>>6LXT:HELIX   13 AB4 LEU E  916  LYS E  986  1                                  71    
LYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 13 AB4 LEU E 916 LYS E 986 1 71 ATOM 3493 N LEU E 916 -28.312 16.975 -60.562 1.00137.11 N ANISOU 3493 N LEU E 916 15415 25339 11343 7480 141 1006 N ATOM 3494 CA LEU E 916 -27.202 16.328 -59.816 1.00131.62 C ANISOU 3494 CA LEU E 916 14412 24034 11564 6131 94 773 C ATOM 3495 C LEU E 916 -26.617 17.318 -58.803 1.00137.82 C ANISOU 3495 C LEU E 916 16705 23521 12141 6022 215 1008 C ATOM 3496 O LEU E 916 -26.585 16.963 -57.616 1.00135.66 O ANISOU 3496 O LEU E 916 16180 23048 12318 5765 162 920 O ATOM 3497 CB LEU E 916 -26.152 15.820 -60.809 1.00127.96 C ANISOU 3497 CB LEU E 916 13526 23536 11557 5006 76 565 C ATOM 3498 CG LEU E 916 -26.541 14.551 -61.567 1.00119.12 C ANISOU 3498 CG LEU E 916 10671 23661 10927 4772 -44 229 C ATOM 3499 CD1 LEU E 916 -25.524 14.234 -62.649 1.00111.29 C ANISOU 3499 CD1 LEU E 916 9459 22574 10253 3769 -40 72 C ATOM 3500 CD2 LEU E 916 -26.693 13.365 -60.622 1.00116.42 C ANISOU 3500 CD2 LEU E 916 9679 23123 11434 3935 -119 -71 C ATOM 3501 N TYR E 917 -26.224 18.519 -59.243 1.00133.11 N ANISOU 3501 N TYR E 917 17618 22101 10857 6248 389 1294 N ATOM 3502 CA TYR E 917 -25.551 19.550 -58.403 1.00135.76 C ANISOU 3502 CA TYR E 917 19519 21120 10944 6044 558 1500 C ATOM 3503 C TYR E 917 -26.533 20.212 -57.428 1.00138.14 C ANISOU 3503 C TYR E 917 20463 21299 10725 7182 619 1748 C ATOM 3504 O TYR E 917 -26.048 20.813 -56.447 1.00138.46 O ANISOU 3504 O TYR E 917 21500 20366 10741 6924 730 1844 O ATOM 3505 CB TYR E 917 -24.885 20.640 -59.245 1.00140.71 C ANISOU 3505 CB TYR E 917 21589 20924 10950 5970 775 1719 C ATOM 3506 CG TYR E 917 -25.826 21.433 -60.114 1.00154.20 C ANISOU 3506 CG TYR E 917 23913 22975 11700 7289 887 2032 C ATOM 3507 CD1 TYR E 917 -26.136 21.011 -61.399 1.00156.70 C ANISOU 3507 CD1 TYR E 917 23449 24181 11908 7491 810 1968 C ATOM 3508 CD2 TYR E 917 -26.403 22.609 -59.660 1.00164.85 C ANISOU 3508 CD2 TYR E 917 26631 23774 12232 8351 1081 2394 C ATOM 3509 CE1 TYR E 917 -26.996 21.731 -62.211 1.00164.05 C ANISOU 3509 CE1 TYR E 917 24922 25481 11930 8735 908 2262 C ATOM 3510 CE2 TYR E 917 -27.267 23.342 -60.460 1.00171.51 C ANISOU 3510 CE2 TYR E 917 27750 24749 12666 9342 1188 2532 C ATOM 3511 CZ TYR E 917 -27.564 22.901 -61.740 1.00170.97 C ANISOU 3511 CZ TYR E 917 26884 25570 12508 9536 1098 2473 C ATOM 3512 OH TYR E 917 -28.409 23.608 -62.544 1.00176.69 O ANISOU 3512 OH TYR E 917 27841 26433 12859 10499 1215 2589 O ATOM 3513 N GLU E 918 -27.843 20.164 -57.703 1.00139.04 N ANISOU 3513 N GLU E 918 20087 22347 10394 8398 564 1847 N ATOM 3514 CA GLU E 918 -28.883 20.606 -56.733 1.00140.03 C ANISOU 3514 CA GLU E 918 20558 22539 10109 9493 588 2034 C ATOM 3515 C GLU E 918 -28.958 19.559 -55.614 1.00134.71 C ANISOU 3515 C GLU E 918 18724 22191 10268 8972 417 1750 C ATOM 3516 O GLU E 918 -29.043 19.966 -54.439 1.00134.70 O ANISOU 3516 O GLU E 918 19343 21610 10226 9144 466 1854 O ATOM 3517 CB GLU E 918 -30.238 20.852 -57.410 1.00142.29 C ANISOU 3517 CB GLU E 918 20434 23542 10086 10626 680 2006 C ATOM 3518 CG GLU E 918 -30.250 22.082 -58.307 1.00149.29 C ANISOU 3518 CG GLU E 918 22515 23792 10416 11112 918 2217 C ATOM 3519 CD GLU E 918 -31.474 22.977 -58.205 1.00158.62 C ANISOU 3519 CD GLU E 918 24115 24935 11220 12279 1161 2248 C ATOM 3520 OE1 GLU E 918 -32.530 22.495 -57.747 1.00160.89 O ANISOU 3520 OE1 GLU E 918 23526 26017 11588 12766 1187 2031 O ATOM 3521 OE2 GLU E 918 -31.358 24.160 -58.578 1.00165.58 O ANISOU 3521 OE2 GLU E 918 26223 25006 11682 12629 1379 2442 O ATOM 3522 N ASN E 919 -28.891 18.268 -55.963 1.00141.35 N ANISOU 3522 N ASN E 919 17983 23888 11836 8328 246 1406 N ATOM 3523 CA ASN E 919 -28.821 17.144 -54.990 1.00137.23 C ANISOU 3523 CA ASN E 919 16284 23663 12195 7674 106 1109 C ATOM 3524 C ASN E 919 -27.547 17.287 -54.140 1.00133.17 C ANISOU 3524 C ASN E 919 16434 22014 12151 6567 147 1080 C ATOM 3525 O ASN E 919 -27.625 17.021 -52.924 1.00129.68 O ANISOU 3525 O ASN E 919 15820 21394 12059 6449 104 1026 O ATOM 3526 CB ASN E 919 -28.896 15.774 -55.679 1.00130.07 C ANISOU 3526 CB ASN E 919 13656 23818 11947 7131 -29 747 C ATOM 3527 CG ASN E 919 -30.300 15.350 -56.067 1.00128.26 C ANISOU 3527 CG ASN E 919 13161 24123 11450 7185 27 570 C ATOM 3528 OD1 ASN E 919 -31.288 15.940 -55.631 1.00137.21 O ANISOU 3528 OD1 ASN E 919 14824 25307 12003 7979 117 700 O ATOM 3529 ND2 ASN E 919 -30.398 14.311 -56.883 1.00120.57 N ANISOU 3529 ND2 ASN E 919 11475 23444 10891 6308 -44 286 N ATOM 3530 N GLN E 920 -26.424 17.694 -54.750 1.00127.34 N ANISOU 3530 N GLN E 920 16418 20564 11403 5789 230 1104 N ATOM 3531 CA GLN E 920 -25.108 17.878 -54.068 1.00127.78 C ANISOU 3531 CA GLN E 920 17137 19559 11856 4663 281 1048 C ATOM 3532 C GLN E 920 -25.225 18.996 -53.030 1.00128.45 C ANISOU 3532 C GLN E 920 18638 18748 11421 5164 428 1311 C ATOM 3533 O GLN E 920 -24.655 18.846 -51.939 1.00130.22 O ANISOU 3533 O GLN E 920 18950 18454 12073 4529 409 1222 O ATOM 3534 CB GLN E 920 -23.983 18.271 -55.031 1.00132.46 C ANISOU 3534 CB GLN E 920 18382 19574 12374 3872 378 1038 C ATOM 3535 CG GLN E 920 -23.701 17.256 -56.130 1.00126.63 C ANISOU 3535 CG GLN E 920 16384 19596 12135 3262 257 779 C ATOM 3536 CD GLN E 920 -22.951 16.041 -55.646 1.00111.38 C ANISOU 3536 CD GLN E 920 13277 17823 11218 2097 117 444 C ATOM 3537 OE1 GLN E 920 -23.516 14.958 -55.484 1.00 97.31 O ANISOU 3537 OE1 GLN E 920 10117 16912 9944 2148 -14 249 O ATOM 3538 NE2 GLN E 920 -21.658 16.216 -55.423 1.00105.83 N ANISOU 3538 NE2 GLN E 920 13126 16281 10802 1034 162 367 N ATOM 3539 N LYS E 921 -25.903 20.088 -53.388 1.00126.93 N ANISOU 3539 N LYS E 921 19536 18369 10322 6249 582 1624 N ATOM 3540 CA LYS E 921 -26.153 21.254 -52.499 1.00134.79 C ANISOU 3540 CA LYS E 921 21977 18530 10708 6895 765 1906 C ATOM 3541 C LYS E 921 -27.087 20.841 -51.355 1.00127.90 C ANISOU 3541 C LYS E 921 20471 18114 10013 7488 649 1883 C ATOM 3542 O LYS E 921 -26.828 21.263 -50.213 1.00127.07 O ANISOU 3542 O LYS E 921 21065 17284 9930 7331 721 1940 O ATOM 3543 CB LYS E 921 -26.737 22.421 -53.300 1.00148.71 C ANISOU 3543 CB LYS E 921 24934 20113 11455 7999 968 2251 C ATOM 3544 CG LYS E 921 -25.701 23.213 -54.084 1.00152.52 C ANISOU 3544 CG LYS E 921 26614 19717 11621 7424 1181 2342 C ATOM 3545 CD LYS E 921 -26.245 23.988 -55.267 1.00159.13 C ANISOU 3545 CD LYS E 921 28006 20649 11808 8279 1329 2534 C ATOM 3546 CE LYS E 921 -25.134 24.459 -56.182 1.00163.73 C ANISOU 3546 CE LYS E 921 29446 20554 12211 7528 1495 2561 C ATOM 3547 NZ LYS E 921 -25.549 25.591 -57.045 1.00170.74 N ANISOU 3547 NZ LYS E 921 31135 21077 12662 8238 1717 2686 N ATOM 3548 N LEU E 922 -28.131 20.059 -51.652 1.00128.72 N ANISOU 3548 N LEU E 922 19308 19381 10219 8130 490 1789 N ATOM 3549 CA LEU E 922 -29.107 19.558 -50.645 1.00129.84 C ANISOU 3549 CA LEU E 922 18694 20094 10546 8710 378 1729 C ATOM 3550 C LEU E 922 -28.334 18.771 -49.583 1.00129.68 C ANISOU 3550 C LEU E 922 18091 19781 11401 7606 281 1489 C ATOM 3551 O LEU E 922 -28.315 19.206 -48.408 1.00134.43 O ANISOU 3551 O LEU E 922 19348 19778 11953 7685 333 1582 O ATOM 3552 CB LEU E 922 -30.166 18.692 -51.342 1.00125.48 C ANISOU 3552 CB LEU E 922 16715 20903 10058 9299 243 1570 C ATOM 3553 CG LEU E 922 -31.224 18.049 -50.441 1.00123.25 C ANISOU 3553 CG LEU E 922 15632 21123 10073 9174 298 1263 C ATOM 3554 CD1 LEU E 922 -32.097 19.109 -49.780 1.00118.35 C ANISOU 3554 CD1 LEU E 922 16019 20154 8794 9998 525 1397 C ATOM 3555 CD2 LEU E 922 -32.085 17.065 -51.223 1.00127.33 C ANISOU 3555 CD2 LEU E 922 15049 22606 10723 8765 245 966 C ATOM 3556 N ILE E 923 -27.676 17.690 -50.009 1.00123.45 N ANISOU 3556 N ILE E 923 16168 19376 11361 6606 159 1199 N ATOM 3557 CA ILE E 923 -26.947 16.740 -49.118 1.00117.88 C ANISOU 3557 CA ILE E 923 14673 18559 11557 5542 54 946 C ATOM 3558 C ILE E 923 -26.040 17.549 -48.184 1.00119.95 C ANISOU 3558 C ILE E 923 16203 17630 11743 5032 158 1062 C ATOM 3559 O ILE E 923 -26.114 17.307 -46.962 1.00118.45 O ANISOU 3559 O ILE E 923 15856 17296 11854 4939 115 1023 O ATOM 3560 CB ILE E 923 -26.166 15.694 -49.937 1.00114.38 C ANISOU 3560 CB ILE E 923 13139 18512 11808 4501 -38 663 C ATOM 3561 CG1 ILE E 923 -27.106 14.722 -50.657 1.00111.41 C ANISOU 3561 CG1 ILE E 923 11325 19388 11617 4925 -132 486 C ATOM 3562 CG2 ILE E 923 -25.169 14.956 -49.056 1.00107.54 C ANISOU 3562 CG2 ILE E 923 11803 17290 11768 3350 -106 459 C ATOM 3563 CD1 ILE E 923 -26.460 13.961 -51.798 1.00107.96 C ANISOU 3563 CD1 ILE E 923 10052 19344 11625 4113 -176 262 C ATOM 3564 N ALA E 924 -25.243 18.476 -48.739 1.00104.00 N ANISOU 3564 N ALA E 924 15390 14812 9313 4722 306 1189 N ATOM 3565 CA ALA E 924 -24.228 19.291 -48.022 1.00103.32 C ANISOU 3565 CA ALA E 924 16569 13565 9123 4087 445 1255 C ATOM 3566 C ALA E 924 -24.905 20.213 -47.000 1.00117.10 C ANISOU 3566 C ALA E 924 19339 14843 10312 4952 567 1495 C ATOM 3567 O ALA E 924 -24.335 20.396 -45.902 1.00118.22 O ANISOU 3567 O ALA E 924 19924 14347 10648 4435 601 1459 O ATOM 3568 CB ALA E 924 -23.396 20.096 -48.990 1.00106.39 C ANISOU 3568 CB ALA E 924 18008 13304 9110 3692 613 1331 C ATOM 3569 N ASN E 925 -26.055 20.797 -47.354 1.00122.24 N ANISOU 3569 N ASN E 925 20375 15799 10272 6220 637 1728 N ATOM 3570 CA ASN E 925 -26.812 21.713 -46.460 1.00118.89 C ANISOU 3570 CA ASN E 925 20943 14974 9254 7176 768 1976 C ATOM 3571 C ASN E 925 -27.408 20.882 -45.324 1.00111.92 C ANISOU 3571 C ASN E 925 19034 14617 8874 7303 593 1845 C ATOM 3572 O ASN E 925 -27.197 21.267 -44.171 1.00111.81 O ANISOU 3572 O ASN E 925 19636 13978 8869 7163 656 1887 O ATOM 3573 CB ASN E 925 -27.867 22.528 -47.213 1.00125.89 C ANISOU 3573 CB ASN E 925 22474 16102 9257 8525 891 2264 C ATOM 3574 CG ASN E 925 -27.274 23.650 -48.046 1.00139.09 C ANISOU 3574 CG ASN E 925 25443 16950 10453 8382 1161 2361 C ATOM 3575 OD1 ASN E 925 -26.214 24.190 -47.726 1.00141.62 O ANISOU 3575 OD1 ASN E 925 26757 16299 10752 7604 1308 2375 O ATOM 3576 ND2 ASN E 925 -27.959 24.017 -49.119 1.00146.33 N ANISOU 3576 ND2 ASN E 925 26306 18251 11040 9088 1248 2378 N ATOM 3577 N GLN E 926 -28.071 19.766 -45.648 1.00115.27 N ANISOU 3577 N GLN E 926 17948 16134 9716 7487 400 1671 N ATOM 3578 CA GLN E 926 -28.665 18.820 -44.660 1.00112.22 C ANISOU 3578 CA GLN E 926 16423 16349 9865 7564 244 1508 C ATOM 3579 C GLN E 926 -27.586 18.304 -43.698 1.00106.32 C ANISOU 3579 C GLN E 926 15460 15099 9839 6377 188 1331 C ATOM 3580 O GLN E 926 -27.848 18.267 -42.478 1.00105.59 O ANISOU 3580 O GLN E 926 15394 14852 9872 6508 169 1341 O ATOM 3581 CB GLN E 926 -29.334 17.640 -45.368 1.00107.28 C ANISOU 3581 CB GLN E 926 14192 16948 9622 7718 89 1294 C ATOM 3582 CG GLN E 926 -30.542 18.036 -46.201 1.00109.30 C ANISOU 3582 CG GLN E 926 14517 17789 9224 8536 208 1315 C ATOM 3583 CD GLN E 926 -31.433 19.032 -45.499 1.00117.46 C ANISOU 3583 CD GLN E 926 16495 18510 9624 9228 413 1421 C ATOM 3584 OE1 GLN E 926 -32.223 18.677 -44.630 1.00119.45 O ANISOU 3584 OE1 GLN E 926 16333 19055 9996 9147 410 1278 O ATOM 3585 NE2 GLN E 926 -31.312 20.296 -45.874 1.00130.32 N ANISOU 3585 NE2 GLN E 926 19436 19488 10593 9801 610 1651 N ATOM 3586 N PHE E 927 -26.431 17.900 -44.230 1.00 93.51 N ANISOU 3586 N PHE E 927 13594 13270 8664 5278 159 1170 N ATOM 3587 CA PHE E 927 -25.265 17.423 -43.445 1.00 88.48 C ANISOU 3587 CA PHE E 927 12764 12167 8689 4085 108 995 C ATOM 3588 C PHE E 927 -24.838 18.535 -42.476 1.00 91.74 C ANISOU 3588 C PHE E 927 14616 11544 8696 4042 256 1155 C ATOM 3589 O PHE E 927 -24.866 18.292 -41.249 1.00 89.50 O ANISOU 3589 O PHE E 927 14165 11147 8695 3921 207 1116 O ATOM 3590 CB PHE E 927 -24.137 16.984 -44.382 1.00 85.58 C ANISOU 3590 CB PHE E 927 12051 11747 8718 3033 78 821 C ATOM 3591 CG PHE E 927 -22.888 16.521 -43.679 1.00 80.87 C ANISOU 3591 CG PHE E 927 11262 10710 8754 1816 27 638 C ATOM 3592 CD1 PHE E 927 -22.896 15.359 -42.929 1.00 75.24 C ANISOU 3592 CD1 PHE E 927 9339 10472 8778 1444 -117 459 C ATOM 3593 CD2 PHE E 927 -21.711 17.247 -43.761 1.00 82.32 C ANISOU 3593 CD2 PHE E 927 12477 10026 8776 1054 137 640 C ATOM 3594 CE1 PHE E 927 -21.752 14.931 -42.277 1.00 71.21 C ANISOU 3594 CE1 PHE E 927 8641 9597 8820 378 -165 305 C ATOM 3595 CE2 PHE E 927 -20.564 16.812 -43.117 1.00 78.23 C ANISOU 3595 CE2 PHE E 927 11733 9178 8813 -49 82 456 C ATOM 3596 CZ PHE E 927 -20.588 15.654 -42.379 1.00 72.71 C ANISOU 3596 CZ PHE E 927 9813 8980 8833 -362 -77 300 C ATOM 3597 N ASN E 928 -24.505 19.718 -43.011 1.00 91.97 N ANISOU 3597 N ASN E 928 16021 10860 8063 4171 450 1330 N ATOM 3598 CA ASN E 928 -24.004 20.891 -42.239 1.00103.93 C ANISOU 3598 CA ASN E 928 19061 11304 9122 4057 655 1466 C ATOM 3599 C ASN E 928 -25.043 21.283 -41.180 1.00104.22 C ANISOU 3599 C ASN E 928 19425 11337 8837 5020 688 1631 C ATOM 3600 O ASN E 928 -24.632 21.695 -40.075 1.00102.63 O ANISOU 3600 O ASN E 928 19868 10493 8633 4702 763 1635 O ATOM 3601 CB ASN E 928 -23.638 22.066 -43.155 1.00102.79 C ANISOU 3601 CB ASN E 928 20306 10480 8270 4166 901 1632 C ATOM 3602 CG ASN E 928 -22.366 21.834 -43.953 1.00104.04 C ANISOU 3602 CG ASN E 928 20386 10401 8742 3008 904 1446 C ATOM 3603 OD1 ASN E 928 -21.480 21.095 -43.531 1.00104.56 O ANISOU 3603 OD1 ASN E 928 19775 10476 9478 1969 777 1206 O ATOM 3604 ND2 ASN E 928 -22.250 22.460 -45.111 1.00105.16 N ANISOU 3604 ND2 ASN E 928 21222 10337 8398 3179 1052 1555 N ATOM 3605 N SER E 929 -26.332 21.157 -41.508 1.00104.92 N ANISOU 3605 N SER E 929 19067 12143 8654 6141 635 1747 N ATOM 3606 CA SER E 929 -27.464 21.332 -40.564 1.00109.83 C ANISOU 3606 CA SER E 929 19723 12973 9035 7120 628 1871 C ATOM 3607 C SER E 929 -27.306 20.313 -39.429 1.00107.14 C ANISOU 3607 C SER E 929 18341 12907 9459 6545 451 1661 C ATOM 3608 O SER E 929 -27.160 20.748 -38.271 1.00112.56 O ANISOU 3608 O SER E 929 19657 13027 10085 6473 516 1711 O ATOM 3609 CB SER E 929 -28.800 21.224 -41.277 1.00113.52 C ANISOU 3609 CB SER E 929 19662 14318 9151 8276 592 1948 C ATOM 3610 OG SER E 929 -29.871 21.028 -40.365 1.00111.11 O ANISOU 3610 OG SER E 929 18786 14494 8935 8659 614 1778 O ATOM 3611 N ALA E 930 -27.257 19.017 -39.760 1.00109.50 N ANISOU 3611 N ALA E 930 17148 14003 10454 6091 258 1432 N ATOM 3612 CA ALA E 930 -27.221 17.897 -38.786 1.00 96.94 C ANISOU 3612 CA ALA E 930 14408 12807 9619 5627 100 1234 C ATOM 3613 C ALA E 930 -26.031 18.057 -37.834 1.00 93.34 C ANISOU 3613 C ALA E 930 14465 11548 9452 4637 125 1175 C ATOM 3614 O ALA E 930 -26.217 17.877 -36.625 1.00 85.75 O ANISOU 3614 O ALA E 930 13378 10518 8684 4670 88 1162 O ATOM 3615 CB ALA E 930 -27.171 16.570 -39.499 1.00 85.87 C ANISOU 3615 CB ALA E 930 11483 12266 8878 5184 -49 999 C ATOM 3616 N ILE E 931 -24.853 18.387 -38.359 1.00 89.59 N ANISOU 3616 N ILE E 931 14539 10512 8989 3786 190 1127 N ATOM 3617 CA ILE E 931 -23.624 18.575 -37.534 1.00 91.33 C ANISOU 3617 CA ILE E 931 15259 9997 9445 2771 223 1038 C ATOM 3618 C ILE E 931 -23.859 19.721 -36.545 1.00 95.83 C ANISOU 3618 C ILE E 931 17140 9837 9435 3227 388 1215 C ATOM 3619 O ILE E 931 -23.606 19.525 -35.341 1.00 91.42 O ANISOU 3619 O ILE E 931 16487 9096 9151 2894 345 1154 O ATOM 3620 CB ILE E 931 -22.392 18.820 -38.419 1.00 86.63 C ANISOU 3620 CB ILE E 931 15083 8965 8867 1849 288 944 C ATOM 3621 CG1 ILE E 931 -22.026 17.550 -39.188 1.00 82.79 C ANISOU 3621 CG1 ILE E 931 13190 9184 9082 1239 114 733 C ATOM 3622 CG2 ILE E 931 -21.226 19.349 -37.590 1.00 85.44 C ANISOU 3622 CG2 ILE E 931 15767 7973 8722 963 381 873 C ATOM 3623 CD1 ILE E 931 -20.792 17.689 -40.041 1.00101.34 C ANISOU 3623 CD1 ILE E 931 15833 11162 11511 281 159 615 C ATOM 3624 N GLY E 932 -24.322 20.874 -37.034 1.00104.98 N ANISOU 3624 N GLY E 932 19488 10591 9810 3971 584 1431 N ATOM 3625 CA GLY E 932 -24.633 22.052 -36.199 1.00106.25 C ANISOU 3625 CA GLY E 932 20997 10031 9343 4508 788 1620 C ATOM 3626 C GLY E 932 -25.442 21.659 -34.976 1.00 95.51 C ANISOU 3626 C GLY E 932 19119 9000 8172 5006 682 1635 C ATOM 3627 O GLY E 932 -25.024 21.995 -33.861 1.00 97.09 O ANISOU 3627 O GLY E 932 19844 8660 8384 4649 742 1614 O ATOM 3628 N LYS E 933 -26.546 20.936 -35.184 1.00100.99 N ANISOU 3628 N LYS E 933 18773 10583 9017 5763 532 1645 N ATOM 3629 CA LYS E 933 -27.439 20.429 -34.107 1.00100.14 C ANISOU 3629 CA LYS E 933 18005 10923 9120 6289 422 1637 C ATOM 3630 C LYS E 933 -26.612 19.568 -33.143 1.00 91.87 C ANISOU 3630 C LYS E 933 16231 9859 8816 5277 290 1434 C ATOM 3631 O LYS E 933 -26.619 19.841 -31.929 1.00 92.13 O ANISOU 3631 O LYS E 933 16655 9530 8820 5276 321 1463 O ATOM 3632 CB LYS E 933 -28.599 19.623 -34.703 1.00 96.50 C ANISOU 3632 CB LYS E 933 16344 11531 8791 7020 292 1590 C ATOM 3633 CG LYS E 933 -29.555 20.403 -35.594 1.00107.78 C ANISOU 3633 CG LYS E 933 18164 13241 9546 7706 470 1606 C ATOM 3634 CD LYS E 933 -30.655 19.534 -36.160 1.00108.54 C ANISOU 3634 CD LYS E 933 16983 14456 9802 7966 384 1433 C ATOM 3635 CE LYS E 933 -31.710 20.304 -36.925 1.00114.88 C ANISOU 3635 CE LYS E 933 18193 15569 9887 8679 568 1452 C ATOM 3636 NZ LYS E 933 -32.393 19.435 -37.912 1.00116.34 N ANISOU 3636 NZ LYS E 933 17291 16706 10206 8691 470 1317 N ATOM 3637 N ILE E 934 -25.907 18.574 -33.683 1.00 90.48 N ANISOU 3637 N ILE E 934 15049 10062 9269 4452 157 1239 N ATOM 3638 CA ILE E 934 -25.122 17.578 -32.899 1.00 87.27 C ANISOU 3638 CA ILE E 934 13761 9772 9625 3506 20 1043 C ATOM 3639 C ILE E 934 -24.095 18.337 -32.048 1.00 92.15 C ANISOU 3639 C ILE E 934 15424 9494 10093 2826 119 1046 C ATOM 3640 O ILE E 934 -23.972 18.005 -30.848 1.00 88.23 O ANISOU 3640 O ILE E 934 14672 8960 9892 2592 59 996 O ATOM 3641 CB ILE E 934 -24.496 16.532 -33.843 1.00 80.05 C ANISOU 3641 CB ILE E 934 11755 9349 9311 2774 -97 853 C ATOM 3642 CG1 ILE E 934 -25.570 15.615 -34.433 1.00 78.16 C ANISOU 3642 CG1 ILE E 934 10307 10083 9307 3397 -190 802 C ATOM 3643 CG2 ILE E 934 -23.405 15.741 -33.138 1.00 74.98 C ANISOU 3643 CG2 ILE E 934 10509 8630 9351 1693 -195 676 C ATOM 3644 CD1 ILE E 934 -25.161 14.899 -35.699 1.00 75.60 C ANISOU 3644 CD1 ILE E 934 9180 10209 9335 2918 -247 658 C ATOM 3645 N GLN E 935 -23.415 19.335 -32.632 1.00 95.26 N ANISOU 3645 N GLN E 935 16970 9207 10018 2539 284 1094 N ATOM 3646 CA GLN E 935 -22.450 20.216 -31.920 1.00 97.07 C ANISOU 3646 CA GLN E 935 18349 8543 9990 1901 435 1075 C ATOM 3647 C GLN E 935 -23.129 20.808 -30.680 1.00103.51 C ANISOU 3647 C GLN E 935 19789 9069 10470 2524 516 1204 C ATOM 3648 O GLN E 935 -22.510 20.775 -29.604 1.00105.66 O ANISOU 3648 O GLN E 935 20158 9048 10939 1935 504 1112 O ATOM 3649 CB GLN E 935 -21.963 21.361 -32.808 1.00 94.85 C ANISOU 3649 CB GLN E 935 19368 7576 9094 1795 667 1145 C ATOM 3650 CG GLN E 935 -20.989 20.942 -33.895 1.00 91.06 C ANISOU 3650 CG GLN E 935 18500 7184 8915 939 619 986 C ATOM 3651 CD GLN E 935 -20.448 22.142 -34.632 1.00103.26 C ANISOU 3651 CD GLN E 935 21448 7959 9826 775 884 1045 C ATOM 3652 OE1 GLN E 935 -21.191 22.898 -35.257 1.00111.91 O ANISOU 3652 OE1 GLN E 935 23288 8909 10323 1634 1038 1250 O ATOM 3653 NE2 GLN E 935 -19.140 22.332 -34.554 1.00104.08 N ANISOU 3653 NE2 GLN E 935 21938 7570 10038 -328 954 860 N ATOM 3654 N ASP E 936 -24.346 21.342 -30.846 1.00109.01 N ANISOU 3654 N ASP E 936 20896 9864 10660 3680 598 1407 N ATOM 3655 CA ASP E 936 -25.184 21.928 -29.760 1.00116.43 C ANISOU 3655 CA ASP E 936 22421 10587 11231 4448 682 1550 C ATOM 3656 C ASP E 936 -25.533 20.825 -28.749 1.00107.43 C ANISOU 3656 C ASP E 936 20062 10047 10711 4403 465 1449 C ATOM 3657 O ASP E 936 -25.522 21.113 -27.530 1.00107.73 O ANISOU 3657 O ASP E 936 20485 9753 10694 4373 503 1463 O ATOM 3658 CB ASP E 936 -26.425 22.629 -30.338 1.00122.01 C ANISOU 3658 CB ASP E 936 23365 11633 11361 5481 818 1608 C ATOM 3659 CG ASP E 936 -27.512 22.991 -29.332 1.00121.57 C ANISOU 3659 CG ASP E 936 23258 11850 11082 6087 887 1558 C ATOM 3660 OD1 ASP E 936 -27.232 23.809 -28.429 1.00119.13 O ANISOU 3660 OD1 ASP E 936 23734 11017 10514 5863 1046 1503 O ATOM 3661 OD2 ASP E 936 -28.643 22.460 -29.466 1.00122.98 O ANISOU 3661 OD2 ASP E 936 22592 12805 11329 6716 795 1547 O ATOM 3662 N SER E 937 -25.820 19.610 -29.233 1.00107.88 N ANISOU 3662 N SER E 937 18719 10942 11329 4380 267 1344 N ATOM 3663 CA SER E 937 -26.201 18.439 -28.398 1.00101.07 C ANISOU 3663 CA SER E 937 16596 10714 11091 4353 85 1239 C ATOM 3664 C SER E 937 -24.995 17.966 -27.575 1.00102.95 C ANISOU 3664 C SER E 937 16569 10705 11843 3242 15 1087 C ATOM 3665 O SER E 937 -25.190 17.651 -26.386 1.00106.52 O ANISOU 3665 O SER E 937 16743 11221 12508 3270 -39 1075 O ATOM 3666 CB SER E 937 -26.804 17.316 -29.225 1.00 90.75 C ANISOU 3666 CB SER E 937 13941 10334 10207 4596 -52 1149 C ATOM 3667 OG SER E 937 -25.808 16.447 -29.748 1.00 89.83 O ANISOU 3667 OG SER E 937 13032 10411 10689 3622 -148 973 O ATOM 3668 N LEU E 938 -23.798 17.939 -28.168 1.00 93.18 N ANISOU 3668 N LEU E 938 15428 9206 10770 2318 19 976 N ATOM 3669 CA LEU E 938 -22.568 17.438 -27.497 1.00 87.90 C ANISOU 3669 CA LEU E 938 14428 8380 10591 1223 -58 812 C ATOM 3670 C LEU E 938 -22.124 18.380 -26.371 1.00 99.93 C ANISOU 3670 C LEU E 938 17050 9179 11741 1003 62 842 C ATOM 3671 O LEU E 938 -21.630 17.868 -25.344 1.00103.30 O ANISOU 3671 O LEU E 938 17042 9660 12549 490 -28 751 O ATOM 3672 CB LEU E 938 -21.448 17.280 -28.525 1.00 89.94 C ANISOU 3672 CB LEU E 938 14592 8546 11036 351 -67 679 C ATOM 3673 CG LEU E 938 -21.599 16.120 -29.506 1.00 93.94 C ANISOU 3673 CG LEU E 938 13813 9800 12081 277 -204 591 C ATOM 3674 CD1 LEU E 938 -20.389 16.058 -30.426 1.00 94.18 C ANISOU 3674 CD1 LEU E 938 13862 9654 12268 -652 -203 453 C ATOM 3675 CD2 LEU E 938 -21.785 14.792 -28.784 1.00 93.26 C ANISOU 3675 CD2 LEU E 938 12390 10342 12704 153 -361 503 C ATOM 3676 N SER E 939 -22.243 19.696 -26.556 1.00100.03 N ANISOU 3676 N SER E 939 18439 8534 11034 1340 275 957 N ATOM 3677 CA SER E 939 -21.784 20.698 -25.558 1.00108.14 C ANISOU 3677 CA SER E 939 20632 8810 11646 1087 443 963 C ATOM 3678 C SER E 939 -22.852 20.848 -24.463 1.00106.38 C ANISOU 3678 C SER E 939 20499 8658 11262 1920 447 1094 C ATOM 3679 O SER E 939 -22.468 21.245 -23.347 1.00105.02 O ANISOU 3679 O SER E 939 20831 8084 10987 1604 510 1057 O ATOM 3680 CB SER E 939 -21.403 22.019 -26.204 1.00113.92 C ANISOU 3680 CB SER E 939 22807 8784 11694 1028 714 1008 C ATOM 3681 OG SER E 939 -20.203 22.536 -25.633 1.00113.76 O ANISOU 3681 OG SER E 939 23095 8532 11595 69 804 765 O ATOM 3682 N SER E 940 -24.122 20.519 -24.761 1.00110.42 N ANISOU 3682 N SER E 940 20502 9697 11756 2912 382 1221 N ATOM 3683 CA SER E 940 -25.252 20.435 -23.789 1.00104.79 C ANISOU 3683 CA SER E 940 19607 9226 10983 3747 349 1324 C ATOM 3684 C SER E 940 -25.055 19.217 -22.875 1.00101.38 C ANISOU 3684 C SER E 940 17956 9298 11267 3298 144 1197 C ATOM 3685 O SER E 940 -25.299 19.335 -21.650 1.00100.57 O ANISOU 3685 O SER E 940 18011 9069 11133 3441 149 1223 O ATOM 3686 CB SER E 940 -26.590 20.395 -24.505 1.00 98.28 C ANISOU 3686 CB SER E 940 18394 9001 9947 4749 348 1399 C ATOM 3687 OG SER E 940 -27.565 19.674 -23.762 1.00100.46 O ANISOU 3687 OG SER E 940 17709 9953 10510 5161 235 1352 O ATOM 3688 N THR E 941 -24.628 18.093 -23.458 1.00 96.63 N ANISOU 3688 N THR E 941 16203 9235 11276 2783 -12 1070 N ATOM 3689 CA THR E 941 -24.265 16.846 -22.739 1.00 88.30 C ANISOU 3689 CA THR E 941 13954 8649 10948 2247 -184 945 C ATOM 3690 C THR E 941 -23.091 17.150 -21.804 1.00 93.48 C ANISOU 3690 C THR E 941 15091 8793 11634 1375 -166 866 C ATOM 3691 O THR E 941 -23.226 16.843 -20.603 1.00 95.07 O ANISOU 3691 O THR E 941 15031 9076 12015 1389 -219 867 O ATOM 3692 CB THR E 941 -23.970 15.711 -23.722 1.00 71.92 C ANISOU 3692 CB THR E 941 10706 7167 9453 1854 -305 828 C ATOM 3693 OG1 THR E 941 -25.157 15.545 -24.495 1.00 70.16 O ANISOU 3693 OG1 THR E 941 10119 7427 9111 2732 -300 891 O ATOM 3694 CG2 THR E 941 -23.612 14.406 -23.046 1.00 75.79 C ANISOU 3694 CG2 THR E 941 9986 8127 10685 1345 -445 716 C ATOM 3695 N ALA E 942 -22.013 17.754 -22.325 1.00 84.57 N ANISOU 3695 N ALA E 942 14653 7176 10305 662 -84 790 N ATOM 3696 CA ALA E 942 -20.774 18.089 -21.574 1.00 83.62 C ANISOU 3696 CA ALA E 942 15006 6597 10170 -270 -52 667 C ATOM 3697 C ALA E 942 -21.101 18.963 -20.360 1.00 84.75 C ANISOU 3697 C ALA E 942 16063 6276 9863 46 69 740 C ATOM 3698 O ALA E 942 -20.501 18.730 -19.291 1.00 83.14 O ANISOU 3698 O ALA E 942 15688 6044 9856 -485 14 654 O ATOM 3699 CB ALA E 942 -19.783 18.783 -22.473 1.00 80.84 C ANISOU 3699 CB ALA E 942 15411 5765 9538 -923 69 574 C ATOM 3700 N SER E 943 -21.996 19.939 -20.548 1.00 91.66 N ANISOU 3700 N SER E 943 17879 6809 10140 878 237 893 N ATOM 3701 CA SER E 943 -22.536 20.849 -19.504 1.00 93.15 C ANISOU 3701 CA SER E 943 19008 6548 9837 1370 384 991 C ATOM 3702 C SER E 943 -23.194 20.013 -18.407 1.00 90.39 C ANISOU 3702 C SER E 943 17763 6701 9879 1716 221 1020 C ATOM 3703 O SER E 943 -22.789 20.158 -17.241 1.00100.99 O ANISOU 3703 O SER E 943 19319 7832 11220 1354 230 968 O ATOM 3704 CB SER E 943 -23.514 21.845 -20.091 1.00104.96 C ANISOU 3704 CB SER E 943 21135 8030 10714 2230 565 1077 C ATOM 3705 OG SER E 943 -24.185 22.581 -19.075 1.00107.93 O ANISOU 3705 OG SER E 943 21937 8367 10705 2677 685 1076 O ATOM 3706 N ALA E 944 -24.157 19.166 -18.783 1.00 89.63 N ANISOU 3706 N ALA E 944 16698 7262 10097 2365 90 1086 N ATOM 3707 CA ALA E 944 -24.950 18.322 -17.856 1.00 88.64 C ANISOU 3707 CA ALA E 944 15680 7662 10338 2798 -40 1113 C ATOM 3708 C ALA E 944 -24.012 17.424 -17.031 1.00 86.18 C ANISOU 3708 C ALA E 944 14587 7554 10602 1929 -179 986 C ATOM 3709 O ALA E 944 -24.181 17.385 -15.798 1.00 96.53 O ANISOU 3709 O ALA E 944 15901 8836 11940 2001 -196 1004 O ATOM 3710 CB ALA E 944 -25.977 17.525 -18.628 1.00 80.05 C ANISOU 3710 CB ALA E 944 13646 7267 9501 3482 -128 1150 C ATOM 3711 N LEU E 945 -23.040 16.762 -17.672 1.00 75.64 N ANISOU 3711 N LEU E 945 12644 6409 9685 1146 -267 865 N ATOM 3712 CA LEU E 945 -22.087 15.819 -17.019 1.00 73.71 C ANISOU 3712 CA LEU E 945 11572 6423 10012 322 -402 749 C ATOM 3713 C LEU E 945 -21.159 16.572 -16.056 1.00 77.23 C ANISOU 3713 C LEU E 945 12842 6335 10167 -298 -339 684 C ATOM 3714 O LEU E 945 -20.861 16.007 -14.981 1.00 74.75 O ANISOU 3714 O LEU E 945 12029 6219 10154 -582 -430 654 O ATOM 3715 CB LEU E 945 -21.276 15.091 -18.093 1.00 75.31 C ANISOU 3715 CB LEU E 945 11073 6902 10641 -323 -483 637 C ATOM 3716 CG LEU E 945 -22.068 14.146 -18.997 1.00 62.36 C ANISOU 3716 CG LEU E 945 8423 5883 9388 144 -548 659 C ATOM 3717 CD1 LEU E 945 -21.213 13.702 -20.174 1.00 62.68 C ANISOU 3717 CD1 LEU E 945 8035 6060 9722 -509 -590 547 C ATOM 3718 CD2 LEU E 945 -22.587 12.944 -18.217 1.00 56.58 C ANISOU 3718 CD2 LEU E 945 6559 5730 9208 354 -642 667 C ATOM 3719 N GLY E 946 -20.715 17.778 -16.436 1.00 79.65 N ANISOU 3719 N GLY E 946 14348 6007 9907 -508 -174 655 N ATOM 3720 CA GLY E 946 -19.938 18.699 -15.581 1.00 74.58 C ANISOU 3720 CA GLY E 946 14679 4794 8865 -1044 -52 571 C ATOM 3721 C GLY E 946 -20.680 19.065 -14.305 1.00 82.18 C ANISOU 3721 C GLY E 946 16001 5630 9594 -503 -5 664 C ATOM 3722 O GLY E 946 -20.072 18.934 -13.223 1.00 88.32 O ANISOU 3722 O GLY E 946 16682 6405 10470 -1008 -48 581 O ATOM 3723 N LYS E 947 -21.941 19.506 -14.417 1.00 84.02 N ANISOU 3723 N LYS E 947 16621 5788 9516 492 79 826 N ATOM 3724 CA LYS E 947 -22.786 19.914 -13.259 1.00 84.95 C ANISOU 3724 CA LYS E 947 17130 5775 9374 1115 137 925 C ATOM 3725 C LYS E 947 -22.963 18.700 -12.334 1.00 80.59 C ANISOU 3725 C LYS E 947 15375 5833 9411 1096 -68 921 C ATOM 3726 O LYS E 947 -22.697 18.853 -11.124 1.00 86.11 O ANISOU 3726 O LYS E 947 16264 6399 10053 858 -63 890 O ATOM 3727 CB LYS E 947 -24.120 20.511 -13.729 1.00 84.95 C ANISOU 3727 CB LYS E 947 17463 5845 8971 2159 250 1048 C ATOM 3728 CG LYS E 947 -24.036 21.868 -14.424 1.00 91.26 C ANISOU 3728 CG LYS E 947 19273 6294 9108 2180 494 987 C ATOM 3729 CD LYS E 947 -25.411 22.460 -14.707 1.00 92.26 C ANISOU 3729 CD LYS E 947 19598 6632 8825 3150 607 1063 C ATOM 3730 CE LYS E 947 -25.385 23.796 -15.423 1.00103.08 C ANISOU 3730 CE LYS E 947 21998 7642 9526 3247 868 1016 C ATOM 3731 NZ LYS E 947 -26.580 24.605 -15.086 1.00111.69 N ANISOU 3731 NZ LYS E 947 23483 8827 10128 4021 1026 1041 N ATOM 3732 N LEU E 948 -23.350 17.542 -12.891 1.00 79.76 N ANISOU 3732 N LEU E 948 14098 6365 9844 1297 -221 941 N ATOM 3733 CA LEU E 948 -23.513 16.263 -12.148 1.00 67.72 C ANISOU 3733 CA LEU E 948 11356 5443 8930 1270 -386 937 C ATOM 3734 C LEU E 948 -22.203 15.930 -11.425 1.00 69.09 C ANISOU 3734 C LEU E 948 11300 5597 9353 298 -461 822 C ATOM 3735 O LEU E 948 -22.270 15.639 -10.223 1.00 68.42 O ANISOU 3735 O LEU E 948 10978 5631 9387 302 -508 842 O ATOM 3736 CB LEU E 948 -23.941 15.142 -13.102 1.00 67.21 C ANISOU 3736 CB LEU E 948 10162 5997 9376 1485 -484 937 C ATOM 3737 CG LEU E 948 -25.431 15.101 -13.458 1.00 64.50 C ANISOU 3737 CG LEU E 948 9658 5934 8916 2533 -449 1034 C ATOM 3738 CD1 LEU E 948 -25.726 14.004 -14.473 1.00 63.54 C ANISOU 3738 CD1 LEU E 948 8420 6434 9288 2618 -522 989 C ATOM 3739 CD2 LEU E 948 -26.294 14.886 -12.231 1.00 64.18 C ANISOU 3739 CD2 LEU E 948 9418 6062 8906 3073 -458 1096 C ATOM 3740 N GLN E 949 -21.052 16.024 -12.099 1.00 78.84 N ANISOU 3740 N GLN E 949 12643 6688 10623 -495 -466 702 N ATOM 3741 CA GLN E 949 -19.720 15.755 -11.472 1.00 89.71 C ANISOU 3741 CA GLN E 949 13813 8083 12189 -1456 -537 568 C ATOM 3742 C GLN E 949 -19.534 16.648 -10.239 1.00 88.42 C ANISOU 3742 C GLN E 949 14519 7504 11571 -1573 -446 543 C ATOM 3743 O GLN E 949 -19.127 16.140 -9.163 1.00 83.12 O ANISOU 3743 O GLN E 949 13385 7071 11125 -1885 -539 516 O ATOM 3744 CB GLN E 949 -18.543 16.013 -12.423 1.00 73.88 C ANISOU 3744 CB GLN E 949 12049 5885 10136 -2268 -515 418 C ATOM 3745 CG GLN E 949 -17.183 15.803 -11.754 1.00 73.49 C ANISOU 3745 CG GLN E 949 11608 6108 10205 -3006 -527 234 C ATOM 3746 CD GLN E 949 -15.997 15.735 -12.687 1.00 72.42 C ANISOU 3746 CD GLN E 949 11025 6333 10157 -3266 -448 47 C ATOM 3747 OE1 GLN E 949 -16.010 16.273 -13.787 1.00 82.22 O ANISOU 3747 OE1 GLN E 949 12699 7357 11185 -3267 -387 38 O ATOM 3748 NE2 GLN E 949 -14.940 15.077 -12.243 1.00 69.87 N ANISOU 3748 NE2 GLN E 949 9910 6498 10138 -3355 -437 -93 N ATOM 3749 N ASP E 950 -19.785 17.947 -10.409 1.00 90.55 N ANISOU 3749 N ASP E 950 16030 7167 11207 -1349 -252 549 N ATOM 3750 CA ASP E 950 -19.563 18.971 -9.357 1.00 86.85 C ANISOU 3750 CA ASP E 950 16565 6208 10227 -1514 -109 496 C ATOM 3751 C ASP E 950 -20.451 18.604 -8.161 1.00 91.13 C ANISOU 3751 C ASP E 950 16750 6994 10883 -913 -174 617 C ATOM 3752 O ASP E 950 -19.893 18.412 -7.059 1.00 94.42 O ANISOU 3752 O ASP E 950 16986 7513 11376 -1354 -231 549 O ATOM 3753 CB ASP E 950 -19.778 20.386 -9.911 1.00 88.44 C ANISOU 3753 CB ASP E 950 17926 5932 9747 -1247 147 471 C ATOM 3754 CG ASP E 950 -18.718 20.857 -10.907 1.00 92.20 C ANISOU 3754 CG ASP E 950 18540 6440 10053 -1866 233 295 C ATOM 3755 OD1 ASP E 950 -17.657 20.195 -11.032 1.00 89.35 O ANISOU 3755 OD1 ASP E 950 17419 6477 10053 -2543 107 165 O ATOM 3756 OD2 ASP E 950 -18.954 21.897 -11.553 1.00 97.36 O ANISOU 3756 OD2 ASP E 950 20008 6789 10195 -1602 434 293 O ATOM 3757 N VAL E 951 -21.759 18.435 -8.385 1.00 92.15 N ANISOU 3757 N VAL E 951 16696 7274 11043 37 -177 779 N ATOM 3758 CA VAL E 951 -22.768 18.201 -7.307 1.00 85.50 C ANISOU 3758 CA VAL E 951 15623 6621 10244 714 -208 892 C ATOM 3759 C VAL E 951 -22.526 16.838 -6.638 1.00 88.74 C ANISOU 3759 C VAL E 951 14761 7658 11298 459 -406 888 C ATOM 3760 O VAL E 951 -22.616 16.766 -5.387 1.00 87.97 O ANISOU 3760 O VAL E 951 14620 7610 11194 485 -429 906 O ATOM 3761 CB VAL E 951 -24.204 18.322 -7.845 1.00 71.84 C ANISOU 3761 CB VAL E 951 13952 4962 8383 1776 -160 1037 C ATOM 3762 CG1 VAL E 951 -25.232 17.874 -6.815 1.00 68.93 C ANISOU 3762 CG1 VAL E 951 13139 4899 8153 2433 -213 1130 C ATOM 3763 CG2 VAL E 951 -24.486 19.740 -8.305 1.00 83.71 C ANISOU 3763 CG2 VAL E 951 16755 5860 9192 2090 64 1058 C ATOM 3764 N VAL E 952 -22.241 15.790 -7.412 1.00 68.83 N ANISOU 3764 N VAL E 952 11254 5593 9307 236 -528 870 N ATOM 3765 CA VAL E 952 -22.020 14.431 -6.844 1.00 64.20 C ANISOU 3765 CA VAL E 952 9446 5595 9352 25 -682 882 C ATOM 3766 C VAL E 952 -20.855 14.520 -5.858 1.00 71.05 C ANISOU 3766 C VAL E 952 10428 6386 10180 -756 -725 792 C ATOM 3767 O VAL E 952 -21.005 14.018 -4.724 1.00 74.42 O ANISOU 3767 O VAL E 952 10434 7057 10785 -666 -784 844 O ATOM 3768 CB VAL E 952 -21.786 13.373 -7.937 1.00 60.30 C ANISOU 3768 CB VAL E 952 7969 5540 9401 -166 -767 858 C ATOM 3769 CG1 VAL E 952 -21.105 12.131 -7.386 1.00 71.62 C ANISOU 3769 CG1 VAL E 952 8336 7453 11423 -648 -889 844 C ATOM 3770 CG2 VAL E 952 -23.087 12.985 -8.624 1.00 59.11 C ANISOU 3770 CG2 VAL E 952 7410 5661 9387 671 -741 940 C ATOM 3771 N ASN E 953 -19.769 15.186 -6.265 1.00 81.65 N ANISOU 3771 N ASN E 953 12362 7405 11258 -1476 -683 654 N ATOM 3772 CA ASN E 953 -18.503 15.305 -5.490 1.00 86.99 C ANISOU 3772 CA ASN E 953 13135 8058 11861 -2334 -719 517 C ATOM 3773 C ASN E 953 -18.716 16.176 -4.240 1.00 88.42 C ANISOU 3773 C ASN E 953 14118 7911 11565 -2215 -625 511 C ATOM 3774 O ASN E 953 -18.170 15.809 -3.186 1.00 93.16 O ANISOU 3774 O ASN E 953 14368 8754 12274 -2579 -706 476 O ATOM 3775 CB ASN E 953 -17.360 15.820 -6.371 1.00 90.22 C ANISOU 3775 CB ASN E 953 13980 8215 12085 -3120 -673 339 C ATOM 3776 CG ASN E 953 -16.841 14.792 -7.360 1.00 89.48 C ANISOU 3776 CG ASN E 953 12795 8701 12504 -3217 -720 278 C ATOM 3777 OD1 ASN E 953 -16.867 13.585 -7.105 1.00 79.94 O ANISOU 3777 OD1 ASN E 953 10555 8053 11767 -3072 -776 300 O ATOM 3778 ND2 ASN E 953 -16.344 15.263 -8.494 1.00 94.11 N ANISOU 3778 ND2 ASN E 953 13614 9213 12930 -3315 -607 161 N ATOM 3779 N GLN E 954 -19.468 17.280 -4.342 1.00 87.67 N ANISOU 3779 N GLN E 954 15058 7298 10953 -1718 -453 545 N ATOM 3780 CA GLN E 954 -19.860 18.113 -3.170 1.00 90.85 C ANISOU 3780 CA GLN E 954 16243 7371 10905 -1484 -339 555 C ATOM 3781 C GLN E 954 -20.573 17.209 -2.161 1.00 89.53 C ANISOU 3781 C GLN E 954 15252 7666 11101 -999 -468 690 C ATOM 3782 O GLN E 954 -20.129 17.158 -0.989 1.00 90.75 O ANISOU 3782 O GLN E 954 15347 7918 11216 -1326 -505 646 O ATOM 3783 CB GLN E 954 -20.777 19.277 -3.561 1.00 98.38 C ANISOU 3783 CB GLN E 954 18313 7749 11318 -833 -128 618 C ATOM 3784 CG GLN E 954 -20.057 20.424 -4.262 1.00110.21 C ANISOU 3784 CG GLN E 954 20911 8649 12313 -1334 74 475 C ATOM 3785 CD GLN E 954 -20.955 21.608 -4.544 1.00113.22 C ANISOU 3785 CD GLN E 954 22203 8687 12129 -629 307 520 C ATOM 3786 OE1 GLN E 954 -22.177 21.551 -4.393 1.00117.80 O ANISOU 3786 OE1 GLN E 954 22759 9300 12700 246 306 685 O ATOM 3787 NE2 GLN E 954 -20.347 22.707 -4.959 1.00106.52 N ANISOU 3787 NE2 GLN E 954 22076 7616 10781 -997 514 358 N ATOM 3788 N ASN E 955 -21.612 16.503 -2.619 1.00 91.22 N ANISOU 3788 N ASN E 955 14833 8176 11649 -275 -526 834 N ATOM 3789 CA ASN E 955 -22.459 15.627 -1.768 1.00 84.28 C ANISOU 3789 CA ASN E 955 13181 7724 11117 275 -613 961 C ATOM 3790 C ASN E 955 -21.578 14.571 -1.096 1.00 77.64 C ANISOU 3790 C ASN E 955 11408 7355 10737 -309 -761 938 C ATOM 3791 O ASN E 955 -21.768 14.344 0.108 1.00 77.41 O ANISOU 3791 O ASN E 955 11205 7471 10737 -191 -791 988 O ATOM 3792 CB ASN E 955 -23.599 14.982 -2.554 1.00 86.63 C ANISOU 3792 CB ASN E 955 12885 8315 11717 1033 -631 1068 C ATOM 3793 CG ASN E 955 -24.660 15.981 -2.948 1.00 93.42 C ANISOU 3793 CG ASN E 955 14614 8792 12091 1783 -492 1121 C ATOM 3794 OD1 ASN E 955 -24.421 17.188 -2.924 1.00 98.32 O ANISOU 3794 OD1 ASN E 955 16341 8856 12160 1668 -360 1078 O ATOM 3795 ND2 ASN E 955 -25.833 15.477 -3.301 1.00 89.91 N ANISOU 3795 ND2 ASN E 955 13672 8656 11835 2554 -502 1207 N ATOM 3796 N ALA E 956 -20.637 13.977 -1.835 1.00 79.16 N ANISOU 3796 N ALA E 956 11051 7773 11252 -906 -842 869 N ATOM 3797 CA ALA E 956 -19.689 12.963 -1.314 1.00 84.50 C ANISOU 3797 CA ALA E 956 10836 8912 12358 -1481 -976 851 C ATOM 3798 C ALA E 956 -18.856 13.562 -0.175 1.00 95.62 C ANISOU 3798 C ALA E 956 12739 10187 13406 -2019 -978 756 C ATOM 3799 O ALA E 956 -18.613 12.862 0.826 1.00 99.68 O ANISOU 3799 O ALA E 956 12652 11071 14150 -2118 -1066 808 O ATOM 3800 CB ALA E 956 -18.799 12.454 -2.418 1.00 77.62 C ANISOU 3800 CB ALA E 956 9482 8217 11792 -2038 -1038 772 C ATOM 3801 N GLN E 957 -18.423 14.813 -0.322 1.00 94.25 N ANISOU 3801 N GLN E 957 13627 9510 12672 -2365 -865 613 N ATOM 3802 CA GLN E 957 -17.590 15.506 0.695 1.00 98.02 C ANISOU 3802 CA GLN E 957 14662 9841 12739 -2950 -831 471 C ATOM 3803 C GLN E 957 -18.466 15.845 1.907 1.00 94.26 C ANISOU 3803 C GLN E 957 14524 9256 12034 -2404 -778 564 C ATOM 3804 O GLN E 957 -18.011 15.570 3.035 1.00 96.94 O ANISOU 3804 O GLN E 957 14581 9863 12387 -2680 -848 546 O ATOM 3805 CB GLN E 957 -16.919 16.745 0.096 1.00100.56 C ANISOU 3805 CB GLN E 957 16052 9627 12528 -3488 -675 268 C ATOM 3806 CG GLN E 957 -15.908 16.415 -0.998 1.00 96.51 C ANISOU 3806 CG GLN E 957 15089 9360 12221 -3986 -707 141 C ATOM 3807 CD GLN E 957 -15.825 17.480 -2.065 1.00102.20 C ANISOU 3807 CD GLN E 957 16636 9662 12533 -3971 -517 35 C ATOM 3808 OE1 GLN E 957 -16.390 18.564 -1.942 1.00111.86 O ANISOU 3808 OE1 GLN E 957 18938 10305 13260 -3767 -347 31 O ATOM 3809 NE2 GLN E 957 -15.126 17.169 -3.144 1.00 94.76 N ANISOU 3809 NE2 GLN E 957 15173 9034 11796 -4087 -520 -40 N ATOM 3810 N ALA E 958 -19.670 16.396 1.676 1.00 88.15 N ANISOU 3810 N ALA E 958 14302 8136 11055 -1645 -662 661 N ATOM 3811 CA ALA E 958 -20.681 16.707 2.720 1.00 86.13 C ANISOU 3811 CA ALA E 958 14362 7767 10598 -1008 -604 761 C ATOM 3812 C ALA E 958 -20.945 15.472 3.595 1.00 85.73 C ANISOU 3812 C ALA E 958 13238 8296 11039 -786 -756 891 C ATOM 3813 O ALA E 958 -20.986 15.615 4.824 1.00 85.38 O ANISOU 3813 O ALA E 958 13317 8288 10835 -781 -756 899 O ATOM 3814 CB ALA E 958 -21.963 17.199 2.096 1.00 74.46 C ANISOU 3814 CB ALA E 958 13369 5974 8948 -160 -490 863 C ATOM 3815 N LEU E 959 -21.109 14.298 2.982 1.00 83.06 N ANISOU 3815 N LEU E 959 11896 8391 11272 -620 -862 984 N ATOM 3816 CA LEU E 959 -21.322 13.016 3.698 1.00 77.17 C ANISOU 3816 CA LEU E 959 10087 8194 11039 -427 -970 1112 C ATOM 3817 C LEU E 959 -20.064 12.592 4.469 1.00 78.28 C ANISOU 3817 C LEU E 959 9825 8643 11274 -1158 -1074 1060 C ATOM 3818 O LEU E 959 -20.234 12.071 5.579 1.00 89.63 O ANISOU 3818 O LEU E 959 10859 10358 12839 -1002 -1118 1151 O ATOM 3819 CB LEU E 959 -21.697 11.941 2.680 1.00 66.08 C ANISOU 3819 CB LEU E 959 7791 7125 10193 -164 -1010 1189 C ATOM 3820 CG LEU E 959 -22.044 10.585 3.286 1.00 64.14 C ANISOU 3820 CG LEU E 959 6474 7403 10495 100 -1065 1322 C ATOM 3821 CD1 LEU E 959 -22.974 10.737 4.480 1.00 59.86 C ANISOU 3821 CD1 LEU E 959 6118 6831 9794 656 -1021 1406 C ATOM 3822 CD2 LEU E 959 -22.664 9.687 2.236 1.00 61.91 C ANISOU 3822 CD2 LEU E 959 5456 7378 10690 460 -1043 1370 C ATOM 3823 N ASN E 960 -18.865 12.761 3.895 1.00 78.85 N ANISOU 3823 N ASN E 960 9961 8708 11290 -1905 -1112 919 N ATOM 3824 CA ASN E 960 -17.570 12.373 4.528 1.00 86.57 C ANISOU 3824 CA ASN E 960 10528 10041 12325 -2638 -1218 844 C ATOM 3825 C ASN E 960 -17.256 13.272 5.740 1.00 91.25 C ANISOU 3825 C ASN E 960 11824 10464 12382 -2897 -1177 742 C ATOM 3826 O ASN E 960 -16.710 12.753 6.743 1.00 84.28 O ANISOU 3826 O ASN E 960 10455 9986 11581 -3140 -1269 765 O ATOM 3827 CB ASN E 960 -16.409 12.398 3.530 1.00 87.40 C ANISOU 3827 CB ASN E 960 10562 10177 12469 -3365 -1256 688 C ATOM 3828 CG ASN E 960 -16.459 11.285 2.504 1.00 80.92 C ANISOU 3828 CG ASN E 960 8938 9708 12099 -3002 -1186 681 C ATOM 3829 OD1 ASN E 960 -16.877 10.165 2.794 1.00 69.07 O ANISOU 3829 OD1 ASN E 960 6803 8600 10841 -2466 -1121 740 O ATOM 3830 ND2 ASN E 960 -16.002 11.582 1.299 1.00 88.22 N ANISOU 3830 ND2 ASN E 960 10099 10499 12920 -3130 -1062 496 N ATOM 3831 N THR E 961 -17.564 14.569 5.664 1.00 83.73 N ANISOU 3831 N THR E 961 11980 8946 10888 -2854 -1029 631 N ATOM 3832 CA THR E 961 -17.404 15.522 6.794 1.00 90.05 C ANISOU 3832 CA THR E 961 13551 9518 11145 -3057 -943 519 C ATOM 3833 C THR E 961 -18.417 15.143 7.888 1.00 89.73 C ANISOU 3833 C THR E 961 13259 9624 11210 -2374 -964 702 C ATOM 3834 O THR E 961 -18.010 15.060 9.084 1.00 86.15 O ANISOU 3834 O THR E 961 12674 9421 10637 -2612 -1012 681 O ATOM 3835 CB THR E 961 -17.499 16.977 6.307 1.00 92.83 C ANISOU 3835 CB THR E 961 15177 9180 10913 -3166 -734 360 C ATOM 3836 OG1 THR E 961 -18.760 17.169 5.662 1.00 88.96 O ANISOU 3836 OG1 THR E 961 14974 8367 10458 -2354 -651 504 O ATOM 3837 CG2 THR E 961 -16.384 17.354 5.354 1.00 93.78 C ANISOU 3837 CG2 THR E 961 15557 9175 10901 -3935 -698 153 C ATOM 3838 N LEU E 962 -19.675 14.894 7.497 1.00 84.23 N ANISOU 3838 N LEU E 962 12461 8819 10723 -1566 -930 865 N ATOM 3839 CA LEU E 962 -20.762 14.462 8.421 1.00 83.22 C ANISOU 3839 CA LEU E 962 12045 8840 10736 -858 -939 1035 C ATOM 3840 C LEU E 962 -20.251 13.252 9.205 1.00 73.38 C ANISOU 3840 C LEU E 962 9769 8206 9906 -1048 -1084 1130 C ATOM 3841 O LEU E 962 -20.174 13.341 10.441 1.00 78.71 O ANISOU 3841 O LEU E 962 10504 8998 10404 -1091 -1099 1141 O ATOM 3842 CB LEU E 962 -22.054 14.141 7.653 1.00 71.61 C ANISOU 3842 CB LEU E 962 10387 7301 9520 -41 -897 1167 C ATOM 3843 CG LEU E 962 -23.204 13.563 8.486 1.00 68.98 C ANISOU 3843 CG LEU E 962 9644 7176 9390 688 -899 1323 C ATOM 3844 CD1 LEU E 962 -23.602 14.496 9.623 1.00 77.54 C ANISOU 3844 CD1 LEU E 962 11520 7959 9981 864 -817 1296 C ATOM 3845 CD2 LEU E 962 -24.426 13.257 7.626 1.00 67.24 C ANISOU 3845 CD2 LEU E 962 9208 6946 9395 1440 -849 1408 C ATOM 3846 N VAL E 963 -19.860 12.192 8.499 1.00 74.25 N ANISOU 3846 N VAL E 963 9000 8687 10526 -1181 -1174 1191 N ATOM 3847 CA VAL E 963 -19.401 10.918 9.121 1.00 69.99 C ANISOU 3847 CA VAL E 963 7425 8736 10433 -1294 -1286 1314 C ATOM 3848 C VAL E 963 -18.349 11.227 10.195 1.00 84.08 C ANISOU 3848 C VAL E 963 9352 10698 11895 -1893 -1350 1222 C ATOM 3849 O VAL E 963 -18.533 10.770 11.341 1.00 72.12 O ANISOU 3849 O VAL E 963 7502 9463 10439 -1692 -1383 1336 O ATOM 3850 CB VAL E 963 -18.871 9.930 8.069 1.00 64.78 C ANISOU 3850 CB VAL E 963 5951 8377 10285 -1517 -1348 1345 C ATOM 3851 CG1 VAL E 963 -17.978 8.864 8.687 1.00 64.12 C ANISOU 3851 CG1 VAL E 963 5217 8801 10343 -1716 -1342 1316 C ATOM 3852 CG2 VAL E 963 -20.014 9.292 7.302 1.00 60.92 C ANISOU 3852 CG2 VAL E 963 5051 7889 10207 -850 -1284 1463 C ATOM 3853 N LYS E 964 -17.300 11.979 9.845 1.00 90.46 N ANISOU 3853 N LYS E 964 10641 11370 12358 -2605 -1355 1012 N ATOM 3854 CA LYS E 964 -16.176 12.308 10.767 1.00 93.49 C ANISOU 3854 CA LYS E 964 11141 11986 12395 -3274 -1410 869 C ATOM 3855 C LYS E 964 -16.727 13.070 11.979 1.00 92.12 C ANISOU 3855 C LYS E 964 11608 11607 11785 -3047 -1334 853 C ATOM 3856 O LYS E 964 -16.447 12.650 13.116 1.00 92.00 O ANISOU 3856 O LYS E 964 11200 11992 11763 -3107 -1408 912 O ATOM 3857 CB LYS E 964 -15.077 13.089 10.038 1.00 93.70 C ANISOU 3857 CB LYS E 964 11667 11838 12095 -4067 -1386 603 C ATOM 3858 CG LYS E 964 -14.238 12.249 9.084 1.00 92.63 C ANISOU 3858 CG LYS E 964 10812 12029 12353 -4273 -1432 569 C ATOM 3859 CD LYS E 964 -13.139 13.026 8.395 1.00 97.48 C ANISOU 3859 CD LYS E 964 11934 12478 12625 -4651 -1291 270 C ATOM 3860 CE LYS E 964 -12.276 12.166 7.496 1.00 89.27 C ANISOU 3860 CE LYS E 964 10299 11660 11961 -4299 -1189 176 C ATOM 3861 NZ LYS E 964 -10.859 12.603 7.522 1.00 82.45 N ANISOU 3861 NZ LYS E 964 9612 10905 10812 -4620 -1132 -26 N ATOM 3862 N GLN E 965 -17.518 14.120 11.752 1.00 85.04 N ANISOU 3862 N GLN E 965 11650 10120 10543 -2754 -1185 790 N ATOM 3863 CA GLN E 965 -18.090 14.933 12.853 1.00 82.86 C ANISOU 3863 CA GLN E 965 12067 9586 9829 -2526 -1087 762 C ATOM 3864 C GLN E 965 -18.990 14.044 13.727 1.00 91.39 C ANISOU 3864 C GLN E 965 12512 10970 11241 -1850 -1149 1003 C ATOM 3865 O GLN E 965 -18.975 14.226 14.963 1.00 98.83 O ANISOU 3865 O GLN E 965 13569 12037 11946 -1876 -1151 999 O ATOM 3866 CB GLN E 965 -18.807 16.160 12.289 1.00 80.87 C ANISOU 3866 CB GLN E 965 12918 8626 9182 -2270 -896 674 C ATOM 3867 CG GLN E 965 -19.198 17.170 13.361 1.00 89.84 C ANISOU 3867 CG GLN E 965 14906 9439 9791 -2180 -760 594 C ATOM 3868 CD GLN E 965 -18.005 17.696 14.124 1.00 92.76 C ANISOU 3868 CD GLN E 965 15552 9945 9749 -3023 -745 363 C ATOM 3869 OE1 GLN E 965 -17.755 17.324 15.272 1.00 97.33 O ANISOU 3869 OE1 GLN E 965 15735 10932 10314 -3130 -831 387 O ATOM 3870 NE2 GLN E 965 -17.236 18.552 13.470 1.00 91.80 N ANISOU 3870 NE2 GLN E 965 16095 9506 9277 -3647 -625 123 N ATOM 3871 N LEU E 966 -19.719 13.098 13.127 1.00 85.10 N ANISOU 3871 N LEU E 966 11054 10311 10969 -1297 -1184 1191 N ATOM 3872 CA LEU E 966 -20.624 12.171 13.862 1.00 82.08 C ANISOU 3872 CA LEU E 966 10034 10211 10941 -648 -1209 1410 C ATOM 3873 C LEU E 966 -19.800 11.247 14.763 1.00 81.57 C ANISOU 3873 C LEU E 966 9178 10735 11079 -959 -1329 1494 C ATOM 3874 O LEU E 966 -20.199 11.051 15.929 1.00 77.50 O ANISOU 3874 O LEU E 966 8553 10378 10516 -682 -1330 1591 O ATOM 3875 CB LEU E 966 -21.450 11.347 12.873 1.00 71.75 C ANISOU 3875 CB LEU E 966 8168 8948 10147 -104 -1192 1543 C ATOM 3876 CG LEU E 966 -22.616 12.068 12.205 1.00 79.64 C ANISOU 3876 CG LEU E 966 9806 9471 10982 468 -1074 1520 C ATOM 3877 CD1 LEU E 966 -23.290 11.137 11.206 1.00 77.29 C ANISOU 3877 CD1 LEU E 966 8820 9339 11208 914 -1066 1623 C ATOM 3878 CD2 LEU E 966 -23.615 12.584 13.233 1.00 75.06 C ANISOU 3878 CD2 LEU E 966 9704 8697 10119 996 -998 1558 C ATOM 3879 N SER E 967 -18.710 10.682 14.238 1.00 87.68 N ANISOU 3879 N SER E 967 9411 11835 12069 -1483 -1422 1465 N ATOM 3880 CA SER E 967 -17.831 9.748 14.988 1.00 78.44 C ANISOU 3880 CA SER E 967 7439 11271 11093 -1771 -1537 1557 C ATOM 3881 C SER E 967 -17.221 10.484 16.190 1.00 88.74 C ANISOU 3881 C SER E 967 9187 12672 11857 -2176 -1566 1432 C ATOM 3882 O SER E 967 -17.099 9.854 17.271 1.00 87.42 O ANISOU 3882 O SER E 967 8527 12930 11760 -2070 -1624 1566 O ATOM 3883 CB SER E 967 -16.797 9.118 14.094 1.00 75.03 C ANISOU 3883 CB SER E 967 6422 11132 10953 -2246 -1619 1529 C ATOM 3884 OG SER E 967 -16.632 9.869 12.901 1.00 89.48 O ANISOU 3884 OG SER E 967 8793 12564 12640 -2525 -1579 1350 O ATOM 3885 N SER E 968 -16.917 11.778 16.022 1.00 80.53 N ANISOU 3885 N SER E 968 9071 11239 10288 -2593 -1502 1184 N ATOM 3886 CA SER E 968 -16.406 12.686 17.086 1.00 88.78 C ANISOU 3886 CA SER E 968 10698 12290 10745 -3023 -1481 1003 C ATOM 3887 C SER E 968 -17.476 12.883 18.169 1.00 85.78 C ANISOU 3887 C SER E 968 10590 11767 10235 -2439 -1417 1117 C ATOM 3888 O SER E 968 -17.121 12.886 19.366 1.00 82.55 O ANISOU 3888 O SER E 968 10091 11681 9595 -2607 -1460 1107 O ATOM 3889 CB SER E 968 -15.953 14.012 16.513 1.00 93.60 C ANISOU 3889 CB SER E 968 12284 12428 10852 -3568 -1367 705 C ATOM 3890 OG SER E 968 -15.707 14.955 17.548 1.00 92.61 O ANISOU 3890 OG SER E 968 12814 12221 10151 -3893 -1292 522 O ATOM 3891 N ASN E 969 -18.732 13.066 17.761 1.00 81.31 N ANISOU 3891 N ASN E 969 10348 10758 9788 -1782 -1317 1210 N ATOM 3892 CA ASN E 969 -19.865 13.329 18.685 1.00 81.89 C ANISOU 3892 CA ASN E 969 10745 10639 9730 -1181 -1240 1302 C ATOM 3893 C ASN E 969 -20.172 12.062 19.486 1.00 78.00 C ANISOU 3893 C ASN E 969 9325 10655 9658 -778 -1326 1549 C ATOM 3894 O ASN E 969 -20.379 12.185 20.692 1.00 86.19 O ANISOU 3894 O ASN E 969 10456 11807 10484 -666 -1322 1581 O ATOM 3895 CB ASN E 969 -21.106 13.827 17.945 1.00 86.64 C ANISOU 3895 CB ASN E 969 11891 10685 10345 -567 -1114 1326 C ATOM 3896 CG ASN E 969 -20.976 15.249 17.444 1.00 96.95 C ANISOU 3896 CG ASN E 969 14306 11406 11125 -857 -977 1101 C ATOM 3897 OD1 ASN E 969 -19.895 15.837 17.479 1.00 92.71 O ANISOU 3897 OD1 ASN E 969 14114 10863 10250 -1590 -966 900 O ATOM 3898 ND2 ASN E 969 -22.080 15.811 16.976 1.00105.51 N ANISOU 3898 ND2 ASN E 969 15964 12004 12121 -277 -852 1126 N ATOM 3899 N PHE E 970 -20.211 10.894 18.841 1.00 79.17 N ANISOU 3899 N PHE E 970 8629 11081 10372 -572 -1380 1715 N ATOM 3900 CA PHE E 970 -20.542 9.599 19.492 1.00 82.60 C ANISOU 3900 CA PHE E 970 8172 11961 11251 -159 -1414 1963 C ATOM 3901 C PHE E 970 -19.446 9.187 20.477 1.00 89.07 C ANISOU 3901 C PHE E 970 8554 13323 11964 -598 -1523 1998 C ATOM 3902 O PHE E 970 -19.794 8.647 21.552 1.00 89.66 O ANISOU 3902 O PHE E 970 8298 13660 12108 -274 -1523 2159 O ATOM 3903 CB PHE E 970 -20.699 8.473 18.471 1.00 77.96 C ANISOU 3903 CB PHE E 970 6813 11530 11277 66 -1409 2100 C ATOM 3904 CG PHE E 970 -22.006 8.482 17.728 1.00 73.50 C ANISOU 3904 CG PHE E 970 6390 10610 10926 688 -1297 2129 C ATOM 3905 CD1 PHE E 970 -23.207 8.646 18.398 1.00 76.31 C ANISOU 3905 CD1 PHE E 970 6987 10796 11210 1292 -1211 2187 C ATOM 3906 CD2 PHE E 970 -22.030 8.303 16.359 1.00 68.14 C ANISOU 3906 CD2 PHE E 970 5568 9809 10513 671 -1279 2090 C ATOM 3907 CE1 PHE E 970 -24.405 8.648 17.705 1.00 74.78 C ANISOU 3907 CE1 PHE E 970 6884 10341 11187 1873 -1110 2195 C ATOM 3908 CE2 PHE E 970 -23.228 8.309 15.668 1.00 67.82 C ANISOU 3908 CE2 PHE E 970 5626 9506 10636 1249 -1177 2101 C ATOM 3909 CZ PHE E 970 -24.412 8.482 16.341 1.00 69.55 C ANISOU 3909 CZ PHE E 970 6188 9556 10680 1786 -1058 2046 C ATOM 3910 N GLY E 971 -18.175 9.364 20.093 1.00 94.07 N ANISOU 3910 N GLY E 971 9135 14157 12452 -1289 -1610 1857 N ATOM 3911 CA GLY E 971 -17.032 9.227 21.012 1.00 79.68 C ANISOU 3911 CA GLY E 971 7023 12865 10385 -1787 -1719 1825 C ATOM 3912 C GLY E 971 -17.291 10.008 22.290 1.00 83.39 C ANISOU 3912 C GLY E 971 8050 13278 10358 -1773 -1690 1751 C ATOM 3913 O GLY E 971 -17.351 9.378 23.369 1.00 87.02 O ANISOU 3913 O GLY E 971 8057 14135 10873 -1544 -1729 1922 O ATOM 3914 N ALA E 972 -17.503 11.323 22.147 1.00 89.69 N ANISOU 3914 N ALA E 972 9816 13566 10698 -1973 -1600 1515 N ATOM 3915 CA ALA E 972 -17.739 12.296 23.240 1.00 92.91 C ANISOU 3915 CA ALA E 972 10926 13810 10565 -2038 -1534 1385 C ATOM 3916 C ALA E 972 -18.901 11.825 24.122 1.00 95.19 C ANISOU 3916 C ALA E 972 11036 14097 11034 -1296 -1500 1615 C ATOM 3917 O ALA E 972 -18.766 11.897 25.356 1.00100.86 O ANISOU 3917 O ALA E 972 11744 15090 11490 -1349 -1525 1625 O ATOM 3918 CB ALA E 972 -17.991 13.674 22.665 1.00 89.59 C ANISOU 3918 CB ALA E 972 11583 12721 9736 -2231 -1390 1135 C ATOM 3919 N ILE E 973 -19.993 11.352 23.515 1.00 93.21 N ANISOU 3919 N ILE E 973 10633 13579 11205 -644 -1440 1777 N ATOM 3920 CA ILE E 973 -21.212 10.883 24.240 1.00 91.28 C ANISOU 3920 CA ILE E 973 10219 13304 11161 93 -1383 1975 C ATOM 3921 C ILE E 973 -20.828 9.669 25.097 1.00 89.72 C ANISOU 3921 C ILE E 973 9116 13736 11237 172 -1468 2197 C ATOM 3922 O ILE E 973 -21.144 9.686 26.299 1.00 89.70 O ANISOU 3922 O ILE E 973 9156 13870 11056 364 -1458 2262 O ATOM 3923 CB ILE E 973 -22.366 10.567 23.261 1.00 92.89 C ANISOU 3923 CB ILE E 973 10364 13164 11767 714 -1296 2066 C ATOM 3924 CG1 ILE E 973 -22.914 11.828 22.588 1.00 89.06 C ANISOU 3924 CG1 ILE E 973 10846 12045 10947 773 -1194 1878 C ATOM 3925 CG2 ILE E 973 -23.475 9.787 23.956 1.00 97.61 C ANISOU 3925 CG2 ILE E 973 10553 13871 12664 1418 -1239 2272 C ATOM 3926 CD1 ILE E 973 -23.742 11.559 21.346 1.00 80.86 C ANISOU 3926 CD1 ILE E 973 9711 10747 10266 1236 -1134 1928 C ATOM 3927 N SER E 974 -20.177 8.665 24.495 1.00104.23 N ANISOU 3927 N SER E 974 10188 15932 13484 42 -1534 2313 N ATOM 3928 CA SER E 974 -19.774 7.378 25.134 1.00 99.95 C ANISOU 3928 CA SER E 974 8731 15983 13261 162 -1587 2559 C ATOM 3929 C SER E 974 -18.877 7.650 26.349 1.00102.19 C ANISOU 3929 C SER E 974 9031 16701 13094 -244 -1685 2515 C ATOM 3930 O SER E 974 -19.068 6.993 27.398 1.00 96.70 O ANISOU 3930 O SER E 974 7940 16337 12464 64 -1682 2711 O ATOM 3931 CB SER E 974 -19.081 6.469 24.140 1.00 97.42 C ANISOU 3931 CB SER E 974 8198 15554 13265 -17 -1456 2385 C ATOM 3932 OG SER E 974 -18.926 5.157 24.662 1.00 94.55 O ANISOU 3932 OG SER E 974 7831 15054 13040 187 -1228 2218 O ATOM 3933 N SER E 975 -17.928 8.578 26.203 1.00100.26 N ANISOU 3933 N SER E 975 9230 16469 12397 -922 -1752 2253 N ATOM 3934 CA SER E 975 -17.046 9.061 27.297 1.00102.10 C ANISOU 3934 CA SER E 975 9588 17108 12099 -1405 -1833 2127 C ATOM 3935 C SER E 975 -17.915 9.573 28.455 1.00101.98 C ANISOU 3935 C SER E 975 10039 16914 11796 -1071 -1762 2138 C ATOM 3936 O SER E 975 -17.764 9.052 29.576 1.00 98.79 O ANISOU 3936 O SER E 975 9227 16976 11331 -944 -1810 2288 O ATOM 3937 CB SER E 975 -16.093 10.127 26.806 1.00106.45 C ANISOU 3937 CB SER E 975 10683 17566 12197 -2182 -1859 1783 C ATOM 3938 OG SER E 975 -16.693 11.417 26.848 1.00113.64 O ANISOU 3938 OG SER E 975 12594 17877 12708 -2237 -1736 1563 O ATOM 3939 N VAL E 976 -18.816 10.524 28.172 1.00103.38 N ANISOU 3939 N VAL E 976 11028 16441 11812 -897 -1644 2000 N ATOM 3940 CA VAL E 976 -19.674 11.219 29.181 1.00101.78 C ANISOU 3940 CA VAL E 976 11416 15974 11282 -617 -1556 1962 C ATOM 3941 C VAL E 976 -20.608 10.196 29.835 1.00 96.44 C ANISOU 3941 C VAL E 976 10195 15451 10995 111 -1535 2266 C ATOM 3942 O VAL E 976 -20.845 10.317 31.042 1.00 95.62 O ANISOU 3942 O VAL E 976 10181 15502 10648 233 -1528 2303 O ATOM 3943 CB VAL E 976 -20.476 12.388 28.571 1.00 93.26 C ANISOU 3943 CB VAL E 976 11302 14140 9992 -512 -1416 1772 C ATOM 3944 CG1 VAL E 976 -21.406 13.022 29.591 1.00 95.16 C ANISOU 3944 CG1 VAL E 976 12106 14115 9937 -169 -1318 1751 C ATOM 3945 CG2 VAL E 976 -19.573 13.451 27.967 1.00102.83 C ANISOU 3945 CG2 VAL E 976 13137 15148 10785 -1245 -1391 1460 C ATOM 3946 N LEU E 977 -21.139 9.247 29.066 1.00104.91 N ANISOU 3946 N LEU E 977 10748 16473 12639 560 -1506 2460 N ATOM 3947 CA LEU E 977 -22.057 8.198 29.585 1.00108.30 C ANISOU 3947 CA LEU E 977 10641 17029 13480 1242 -1443 2734 C ATOM 3948 C LEU E 977 -21.308 7.303 30.580 1.00110.05 C ANISOU 3948 C LEU E 977 10169 17913 13731 1162 -1521 2929 C ATOM 3949 O LEU E 977 -21.873 7.016 31.656 1.00109.80 O ANISOU 3949 O LEU E 977 10047 18003 13669 1532 -1478 3066 O ATOM 3950 CB LEU E 977 -22.628 7.384 28.416 1.00104.18 C ANISOU 3950 CB LEU E 977 9693 16343 13546 1623 -1372 2852 C ATOM 3951 CG LEU E 977 -23.851 7.990 27.723 1.00 99.61 C ANISOU 3951 CG LEU E 977 9669 15167 13010 2030 -1259 2747 C ATOM 3952 CD1 LEU E 977 -24.299 7.136 26.550 1.00 89.27 C ANISOU 3952 CD1 LEU E 977 8177 13558 12185 2130 -1094 2568 C ATOM 3953 CD2 LEU E 977 -25.003 8.172 28.701 1.00 95.55 C ANISOU 3953 CD2 LEU E 977 9427 14494 12385 2557 -1168 2793 C ATOM 3954 N ASN E 978 -20.085 6.888 30.237 1.00118.94 N ANISOU 3954 N ASN E 978 10831 19463 14899 710 -1629 2940 N ATOM 3955 CA ASN E 978 -19.242 5.990 31.070 1.00121.44 C ANISOU 3955 CA ASN E 978 10893 20040 15209 564 -1523 2896 C ATOM 3956 C ASN E 978 -18.853 6.706 32.373 1.00122.33 C ANISOU 3956 C ASN E 978 10927 20804 14747 356 -1756 3006 C ATOM 3957 O ASN E 978 -18.838 6.025 33.419 1.00122.45 O ANISOU 3957 O ASN E 978 10846 20903 14777 559 -1614 3049 O ATOM 3958 CB ASN E 978 -18.033 5.479 30.283 1.00124.76 C ANISOU 3958 CB ASN E 978 11174 20487 15744 158 -1491 2741 C ATOM 3959 CG ASN E 978 -18.422 4.490 29.202 1.00121.89 C ANISOU 3959 CG ASN E 978 10956 19484 15873 399 -1259 2577 C ATOM 3960 OD1 ASN E 978 -19.238 3.599 29.427 1.00121.44 O ANISOU 3960 OD1 ASN E 978 11045 19041 16054 764 -1063 2508 O ATOM 3961 ND2 ASN E 978 -17.851 4.641 28.018 1.00119.51 N ANISOU 3961 ND2 ASN E 978 10657 19091 15662 121 -1300 2458 N ATOM 3962 N ASP E 979 -18.560 8.013 32.316 1.00122.44 N ANISOU 3962 N ASP E 979 11637 20629 14256 -141 -1804 2708 N ATOM 3963 CA ASP E 979 -18.236 8.861 33.502 1.00121.76 C ANISOU 3963 CA ASP E 979 11973 20739 13550 -468 -1838 2540 C ATOM 3964 C ASP E 979 -19.455 8.947 34.428 1.00127.72 C ANISOU 3964 C ASP E 979 13001 21239 14286 97 -1739 2649 C ATOM 3965 O ASP E 979 -19.260 8.906 35.662 1.00123.98 O ANISOU 3965 O ASP E 979 12419 21168 13520 82 -1776 2700 O ATOM 3966 CB ASP E 979 -17.790 10.276 33.113 1.00126.33 C ANISOU 3966 CB ASP E 979 13376 20997 13627 -1117 -1821 2148 C ATOM 3967 CG ASP E 979 -16.283 10.470 33.056 1.00135.20 C ANISOU 3967 CG ASP E 979 14298 22658 14415 -1887 -1939 1953 C ATOM 3968 OD1 ASP E 979 -15.589 9.580 32.524 1.00137.68 O ANISOU 3968 OD1 ASP E 979 13906 23368 15038 -1950 -2034 2086 O ATOM 3969 OD2 ASP E 979 -15.815 11.511 33.553 1.00140.58 O ANISOU 3969 OD2 ASP E 979 15527 23370 14518 -2426 -1922 1655 O ATOM 3970 N ILE E 980 -20.656 9.083 33.853 1.00123.67 N ANISOU 3970 N ILE E 980 12828 20111 14049 571 -1617 2671 N ATOM 3971 CA ILE E 980 -21.935 9.239 34.607 1.00119.66 C ANISOU 3971 CA ILE E 980 12637 19296 13533 1133 -1508 2741 C ATOM 3972 C ILE E 980 -22.266 7.911 35.299 1.00111.98 C ANISOU 3972 C ILE E 980 10892 18717 12938 1653 -1494 3078 C ATOM 3973 O ILE E 980 -22.754 7.964 36.440 1.00106.55 O ANISOU 3973 O ILE E 980 10306 18110 12067 1897 -1460 3141 O ATOM 3974 CB ILE E 980 -23.072 9.735 33.687 1.00115.87 C ANISOU 3974 CB ILE E 980 12689 18106 13232 1495 -1386 2655 C ATOM 3975 CG1 ILE E 980 -22.897 11.215 33.332 1.00109.93 C ANISOU 3975 CG1 ILE E 980 12875 16905 11988 1051 -1353 2328 C ATOM 3976 CG2 ILE E 980 -24.433 9.468 34.316 1.00121.26 C ANISOU 3976 CG2 ILE E 980 13413 18582 14079 2195 -1275 2791 C ATOM 3977 CD1 ILE E 980 -23.739 11.678 32.168 1.00109.81 C ANISOU 3977 CD1 ILE E 980 13332 16253 12137 1335 -1251 2247 C ATOM 3978 N LEU E 981 -22.005 6.777 34.639 1.00123.33 N ANISOU 3978 N LEU E 981 11643 20342 14874 1790 -1482 3259 N ATOM 3979 CA LEU E 981 -22.276 5.413 35.175 1.00120.86 C ANISOU 3979 CA LEU E 981 11225 19745 14950 1956 -1167 3163 C ATOM 3980 C LEU E 981 -21.313 5.076 36.322 1.00127.17 C ANISOU 3980 C LEU E 981 11746 21099 15474 1748 -1219 3256 C ATOM 3981 O LEU E 981 -21.749 4.383 37.261 1.00125.52 O ANISOU 3981 O LEU E 981 11559 20794 15338 1977 -1053 3280 O ATOM 3982 CB LEU E 981 -22.148 4.393 34.041 1.00108.86 C ANISOU 3982 CB LEU E 981 9691 17783 13886 1844 -989 2969 C ATOM 3983 CG LEU E 981 -23.295 4.388 33.035 1.00108.39 C ANISOU 3983 CG LEU E 981 9922 17131 14130 2062 -873 2795 C ATOM 3984 CD1 LEU E 981 -23.016 3.396 31.914 1.00100.54 C ANISOU 3984 CD1 LEU E 981 8925 15817 13460 1874 -763 2572 C ATOM 3985 CD2 LEU E 981 -24.622 4.075 33.719 1.00 99.91 C ANISOU 3985 CD2 LEU E 981 9090 15727 13143 2389 -718 2706 C ATOM 3986 N SER E 982 -20.054 5.524 36.237 1.00131.53 N ANISOU 3986 N SER E 982 12066 22212 15697 1281 -1439 3272 N ATOM 3987 CA SER E 982 -19.020 5.365 37.295 1.00134.30 C ANISOU 3987 CA SER E 982 12160 23180 15688 1015 -1513 3314 C ATOM 3988 C SER E 982 -19.360 6.255 38.494 1.00142.31 C ANISOU 3988 C SER E 982 13282 24628 16160 1061 -1707 3399 C ATOM 3989 O SER E 982 -19.108 5.818 39.629 1.00152.43 O ANISOU 3989 O SER E 982 14414 26200 17302 1127 -1636 3462 O ATOM 3990 CB SER E 982 -17.636 5.665 36.780 1.00135.27 C ANISOU 3990 CB SER E 982 12087 23740 15570 418 -1680 3201 C ATOM 3991 OG SER E 982 -17.195 4.637 35.907 1.00131.05 O ANISOU 3991 OG SER E 982 11493 22816 15483 438 -1485 3135 O ATOM 3992 N ARG E 983 -19.893 7.457 38.247 1.00132.19 N ANISOU 3992 N ARG E 983 12637 23002 14589 934 -1767 3218 N ATOM 3993 CA ARG E 983 -20.284 8.437 39.298 1.00126.75 C ANISOU 3993 CA ARG E 983 12573 22193 13392 846 -1739 3046 C ATOM 3994 C ARG E 983 -21.552 7.975 40.019 1.00119.75 C ANISOU 3994 C ARG E 983 11664 21101 12733 1552 -1624 3262 C ATOM 3995 O ARG E 983 -21.725 8.371 41.181 1.00121.82 O ANISOU 3995 O ARG E 983 12158 21505 12623 1556 -1621 3228 O ATOM 3996 CB ARG E 983 -20.555 9.816 38.700 1.00129.88 C ANISOU 3996 CB ARG E 983 13884 21962 13501 508 -1677 2693 C ATOM 3997 CG ARG E 983 -19.305 10.652 38.468 1.00134.41 C ANISOU 3997 CG ARG E 983 14713 22756 13601 -321 -1757 2381 C ATOM 3998 CD ARG E 983 -19.618 12.007 37.863 1.00138.10 C ANISOU 3998 CD ARG E 983 16146 22538 13789 -625 -1646 2046 C ATOM 3999 NE ARG E 983 -18.443 12.810 37.566 1.00144.01 N ANISOU 3999 NE ARG E 983 17175 23448 14093 -1450 -1681 1720 N ATOM 4000 CZ ARG E 983 -18.385 14.139 37.651 1.00146.62 C ANISOU 4000 CZ ARG E 983 18377 23412 13919 -1911 -1569 1374 C ATOM 4001 NH1 ARG E 983 -19.437 14.844 38.043 1.00143.07 N ANISOU 4001 NH1 ARG E 983 18619 22408 13334 -1604 -1424 1319 N ATOM 4002 NH2 ARG E 983 -17.259 14.763 37.351 1.00150.28 N ANISOU 4002 NH2 ARG E 983 19027 24072 14002 -2691 -1582 1070 N ATOM 4003 N LEU E 984 -22.426 7.239 39.322 1.00127.34 N ANISOU 4003 N LEU E 984 12397 21725 14263 2094 -1520 3441 N ATOM 4004 CA LEU E 984 -23.642 6.598 39.893 1.00127.98 C ANISOU 4004 CA LEU E 984 12472 21476 14678 2686 -1306 3538 C ATOM 4005 C LEU E 984 -23.221 5.438 40.795 1.00134.10 C ANISOU 4005 C LEU E 984 12913 22425 15612 2631 -1125 3559 C ATOM 4006 O LEU E 984 -23.770 5.336 41.907 1.00138.21 O ANISOU 4006 O LEU E 984 13511 22979 16022 2866 -1047 3613 O ATOM 4007 CB LEU E 984 -24.553 6.079 38.773 1.00120.29 C ANISOU 4007 CB LEU E 984 11654 19760 14291 2891 -1063 3376 C ATOM 4008 CG LEU E 984 -25.646 7.031 38.291 1.00114.61 C ANISOU 4008 CG LEU E 984 11428 18618 13501 3232 -1084 3334 C ATOM 4009 CD1 LEU E 984 -26.365 6.434 37.093 1.00111.53 C ANISOU 4009 CD1 LEU E 984 11110 17612 13655 3276 -872 3107 C ATOM 4010 CD2 LEU E 984 -26.641 7.347 39.399 1.00120.39 C ANISOU 4010 CD2 LEU E 984 12477 19220 14047 3598 -1008 3342 C ATOM 4011 N ASP E 985 -22.299 4.594 40.317 1.00141.56 N ANISOU 4011 N ASP E 985 13579 23436 16770 2354 -1057 3525 N ATOM 4012 CA ASP E 985 -21.826 3.372 41.025 1.00143.91 C ANISOU 4012 CA ASP E 985 13685 23820 17176 2334 -886 3568 C ATOM 4013 C ASP E 985 -21.206 3.765 42.375 1.00145.14 C ANISOU 4013 C ASP E 985 13645 24674 16829 2263 -1020 3705 C ATOM 4014 O ASP E 985 -21.556 3.119 43.385 1.00141.71 O ANISOU 4014 O ASP E 985 13209 24224 16409 2481 -867 3781 O ATOM 4015 CB ASP E 985 -20.867 2.563 40.145 1.00145.20 C ANISOU 4015 CB ASP E 985 13698 23914 17559 2072 -841 3504 C ATOM 4016 CG ASP E 985 -21.554 1.819 39.011 1.00143.00 C ANISOU 4016 CG ASP E 985 13641 22925 17767 2150 -676 3331 C ATOM 4017 OD1 ASP E 985 -22.706 1.384 39.208 1.00140.00 O ANISOU 4017 OD1 ASP E 985 13485 22120 17590 2385 -524 3256 O ATOM 4018 OD2 ASP E 985 -20.930 1.678 37.939 1.00143.26 O ANISOU 4018 OD2 ASP E 985 13627 22864 17940 1935 -713 3241 O ATOM 4019 N LYS E 986 -20.350 4.799 42.390 1.00149.60 N ATOM 4020 CA LYS E 986 -19.631 5.312 43.594 1.00151.25 C ATOM 4021 C LYS E 986 -20.605 5.988 44.567 1.00150.58 C ATOM 4022 O LYS E 986 -20.228 6.153 45.746 1.00152.96 O ATOM 4023 CB LYS E 986 -18.536 6.306 43.198 1.00154.62 C ATOM 4024 CG LYS E 986 -17.359 5.683 42.464 1.00157.23 C ATOM 4025 CD LYS E 986 -16.286 6.669 42.076 1.00157.86 C ATOM 4026 CE LYS E 986 -15.262 6.053 41.148 1.00155.71 C ATOM 4027 NZ LYS E 986 -13.988 6.809 41.163 1.00161.41 N