959 8986 7716 9296 350 -129 212 C ATOM 3013 CD1 LEU D 959 -26.102 13.328 4.554 1.00 66.94 C ANISOU 3013 CD1 LEU D 959 8612 7563 9261 21 -172 204 C ATOM 3014 CD2 LEU D 959 -25.182 14.070 2.373 1.00 57.55 C ANISOU 3014 CD2 LEU D 959 7771 5930 8165 53 -172 195 C ATOM 3015 N ASN D 960 -29.969 15.652 3.661 1.00 82.58 N ANISOU 3015 N ASN D 960 10574 10664 10138 1782 125 437 N ATOM 3016 CA ASN D 960 -30.387 16.931 4.308 1.00 85.87 C ANISOU 3016 CA ASN D 960 11439 10959 10228 2326 303 496 C ATOM 3017 C ASN D 960 -31.446 16.667 5.394 1.00 87.49 C ANISOU 3017 C ASN D 960 11378 11622 10242 2550 340 593 C ATOM 3018 O ASN D 960 -31.337 17.316 6.455 1.00 95.78 O ANISOU 3018 O ASN D 960 12823 12403 11167 2722 440 577 O ATOM 3019 CB ASN D 960 -30.860 17.965 3.283 1.00 83.29 C ANISOU 3019 CB ASN D 960 11331 10686 9630 2855 455 595 C ATOM 3020 CG ASN D 960 -29.729 18.520 2.438 1.00 80.79 C ANISOU 3020 CG ASN D 960 11436 9792 9467 2709 458 497 C ATOM 3021 OD1 ASN D 960 -28.695 18.940 2.960 1.00 79.62 O ANISOU 3021 OD1 ASN D 960 11751 9064 9436 2485 461 385 O ATOM 3022 ND2 ASN D 960 -29.907 18.521 1.127 1.00 83.03 N ANISOU 3022 ND2 ASN D 960 11553 10252 9742 2812 451 545 N ATOM 3023 N THR D 961 -32.411 15.760 5.157 1.00 79.65 N ANISOU 3023 N THR D 961 9764 11287 9214 2525 267 689 N ATOM 3024 CA THR D 961 -33.416 15.291 6.163 1.00 76.64 C ANISOU 3024 CA THR D 961 9023 11406 8690 2659 273 793 C ATOM 3025 C THR D 961 -32.702 14.592 7.330 1.00 81.33 C ANISOU 3025 C THR D 961 9621 11722 9560 2209 183 663 C ATOM 3026 O THR D 961 -33.040 14.878 8.507 1.00 79.25 O ANISOU 3026 O THR D 961 9478 11474 9159 2426 252 702 O ATOM 3027 CB THR D 961 -34.442 14.321 5.552 1.00 74.79 C ANISOU 3027 CB THR D 961 8096 11926 8394 2570 183 904 C ATOM 3028 OG1 THR D 961 -35.161 14.978 4.507 1.00 81.60 O ANISOU 3028 OG1 THR D 961 8907 13136 8961 3007 268 1059 O ATOM 3029 CG2 THR D 961 -35.423 13.779 6.570 1.00 68.35 C ANISOU 3029 CG2 THR D 961 6889 11629 7452 2660 177 1017 C ATOM 3030 N LEU D 962 -31.780 13.681 7.006 1.00 66.72 N ANISOU 3030 N LEU D 962 7629 9654 8067 1625 51 538 N ATOM 3031 CA LEU D 962 -30.938 12.971 7.996 1.00 71.29 C ANISOU 3031 CA LEU D 962 8199 9958 8930 1171 -19 440 C ATOM 3032 C LEU D 962 -30.211 14.020 8.843 1.00 71.41 C ANISOU 3032 C LEU D 962 8812 9445 8876 1293 49 385 C ATOM 3033 O LEU D 962 -30.311 13.935 10.072 1.00 88.05 O ANISOU 3033 O LEU D 962 10937 11568 10951 1297 63 383 O ATOM 3034 CB LEU D 962 -29.962 12.026 7.284 1.00 72.62 C ANISOU 3034 CB LEU D 962 8220 9918 9454 608 -115 358 C ATOM 3035 CG LEU D 962 -28.938 11.336 8.185 1.00 69.76 C ANISOU 3035 CG LEU D 962 7865 9256 9383 156 -157 300 C ATOM 3036 CD1 LEU D 962 -29.621 10.474 9.239 1.00 66.59 C ANISOU 3036 CD1 LEU D 962 7070 9239 8993 92 -161 334 C ATOM 3037 CD2 LEU D 962 -27.965 10.516 7.356 1.00 55.80 C ANISOU 3037 CD2 LEU D 962 6008 7264 7930 -313 -202 266 C ATOM 3038 N VAL D 963 -29.521 14.980 8.223 1.00 77.79 N ANISOU 3038 N VAL D 963 10106 9806 9643 1375 97 338 N ATOM 3039 CA VAL D 963 -28.705 15.983 8.977 1.00 88.95 C ANISOU 3039 CA VAL D 963 12150 10671 10977 1386 162 264 C ATOM 3040 C VAL D 963 -29.616 16.711 9.978 1.00 93.72 C ANISOU 3040 C VAL D 963 12975 11402 11233 1873 307 324 C ATOM 3041 O VAL D 963 -29.178 16.892 11.137 1.00 99.46 O ANISOU 3041 O VAL D 963 13964 11886 11940 1735 315 264 O ATOM 3042 CB VAL D 963 -27.954 16.976 8.061 1.00 85.39 C ANISOU 3042 CB VAL D 963 12207 9746 10490 1437 215 216 C ATOM 3043 CG1 VAL D 963 -27.541 18.242 8.813 1.00 85.82 C ANISOU 3043 CG1 VAL D 963 12976 9324 10309 1592 345 158 C ATOM 3044 CG2 VAL D 963 -26.745 16.328 7.399 1.00 76.40 C ANISOU 3044 CG2 VAL D 963 10962 8356 9712 893 75 160 C ATOM 3045 N LYS D 964 -30.822 17.112 9.554 1.00 96.32 N ANISOU 3045 N LYS D 964 13202 12115 11279 2423 428 457 N ATOM 3046 CA LYS D 964 -31.777 17.877 10.405 1.00 94.45 C ANISOU 3046 CA LYS D 964 13199 12021 10668 2989 616 567 C ATOM 3047 C LYS D 964 -32.122 17.022 11.631 1.00 91.74 C ANISOU 3047 C LYS D 964 12494 11962 10401 2830 536 580 C ATOM 3048 O LYS D 964 -31.889 17.495 12.762 1.00 92.95 O ANISOU 3048 O LYS D 964 13040 11833 10443 2874 608 533 O ATOM 3049 CB LYS D 964 -33.044 18.277 9.635 1.00 97.17 C ANISOU 3049 CB LYS D 964 13359 12855 10705 3603 757 773 C ATOM 3050 CG LYS D 964 -32.910 19.444 8.662 1.00105.76 C ANISOU 3050 CG LYS D 964 14935 13654 11596 3971 932 804 C ATOM 3051 CD LYS D 964 -34.206 19.699 7.917 1.00108.79 C ANISOU 3051 CD LYS D 964 15021 14643 11672 4572 1067 1053 C ATOM 3052 CE LYS D 964 -34.123 20.759 6.839 1.00105.96 C ANISOU 3052 CE LYS D 964 15065 14066 11128 4958 1252 1110 C ATOM 3053 NZ LYS D 964 -35.478 21.209 6.442 1.00100.43 N ANISOU 3053 NZ LYS D 964 14158 13973 10026 5677 1458 1414 N ATOM 3054 N GLN D 965 -32.622 15.802 11.407 1.00 84.18 N ANISOU 3054 N GLN D 965 10839 11523 9621 2622 399 633 N ATOM 3055 CA GLN D 965 -33.082 14.875 12.480 1.00 86.71 C ANISOU 3055 CA GLN D 965 10733 12191 10021 2488 331 666 C ATOM 3056 C GLN D 965 -31.914 14.497 13.414 1.00 89.27 C ANISOU 3056 C GLN D 965 11218 12092 10609 1987 244 513 C ATOM 3057 O GLN D 965 -32.173 14.270 14.607 1.00 83.83 O ANISOU 3057 O GLN D 965 10461 11507 9884 2018 255 531 O ATOM 3058 CB GLN D 965 -33.765 13.659 11.855 1.00 82.52 C ANISOU 3058 CB GLN D 965 9476 12258 9621 2298 217 738 C ATOM 3059 CG GLN D 965 -35.140 13.986 11.297 1.00 95.91 C ANISOU 3059 CG GLN D 965 10921 14543 10977 2826 303 946 C ATOM 3060 CD GLN D 965 -35.703 12.871 10.452 1.00 94.78 C ANISOU 3060 CD GLN D 965 10119 14963 10929 2548 179 995 C ATOM 3061 OE1 GLN D 965 -35.482 11.691 10.715 1.00 89.78 O ANISOU 3061 OE1 GLN D 965 9124 14427 10563 2055 64 915 O ATOM 3062 NE2 GLN D 965 -36.455 13.244 9.430 1.00 90.82 N ANISOU 3062 NE2 GLN D 965 9473 14852 10183 2862 222 1138 N ATOM 3063 N LEU D 966 -30.677 14.444 12.907 1.00 81.94 N ANISOU 3063 N LEU D 966 10480 10732 9920 1556 165 392 N ATOM 3064 CA LEU D 966 -29.451 14.174 13.710 1.00 79.15 C ANISOU 3064 CA LEU D 966 10287 9999 9788 1071 89 287 C ATOM 3065 C LEU D 966 -29.160 15.357 14.645 1.00 78.83 C ANISOU 3065 C LEU D 966 10896 9569 9485 1249 189 236 C ATOM 3066 O LEU D 966 -28.864 15.114 15.835 1.00 78.30 O ANISOU 3066 O LEU D 966 10842 9460 9447 1061 161 206 O ATOM 3067 CB LEU D 966 -28.271 13.905 12.769 1.00 84.67 C ANISOU 3067 CB LEU D 966 11022 10386 10764 628 0 225 C ATOM 3068 CG LEU D 966 -28.282 12.548 12.058 1.00 82.12 C ANISOU 3068 CG LEU D 966 10110 10352 10739 308 -86 256 C ATOM 3069 CD1 LEU D 966 -27.027 12.373 11.222 1.00 64.56 C ANISOU 3069 CD1 LEU D 966 7999 7764 8768 -92 -144 219 C ATOM 3070 CD2 LEU D 966 -28.405 11.395 13.040 1.00 85.70 C ANISOU 3070 CD2 LEU D 966 10129 11072 11362 62 -120 283 C ATOM 3071 N SER D 967 -29.238 16.587 14.131 1.00 85.89 N ANISOU 3071 N SER D 967 12332 10185 10118 1591 318 225 N ATOM 3072 CA SER D 967 -29.079 17.845 14.911 1.00 83.67 C ANISOU 3072 CA SER D 967 12784 9494 9513 1808 471 172 C ATOM 3073 C SER D 967 -30.155 17.940 16.002 1.00 85.32 C ANISOU 3073 C SER D 967 12964 9984 9469 2230 586 258 C ATOM 3074 O SER D 967 -29.847 18.483 17.084 1.00 84.85 O ANISOU 3074 O SER D 967 13364 9636 9239 2194 653 191 O ATOM 3075 CB SER D 967 -29.106 19.067 14.023 1.00 79.08 C ANISOU 3075 CB SER D 967 12759 8595 8691 2153 636 169 C ATOM 3076 OG SER D 967 -27.826 19.322 13.466 1.00 72.14 O ANISOU 3076 OG SER D 967 12172 7262 7975 1710 556 55 O ATOM 3077 N SER D 968 -31.372 17.460 15.721 1.00 83.61 N ANISOU 3077 N SER D 968 12243 10323 9202 2609 613 412 N ATOM 3078 CA SER D 968 -32.493 17.396 16.694 1.00 89.85 C ANISOU 3078 CA SER D 968 12882 11485 9773 3030 710 541 C ATOM 3079 C SER D 968 -32.152 16.362 17.773 1.00 84.53 C ANISOU 3079 C SER D 968 11839 10932 9348 2599 556 483 C ATOM 3080 O SER D 968 -32.350 16.659 18.962 1.00 87.57 O ANISOU 3080 O SER D 968 12460 11254 9559 2750 633 488 O ATOM 3081 CB SER D 968 -33.817 17.086 16.025 1.00 97.72 C ANISOU 3081 CB SER D 968 13366 13108 10654 3476 754 748 C ATOM 3082 OG SER D 968 -34.237 15.748 16.287 1.00 99.88 O ANISOU 3082 OG SER D 968 12895 13892 11161 3226 593 795 O ATOM 3083 N ASN D 969 -31.644 15.194 17.371 1.00 81.65 N ANISOU 3083 N ASN D 969 10939 10719 9364 2094 369 440 N ATOM 3084 CA ASN D 969 -31.288 14.093 18.305 1.00 75.36 C ANISOU 3084 CA ASN D 969 9739 10062 8831 1681 248 409 C ATOM 3085 C ASN D 969 -30.121 14.542 19.191 1.00 77.09 C ANISOU 3085 C ASN D 969 10436 9799 9055 1351 229 285 C ATOM 3086 O ASN D 969 -30.214 14.324 20.400 1.00 88.63 O ANISOU 3086 O ASN D 969 11857 11339 10481 1330 232 289 O ATOM 3087 CB ASN D 969 -30.961 12.781 17.583 1.00 69.09 C ANISOU 3087 CB ASN D 969 8347 9487 8418 1233 110 405 C ATOM 3088 CG ASN D 969 -32.166 12.106 16.951 1.00 65.41 C ANISOU 3088 CG ASN D 969 7325 9588 7938 1445 108 522 C ATOM 3089 OD1 ASN D 969 -33.277 12.635 16.964 1.00 62.35 O ANISOU 3089 OD1 ASN D 969 6946 9489 7254 1960 200 639 O ATOM 3090 ND2 ASN D 969 -31.951 10.937 16.374 1.00 69.57 N ANISOU 3090 ND2 ASN D 969 7380 10294 8761 1041 18 509 N ATOM 3091 N PHE D 970 -29.073 15.156 18.636 1.00 76.50 N ANISOU 3091 N PHE D 970 10793 9270 9003 1091 209 189 N ATOM 3092 CA PHE D 970 -27.876 15.570 19.418 1.00 77.11 C ANISOU 3092 CA PHE D 970 11303 8932 9064 684 170 84 C ATOM 3093 C PHE D 970 -28.224 16.701 20.389 1.00 88.58 C ANISOU 3093 C PHE D 970 13391 10156 10108 1003 320 42 C ATOM 3094 O PHE D 970 -27.676 16.705 21.510 1.00 91.22 O ANISOU 3094 O PHE D 970 13885 10375 10399 724 284 -13 O ATOM 3095 CB PHE D 970 -26.723 15.998 18.513 1.00 81.41 C ANISOU 3095 CB PHE D 970 12155 9076 9702 336 116 15 C ATOM 3096 CG PHE D 970 -25.983 14.849 17.881 1.00 76.15 C ANISOU 3096 CG PHE D 970 10955 8535 9444 -119 -29 55 C ATOM 3097 CD1 PHE D 970 -25.498 13.807 18.649 1.00 74.32 C ANISOU 3097 CD1 PHE D 970 10303 8490 9445 -494 -115 99 C ATOM 3098 CD2 PHE D 970 -25.783 14.809 16.514 1.00 73.83 C ANISOU 3098 CD2 PHE D 970 10597 8169 9286 -145 -50 65 C ATOM 3099 CE1 PHE D 970 -24.827 12.748 18.060 1.00 69.07 C ANISOU 3099 CE1 PHE D 970 9192 7918 9132 -869 -194 165 C ATOM 3100 CE2 PHE D 970 -25.116 13.750 15.926 1.00 71.16 C ANISOU 3100 CE2 PHE D 970 9817 7918 9302 -538 -149 116 C ATOM 3101 CZ PHE D 970 -24.636 12.721 16.700 1.00 63.78 C ANISOU 3101 CZ PHE D 970 8496 7149 8587 -892 -207 171 C ATOM 3102 N GLY D 971 -29.077 17.640 19.965 1.00 82.18 N ANISOU 3102 N GLY D 971 12955 9280 8990 1566 503 80 N ATOM 3103 CA GLY D 971 -29.655 18.671 20.846 1.00 83.68 C ANISOU 3103 CA GLY D 971 13751 9288 8754 1998 712 81 C ATOM 3104 C GLY D 971 -30.295 18.038 22.072 1.00 84.28 C ANISOU 3104 C GLY D 971 13487 9716 8821 2115 698 148 C ATOM 3105 O GLY D 971 -29.920 18.413 23.197 1.00 93.83 O ANISOU 3105 O GLY D 971 15095 10692 9864 1975 731 69 O ATOM 3106 N ALA D 972 -31.197 17.073 21.854 1.00 75.89 N ANISOU 3106 N ALA D 972 11699 9206 7930 2319 642 287 N ATOM 3107 CA ALA D 972 -31.974 16.354 22.894 1.00 77.22 C ANISOU 3107 CA ALA D 972 11433 9793 8114 2483 630 384 C ATOM 3108 C ALA D 972 -31.051 15.557 23.832 1.00 76.08 C ANISOU 3108 C ALA D 972 11066 9616 8225 1903 470 290 C ATOM 3109 O ALA D 972 -31.382 15.457 25.028 1.00 74.26 O ANISOU 3109 O ALA D 972 10834 9494 7888 2016 504 314 O ATOM 3110 CB ALA D 972 -32.990 15.454 22.238 1.00 74.72 C ANISOU 3110 CB ALA D 972 10378 10067 7945 2703 585 542 C ATOM 3111 N ILE D 973 -29.949 15.005 23.314 1.00 71.08 N ANISOU 3111 N ILE D 973 10239 8863 7904 1333 315 214 N ATOM 3112 CA ILE D 973 -28.978 14.177 24.091 1.00 80.16 C ANISOU 3112 CA ILE D 973 11117 10030 9310 772 178 173 C ATOM 3113 C ILE D 973 -28.193 15.092 25.034 1.00 82.99 C ANISOU 3113 C ILE D 973 12132 9987 9412 569 203 64 C ATOM 3114 O ILE D 973 -28.133 14.778 26.239 1.00 84.63 O ANISOU 3114 O ILE D 973 12248 10312 9595 466 183 68 O ATOM 3115 CB ILE D 973 -28.045 13.391 23.150 1.00 78.28 C ANISOU 3115 CB ILE D 973 10520 9781 9442 284 49 171 C ATOM 3116 CG1 ILE D 973 -28.789 12.260 22.439 1.00 72.78 C ANISOU 3116 CG1 ILE D 973 9135 9515 9004 379 25 267 C ATOM 3117 CG2 ILE D 973 -26.820 12.880 23.895 1.00 77.14 C ANISOU 3117 CG2 ILE D 973 10274 9563 9473 -280 -51 156 C ATOM 3118 CD1 ILE D 973 -28.057 11.697 21.240 1.00 69.83 C ANISOU 3118 CD1 ILE D 973 8539 9071 8921 21 -49 265 C ATOM 3119 N SER D 974 -27.603 16.165 24.499 1.00 91.78 N ANISOU 3119 N SER D 974 13885 10653 10334 487 248 -31 N ATOM 3120 CA SER D 974 -26.754 17.132 25.249 1.00 97.64 C ANISOU 3120 CA SER D 974 15342 10965 10790 196 274 -156 C ATOM 3121 C SER D 974 -27.576 17.809 26.357 1.00 95.15 C ANISOU 3121 C SER D 974 15469 10593 10089 615 443 -173 C ATOM 3122 O SER D 974 -27.008 18.058 27.434 1.00100.61 O ANISOU 3122 O SER D 974 16469 11141 10617 307 422 -251 O ATOM 3123 CB SER D 974 -26.113 18.147 24.332 1.00105.03 C ANISOU 3123 CB SER D 974 16880 11440 11586 73 318 -247 C ATOM 3124 OG SER D 974 -26.989 18.519 23.278 1.00109.53 O ANISOU 3124 OG SER D 974 17504 12012 12099 604 447 -198 O ATOM 3125 N SER D 975 -28.861 18.091 26.112 1.00 99.78 N ANISOU 3125 N SER D 975 16081 11315 10515 1290 611 -82 N ATOM 3126 CA SER D 975 -29.800 18.636 27.130 1.00 99.67 C ANISOU 3126 CA SER D 975 16422 11306 10141 1797 803 -41 C ATOM 3127 C SER D 975 -29.890 17.645 28.300 1.00 98.12 C ANISOU 3127 C SER D 975 15694 11476 10110 1641 686 1 C ATOM 3128 O SER D 975 -29.593 18.044 29.444 1.00100.28 O ANISOU 3128 O SER D 975 16382 11566 10154 1508 724 -77 O ATOM 3129 CB SER D 975 -31.169 18.953 26.541 1.00 94.52 C ANISOU 3129 CB SER D 975 15737 10852 9324 2564 998 120 C ATOM 3130 OG SER D 975 -32.023 17.813 26.517 1.00 88.36 O ANISOU 3130 OG SER D 975 14099 10677 8798 2766 908 280 O ATOM 3131 N VAL D 976 -30.234 16.388 28.003 1.00 96.48 N ANISOU 3131 N VAL D 976 14621 11755 10281 1618 555 112 N ATOM 3132 CA VAL D 976 -30.447 15.307 29.008 1.00 94.56 C ANISOU 3132 CA VAL D 976 13778 11915 10237 1527 466 180 C ATOM 3133 C VAL D 976 -29.128 15.041 29.746 1.00102.27 C ANISOU 3133 C VAL D 976 14788 12750 11320 865 328 79 C ATOM 3134 O VAL D 976 -29.184 14.875 30.974 1.00106.11 O ANISOU 3134 O VAL D 976 15259 13339 11719 845 332 82 O ATOM 3135 CB VAL D 976 -31.008 14.031 28.354 1.00 88.30 C ANISOU 3135 CB VAL D 976 12109 11620 9821 1575 377 307 C ATOM 3136 CG1 VAL D 976 -31.117 12.888 29.349 1.00 98.09 C ANISOU 3136 CG1 VAL D 976 12752 13234 11285 1433 305 370 C ATOM 3137 CG2 VAL D 976 -32.356 14.276 27.697 1.00 86.51 C ANISOU 3137 CG2 VAL D 976 11791 11633 9444 2206 500 439 C ATOM 3138 N LEU D 977 -27.990 15.009 29.040 1.00100.78 N ANISOU 3138 N LEU D 977 14631 12366 11295 355 216 16 N ATOM 3139 CA LEU D 977 -26.645 14.797 29.648 1.00 98.73 C ANISOU 3139 CA LEU D 977 14383 12022 11109 -304 84 -34 C ATOM 3140 C LEU D 977 -26.337 15.899 30.674 1.00105.69 C ANISOU 3140 C LEU D 977 16034 12573 11549 -400 148 -156 C ATOM 3141 O LEU D 977 -25.968 15.558 31.819 1.00104.97 O ANISOU 3141 O LEU D 977 15822 12633 11429 -658 90 -150 O ATOM 3142 CB LEU D 977 -25.580 14.778 28.547 1.00 93.37 C ANISOU 3142 CB LEU D 977 13693 11164 10618 -745 -17 -51 C ATOM 3143 CG LEU D 977 -25.415 13.459 27.794 1.00 78.67 C ANISOU 3143 CG LEU D 977 11043 9625 9223 -896 -104 72 C ATOM 3144 CD1 LEU D 977 -24.341 13.603 26.729 1.00 72.72 C ANISOU 3144 CD1 LEU D 977 10387 8641 8602 -1294 -181 64 C ATOM 3145 CD2 LEU D 977 -25.077 12.309 28.736 1.00 75.21 C ANISOU 3145 CD2 LEU D 977 10017 9546 9012 -1158 -164 175 C ATOM 3146 N ASN D 978 -26.469 17.167 30.277 1.00111.37 N ANISOU 3146 N ASN D 978 17537 12857 11923 -212 281 -259 N ATOM 3147 CA ASN D 978 -26.230 18.345 31.154 1.00118.39 C ANISOU 3147 CA ASN D 978 19310 13344 12328 -296 393 -398 C ATOM 3148 C ASN D 978 -27.111 18.216 32.409 1.00115.11 C ANISOU 3148 C ASN D 978 18877 13119 11741 82 490 -358 C ATOM 3149 O ASN D 978 -26.580 18.436 33.515 1.00124.80 O ANISOU 3149 O ASN D 978 20395 14270 12755 -258 461 -436 O ATOM 3150 CB ASN D 978 -26.450 19.670 30.405 1.00122.40 C ANISOU 3150 CB ASN D 978 20657 13349 12501 -23 590 -490 C ATOM 3151 CG ASN D 978 -25.285 20.095 29.524 1.00116.18 C ANISOU 3151 CG ASN D 978 20140 12251 11754 -554 499 -578 C ATOM 3152 OD1 ASN D 978 -24.122 19.825 29.830 1.00115.82 O ANISOU 3152 OD1 ASN D 978 19981 12233 11791 -1228 317 -610 O ATOM 3153 ND2 ASN D 978 -25.579 20.799 28.441 1.00110.59 N ANISOU 3153 ND2 ASN D 978 19798 11260 10963 -245 634 -597 N ATOM 3154 N ASP D 979 -28.392 17.853 32.247 1.00113.91 N ANISOU 3154 N ASP D 979 18373 13239 11669 739 593 -228 N ATOM 3155 CA ASP D 979 -29.373 17.715 33.357 1.00118.43 C ANISOU 3155 CA ASP D 979 18888 14024 12087 1196 702 -152 C ATOM 3156 C ASP D 979 -28.938 16.586 34.297 1.00114.17 C ANISOU 3156 C ASP D 979 17692 13869 11817 817 522 -114 C ATOM 3157 O ASP D 979 -29.208 16.706 35.507 1.00112.12 O ANISOU 3157 O ASP D 979 17610 13644 11345 929 580 -121 O ATOM 3158 CB ASP D 979 -30.792 17.430 32.854 1.00122.43 C ANISOU 3158 CB ASP D 979 19016 14841 12661 1929 820 26 C ATOM 3159 CG ASP D 979 -31.479 18.591 32.152 1.00123.56 C ANISOU 3159 CG ASP D 979 19812 14676 12458 2480 1067 52 C ATOM 3160 OD1 ASP D 979 -30.907 19.703 32.147 1.00126.34 O ANISOU 3160 OD1 ASP D 979 21021 14500 12484 2330 1183 -92 O ATOM 3161 OD2 ASP D 979 -32.590 18.369 31.612 1.00120.16 O ANISOU 3161 OD2 ASP D 979 19027 14559 12069 3053 1154 230 O ATOM 3162 N ILE D 980 -28.334 15.521 33.757 1.00106.54 N ANISOU 3162 N ILE D 980 16005 13182 11292 430 339 -58 N ATOM 3163 CA ILE D 980 -27.869 14.339 34.544 1.00107.99 C ANISOU 3163 CA ILE D 980 15504 13758 11768 81 200 15 C ATOM 3164 C ILE D 980 -26.625 14.747 35.344 1.00115.67 C ANISOU 3164 C ILE D 980 16852 14553 12546 -533 114 -84 C ATOM 3165 O ILE D 980 -26.550 14.373 36.528 1.00112.84 O ANISOU 3165 O ILE D 980 16322 14408 12145 -631 87 -56 O ATOM 3166 CB ILE D 980 -27.636 13.110 33.637 1.00106.45 C ANISOU 3166 CB ILE D 980 14499 13876 12071 -102 91 125 C ATOM 3167 CG1 ILE D 980 -28.966 12.481 33.209 1.00115.35 C ANISOU 3167 CG1 ILE D 980 15137 15320 13371 449 162 239 C ATOM 3168 CG2 ILE D 980 -26.728 12.086 34.305 1.00 98.37 C ANISOU 3168 CG2 ILE D 980 12933 13137 11307 -596 -24 199 C ATOM 3169 CD1 ILE D 980 -28.856 11.512 32.046 1.00117.86 C ANISOU 3169 CD1 ILE D 980 14848 15839 14095 300 95 312 C ATOM 3170 N LEU D 981 -25.710 15.517 34.744 1.00125.39 N ANISOU 3170 N LEU D 981 18585 15425 13633 -933 74 -188 N ATOM 3171 CA LEU D 981 -24.444 15.979 35.391 1.00117.17 C ANISOU 3171 CA LEU D 981 17922 14234 12362 -1608 -25 -273 C ATOM 3172 C LEU D 981 -24.725 16.945 36.552 1.00115.36 C ANISOU 3172 C LEU D 981 18447 13758 11625 -1524 89 -403 C ATOM 3173 O LEU D 981 -23.956 16.907 37.534 1.00120.00 O ANISOU 3173 O LEU D 981 19081 14451 12062 -2014 -4 -427 O ATOM 3174 CB LEU D 981 -23.556 16.654 34.344 1.00108.73 C ANISOU 3174 CB LEU D 981 17254 12820 11239 -1992 -73 -347 C ATOM 3175 CG LEU D 981 -22.910 15.709 33.336 1.00105.06 C ANISOU 3175 CG LEU D 981 16094 12586 11238 -2253 -206 -212 C ATOM 3176 CD1 LEU D 981 -22.147 16.496 32.281 1.00105.61 C ANISOU 3176 CD1 LEU D 981 16626 12278 11224 -2555 -235 -287 C ATOM 3177 CD2 LEU D 981 -21.998 14.706 34.032 1.00104.36 C ANISOU 3177 CD2 LEU D 981 15378 12917 11358 -2747 -348 -68 C ATOM 3178 N SER D 982 -25.751 17.798 36.423 1.00117.59 N ANISOU 3178 N SER D 982 19320 13730 11628 -936 299 -469 N ATOM 3179 CA SER D 982 -26.213 18.757 37.464 1.00123.71 C ANISOU 3179 CA SER D 982 20898 14214 11893 -720 479 -578 C ATOM 3180 C SER D 982 -26.892 18.003 38.616 1.00121.78 C ANISOU 3180 C SER D 982 20183 14367 11722 -425 482 -476 C ATOM 3181 O SER D 982 -26.626 18.365 39.779 1.00118.99 O ANISOU 3181 O SER D 982 20227 13939 11046 -646 499 -558 O ATOM 3182 CB SER D 982 -27.121 19.825 36.884 1.00126.87 C ANISOU 3182 CB SER D 982 22027 14186 11992 -108 748 -621 C ATOM 3183 OG SER D 982 -28.372 19.290 36.478 1.00127.05 O ANISOU 3183 OG SER D 982 21537 14497 12238 622 836 -451 O ATOM 3184 N ARG D 983 -27.741 17.013 38.298 1.00120.78 N ANISOU 3184 N ARG D 983 19264 14643 11982 36 470 -307 N ATOM 3185 CA ARG D 983 -28.407 16.111 39.277 1.00114.60 C ANISOU 3185 CA ARG D 983 17889 14299 11353 321 461 -182 C ATOM 3186 C ARG D 983 -27.323 15.322 40.002 1.00114.66 C ANISOU 3186 C ARG D 983 17422 14604 11541 -327 266 -167 C ATOM 3187 O ARG D 983 -27.353 15.265 41.240 1.00111.10 O ANISOU 3187 O ARG D 983 17023 14273 10918 -360 274 -173 O ATOM 3188 CB ARG D 983 -29.345 15.108 38.598 1.00107.14 C ANISOU 3188 CB ARG D 983 16130 13751 10826 787 459 -6 C ATOM 3189 CG ARG D 983 -30.715 15.657 38.231 1.00110.57 C ANISOU 3189 CG ARG D 983 16830 14107 11074 1567 665 68 C ATOM 3190 CD ARG D 983 -31.541 14.603 37.515 1.00118.55 C ANISOU 3190 CD ARG D 983 16983 15573 12487 1897 627 244 C ATOM 3191 NE ARG D 983 -32.590 15.167 36.673 1.00122.88 N ANISOU 3191 NE ARG D 983 17737 16066 12887 2507 786 331 N ATOM 3192 CZ ARG D 983 -32.583 15.213 35.337 1.00111.71 C ANISOU 3192 CZ ARG D 983 16224 14614 11607 2508 766 342 C ATOM 3193 NH1 ARG D 983 -31.572 14.721 34.638 1.00 98.90 N ANISOU 3193 NH1 ARG D 983 14319 12970 10290 1935 596 267 N ATOM 3194 NH2 ARG D 983 -33.605 15.758 34.698 1.00109.56 N ANISOU 3194 NH2 ARG D 983 16131 14348 11147 3112 932 454 N ATOM 3195 N LEU D 984 -26.387 14.771 39.231 1.00115.53 N ATOM 3196 CA LEU D 984 -25.323 13.860 39.714 1.00113.71 C ATOM 3197 C LEU D 984 -24.183 14.665 40.357 1.00125.70 C ATOM 3198 O LEU D 984 -23.121 14.075 40.613 1.00126.64 O ATOM 3199 CB LEU D 984 -24.851 13.029 38.520 1.00103.49 C ATOM 3200 CG LEU D 984 -23.827 11.948 38.836 1.00105.43 C ATOM 3201 CD1 LEU D 984 -24.158 10.637 38.142 1.00 92.44 C ATOM 3202 CD2 LEU D 984 -22.451 12.431 38.442 1.00111.25 C