>>6M17:HELIX    7 AA7 LYS A  112  ASN A  142  1                                  31    
KGLGLASMLTSFMVGLYYNTIISWIMWYLFN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 7 AA7 LYS A 112 ASN A 142 1 31 ATOM 837 N LYS A 112 122.617 126.754 106.458 1.00 68.38 N ATOM 838 CA LYS A 112 122.625 128.158 106.830 1.00 68.38 C ATOM 839 C LYS A 112 122.333 128.331 108.308 1.00 68.38 C ATOM 840 O LYS A 112 122.438 129.442 108.829 1.00 68.38 O ATOM 841 CB LYS A 112 121.611 128.936 105.989 1.00 68.38 C ATOM 842 CG LYS A 112 121.932 130.399 105.749 1.00 68.38 C ATOM 843 CD LYS A 112 121.003 130.973 104.695 1.00 68.38 C ATOM 844 CE LYS A 112 121.028 132.486 104.687 1.00 68.38 C ATOM 845 NZ LYS A 112 120.253 133.044 105.822 1.00 68.38 N ATOM 846 N GLY A 113 121.974 127.245 108.991 1.00 68.14 N ATOM 847 CA GLY A 113 121.795 127.306 110.425 1.00 68.14 C ATOM 848 C GLY A 113 123.096 127.465 111.179 1.00 68.14 C ATOM 849 O GLY A 113 123.099 127.960 112.305 1.00 68.14 O ATOM 850 N LEU A 114 124.217 127.053 110.577 1.00 67.11 N ATOM 851 CA LEU A 114 125.504 127.212 111.245 1.00 67.11 C ATOM 852 C LEU A 114 125.939 128.668 111.291 1.00 67.11 C ATOM 853 O LEU A 114 126.623 129.078 112.234 1.00 67.11 O ATOM 854 CB LEU A 114 126.583 126.384 110.556 1.00 67.11 C ATOM 855 CG LEU A 114 126.703 124.905 110.900 1.00 67.11 C ATOM 856 CD1 LEU A 114 125.808 124.076 110.014 1.00 67.11 C ATOM 857 CD2 LEU A 114 128.143 124.464 110.776 1.00 67.11 C ATOM 858 N GLY A 115 125.566 129.461 110.287 1.00 66.02 N ATOM 859 CA GLY A 115 125.870 130.877 110.332 1.00 66.02 C ATOM 860 C GLY A 115 124.960 131.648 111.257 1.00 66.02 C ATOM 861 O GLY A 115 125.370 132.662 111.826 1.00 66.02 O ATOM 862 N LEU A 116 123.724 131.187 111.425 1.00 63.75 N ATOM 863 CA LEU A 116 122.795 131.813 112.352 1.00 63.75 C ATOM 864 C LEU A 116 122.980 131.339 113.784 1.00 63.75 C ATOM 865 O LEU A 116 122.558 132.037 114.710 1.00 63.75 O ATOM 866 CB LEU A 116 121.353 131.549 111.919 1.00 63.75 C ATOM 867 CG LEU A 116 120.941 132.118 110.566 1.00 63.75 C ATOM 868 CD1 LEU A 116 119.528 131.694 110.223 1.00 63.75 C ATOM 869 CD2 LEU A 116 121.064 133.624 110.576 1.00 63.75 C ATOM 870 N ALA A 117 123.587 130.172 113.990 1.00 62.67 N ATOM 871 CA ALA A 117 123.895 129.743 115.347 1.00 62.67 C ATOM 872 C ALA A 117 125.209 130.328 115.835 1.00 62.67 C ATOM 873 O ALA A 117 125.375 130.536 117.039 1.00 62.67 O ATOM 874 CB ALA A 117 123.940 128.221 115.433 1.00 62.67 C ATOM 875 N SER A 118 126.147 130.601 114.927 1.00 64.06 N ATOM 876 CA SER A 118 127.385 131.265 115.309 1.00 64.06 C ATOM 877 C SER A 118 127.179 132.747 115.585 1.00 64.06 C ATOM 878 O SER A 118 128.018 133.365 116.247 1.00 64.06 O ATOM 879 CB SER A 118 128.438 131.084 114.219 1.00 64.06 C ATOM 880 OG SER A 118 128.858 129.735 114.135 1.00 64.06 O ATOM 881 N MET A 119 126.090 133.329 115.091 1.00 64.24 N ATOM 882 CA MET A 119 125.724 134.704 115.395 1.00 64.24 C ATOM 883 C MET A 119 124.957 134.804 116.706 1.00 64.24 C ATOM 884 O MET A 119 125.116 135.777 117.448 1.00 64.24 O ATOM 885 CB MET A 119 124.892 135.282 114.247 1.00 64.24 C ATOM 886 CG MET A 119 124.528 136.744 114.384 1.00 64.24 C ATOM 887 SD MET A 119 123.330 137.257 113.147 1.00 64.24 S ATOM 888 CE MET A 119 121.888 136.354 113.690 1.00 64.24 C ATOM 889 N LEU A 120 124.135 133.802 117.017 1.00 61.53 N ATOM 890 CA LEU A 120 123.353 133.838 118.245 1.00 61.53 C ATOM 891 C LEU A 120 124.160 133.405 119.459 1.00 61.53 C ATOM 892 O LEU A 120 123.802 133.757 120.585 1.00 61.53 O ATOM 893 CB LEU A 120 122.112 132.962 118.102 1.00 61.53 C ATOM 894 CG LEU A 120 120.977 133.594 117.306 1.00 61.53 C ATOM 895 CD1 LEU A 120 119.840 132.614 117.131 1.00 61.53 C ATOM 896 CD2 LEU A 120 120.501 134.844 118.009 1.00 61.53 C ATOM 897 N THR A 121 125.232 132.638 119.266 1.00 61.72 N ATOM 898 CA THR A 121 126.097 132.301 120.388 1.00 61.72 C ATOM 899 C THR A 121 127.222 133.305 120.579 1.00 61.72 C ATOM 900 O THR A 121 127.923 133.235 121.591 1.00 61.72 O ATOM 901 CB THR A 121 126.681 130.895 120.223 1.00 61.72 C ATOM 902 OG1 THR A 121 127.179 130.440 121.484 1.00 61.72 O ATOM 903 CG2 THR A 121 127.821 130.889 119.226 1.00 61.72 C ATOM 904 N SER A 122 127.417 134.226 119.639 1.00 61.48 N ATOM 905 CA SER A 122 128.338 135.335 119.825 1.00 61.48 C ATOM 906 C SER A 122 127.668 136.539 120.460 1.00 61.48 C ATOM 907 O SER A 122 128.359 137.386 121.031 1.00 61.48 O ATOM 908 CB SER A 122 128.953 135.748 118.488 1.00 61.48 C ATOM 909 OG SER A 122 129.900 134.794 118.048 1.00 61.48 O ATOM 910 N PHE A 123 126.345 136.632 120.367 1.00 62.06 N ATOM 911 CA PHE A 123 125.581 137.677 121.028 1.00 62.06 C ATOM 912 C PHE A 123 125.321 137.350 122.490 1.00 62.06 C ATOM 913 O PHE A 123 125.377 138.242 123.341 1.00 62.06 O ATOM 914 CB PHE A 123 124.255 137.892 120.296 1.00 62.06 C ATOM 915 CG PHE A 123 123.294 138.780 121.028 1.00 62.06 C ATOM 916 CD1 PHE A 123 123.525 140.139 121.118 1.00 62.06 C ATOM 917 CD2 PHE A 123 122.154 138.257 121.617 1.00 62.06 C ATOM 918 CE1 PHE A 123 122.645 140.958 121.788 1.00 62.06 C ATOM 919 CE2 PHE A 123 121.271 139.073 122.289 1.00 62.06 C ATOM 920 CZ PHE A 123 121.517 140.423 122.374 1.00 62.06 C ATOM 921 N MET A 124 125.044 136.083 122.802 1.00 64.94 N ATOM 922 CA MET A 124 124.708 135.710 124.171 1.00 64.94 C ATOM 923 C MET A 124 125.939 135.500 125.037 1.00 64.94 C ATOM 924 O MET A 124 125.876 135.732 126.247 1.00 64.94 O ATOM 925 CB MET A 124 123.844 134.451 124.179 1.00 64.94 C ATOM 926 CG MET A 124 122.393 134.723 123.867 1.00 64.94 C ATOM 927 SD MET A 124 121.382 133.238 123.851 1.00 64.94 S ATOM 928 CE MET A 124 119.839 133.898 123.226 1.00 64.94 C ATOM 929 N VAL A 125 127.052 135.052 124.457 1.00 61.88 N ATOM 930 CA VAL A 125 128.289 134.960 125.228 1.00 61.88 C ATOM 931 C VAL A 125 128.826 136.354 125.519 1.00 61.88 C ATOM 932 O VAL A 125 129.142 136.684 126.665 1.00 61.88 O ATOM 933 CB VAL A 125 129.323 134.083 124.499 1.00 61.88 C ATOM 934 CG1 VAL A 125 130.727 134.356 125.003 1.00 61.88 C ATOM 935 CG2 VAL A 125 128.991 132.623 124.695 1.00 61.88 C ATOM 936 N GLY A 126 128.869 137.214 124.503 1.00 58.67 N ATOM 937 CA GLY A 126 129.321 138.583 124.689 1.00 58.67 C ATOM 938 C GLY A 126 128.353 139.482 125.430 1.00 58.67 C ATOM 939 O GLY A 126 128.686 140.644 125.677 1.00 58.67 O ATOM 940 N LEU A 127 127.167 138.983 125.777 1.00 57.57 N ATOM 941 CA LEU A 127 126.260 139.742 126.627 1.00 57.57 C ATOM 942 C LEU A 127 126.767 139.784 128.062 1.00 57.57 C ATOM 943 O LEU A 127 126.900 140.862 128.649 1.00 57.57 O ATOM 944 CB LEU A 127 124.861 139.136 126.566 1.00 57.57 C ATOM 945 CG LEU A 127 123.772 139.847 127.360 1.00 57.57 C ATOM 946 CD1 LEU A 127 123.669 141.285 126.921 1.00 57.57 C ATOM 947 CD2 LEU A 127 122.450 139.136 127.179 1.00 57.57 C ATOM 948 N TYR A 128 127.061 138.621 128.644 1.00 57.87 N ATOM 949 CA TYR A 128 127.555 138.571 130.013 1.00 57.87 C ATOM 950 C TYR A 128 129.059 138.767 130.111 1.00 57.87 C ATOM 951 O TYR A 128 129.549 139.136 131.181 1.00 57.87 O ATOM 952 CB TYR A 128 127.159 137.247 130.685 1.00 57.87 C ATOM 953 CG TYR A 128 127.947 136.018 130.271 1.00 57.87 C ATOM 954 CD1 TYR A 128 127.558 135.265 129.176 1.00 57.87 C ATOM 955 CD2 TYR A 128 129.045 135.581 131.007 1.00 57.87 C ATOM 956 CE1 TYR A 128 128.260 134.139 128.801 1.00 57.87 C ATOM 957 CE2 TYR A 128 129.756 134.465 130.632 1.00 57.87 C ATOM 958 CZ TYR A 128 129.357 133.746 129.532 1.00 57.87 C ATOM 959 OH TYR A 128 130.060 132.626 129.167 1.00 57.87 O ATOM 960 N TYR A 129 129.800 138.510 129.035 1.00 56.30 N ATOM 961 CA TYR A 129 131.248 138.675 129.054 1.00 56.30 C ATOM 962 C TYR A 129 131.657 140.133 129.150 1.00 56.30 C ATOM 963 O TYR A 129 132.755 140.424 129.627 1.00 56.30 O ATOM 964 CB TYR A 129 131.839 138.043 127.800 1.00 56.30 C ATOM 965 CG TYR A 129 133.337 137.885 127.749 1.00 56.30 C ATOM 966 CD1 TYR A 129 133.953 136.740 128.231 1.00 56.30 C ATOM 967 CD2 TYR A 129 134.128 138.857 127.160 1.00 56.30 C ATOM 968 CE1 TYR A 129 135.322 136.590 128.154 1.00 56.30 C ATOM 969 CE2 TYR A 129 135.486 138.717 127.081 1.00 56.30 C ATOM 970 CZ TYR A 129 136.078 137.587 127.574 1.00 56.30 C ATOM 971 OH TYR A 129 137.439 137.469 127.474 1.00 56.30 O ATOM 972 N ASN A 130 130.807 141.049 128.707 1.00 54.39 N ATOM 973 CA ASN A 130 131.072 142.473 128.824 1.00 54.39 C ATOM 974 C ASN A 130 130.467 143.055 130.097 1.00 54.39 C ATOM 975 O ASN A 130 130.523 144.269 130.304 1.00 54.39 O ATOM 976 CB ASN A 130 130.541 143.197 127.584 1.00 54.39 C ATOM 977 CG ASN A 130 131.272 144.494 127.303 1.00 54.39 C ATOM 978 OD1 ASN A 130 132.174 144.884 128.031 1.00 54.39 O ATOM 979 ND2 ASN A 130 130.899 145.151 126.220 1.00 54.39 N ATOM 980 N THR A 131 129.881 142.214 130.945 1.00 51.33 N ATOM 981 CA THR A 131 129.488 142.594 132.294 1.00 51.33 C ATOM 982 C THR A 131 130.610 142.329 133.286 1.00 51.33 C ATOM 983 O THR A 131 130.784 143.086 134.245 1.00 51.33 O ATOM 984 CB THR A 131 128.225 141.836 132.702 1.00 51.33 C ATOM 985 OG1 THR A 131 127.257 141.940 131.654 1.00 51.33 O ATOM 986 CG2 THR A 131 127.631 142.417 133.956 1.00 51.33 C ATOM 987 N ILE A 132 131.390 141.272 133.051 1.00 52.57 N ATOM 988 CA ILE A 132 132.574 140.993 133.858 1.00 52.57 C ATOM 989 C ILE A 132 133.625 142.080 133.671 1.00 52.57 C ATOM 990 O ILE A 132 134.353 142.418 134.610 1.00 52.57 O ATOM 991 CB ILE A 132 133.112 139.589 133.510 1.00 52.57 C ATOM 992 CG1 ILE A 132 132.005 138.551 133.672 1.00 52.57 C ATOM 993 CG2 ILE A 132 134.277 139.199 134.391 1.00 52.57 C ATOM 994 CD1 ILE A 132 132.410 137.160 133.260 1.00 52.57 C ATOM 995 N ILE A 133 133.695 142.673 132.477 1.00 50.72 N ATOM 996 CA ILE A 133 134.616 143.782 132.247 1.00 50.72 C ATOM 997 C ILE A 133 134.143 145.037 132.971 1.00 50.72 C ATOM 998 O ILE A 133 134.961 145.837 133.436 1.00 50.72 O ATOM 999 CB ILE A 133 134.788 144.017 130.735 1.00 50.72 C ATOM 1000 CG1 ILE A 133 135.118 142.704 130.038 1.00 50.72 C ATOM 1001 CG2 ILE A 133 135.894 145.010 130.447 1.00 50.72 C ATOM 1002 CD1 ILE A 133 135.181 142.819 128.549 1.00 50.72 C ATOM 1003 N SER A 134 132.829 145.221 133.115 1.00 49.24 N ATOM 1004 CA SER A 134 132.333 146.356 133.884 1.00 49.24 C ATOM 1005 C SER A 134 132.561 146.186 135.379 1.00 49.24 C ATOM 1006 O SER A 134 132.615 147.185 136.098 1.00 49.24 O ATOM 1007 CB SER A 134 130.849 146.578 133.620 1.00 49.24 C ATOM 1008 OG SER A 134 130.081 145.533 134.176 1.00 49.24 O ATOM 1009 N TRP A 135 132.682 144.950 135.865 1.00 50.01 N ATOM 1010 CA TRP A 135 133.101 144.739 137.245 1.00 50.01 C ATOM 1011 C TRP A 135 134.598 144.946 137.414 1.00 50.01 C ATOM 1012 O TRP A 135 135.046 145.333 138.496 1.00 50.01 O ATOM 1013 CB TRP A 135 132.717 143.337 137.714 1.00 50.01 C ATOM 1014 CG TRP A 135 131.251 143.131 137.862 1.00 50.01 C ATOM 1015 CD1 TRP A 135 130.305 144.092 138.001 1.00 50.01 C ATOM 1016 CD2 TRP A 135 130.560 141.880 137.890 1.00 50.01 C ATOM 1017 NE1 TRP A 135 129.062 143.523 138.107 1.00 50.01 N ATOM 1018 CE2 TRP A 135 129.193 142.163 138.045 1.00 50.01 C ATOM 1019 CE3 TRP A 135 130.964 140.547 137.795 1.00 50.01 C ATOM 1020 CZ2 TRP A 135 128.231 141.168 138.104 1.00 50.01 C ATOM 1021 CZ3 TRP A 135 130.007 139.564 137.858 1.00 50.01 C ATOM 1022 CH2 TRP A 135 128.657 139.877 138.013 1.00 50.01 C ATOM 1023 N ILE A 136 135.381 144.691 136.368 1.00 49.21 N ATOM 1024 CA ILE A 136 136.814 144.957 136.410 1.00 49.21 C ATOM 1025 C ILE A 136 137.082 146.458 136.378 1.00 49.21 C ATOM 1026 O ILE A 136 137.982 146.955 137.063 1.00 49.21 O ATOM 1027 CB ILE A 136 137.503 144.205 135.253 1.00 49.21 C ATOM 1028 CG1 ILE A 136 137.529 142.710 135.550 1.00 49.21 C ATOM 1029 CG2 ILE A 136 138.915 144.686 135.008 1.00 49.21 C ATOM 1030 CD1 ILE A 136 137.942 141.871 134.382 1.00 49.21 C ATOM 1031 N MET A 137 136.273 147.212 135.627 1.00 49.16 N ATOM 1032 CA MET A 137 136.432 148.663 135.588 1.00 49.16 C ATOM 1033 C MET A 137 136.012 149.315 136.896 1.00 49.16 C ATOM 1034 O MET A 137 136.534 150.375 137.247 1.00 49.16 O ATOM 1035 CB MET A 137 135.634 149.258 134.432 1.00 49.16 C ATOM 1036 CG MET A 137 136.159 148.892 133.062 1.00 49.16 C ATOM 1037 SD MET A 137 135.435 149.878 131.745 1.00 49.16 S ATOM 1038 CE MET A 137 136.610 151.221 131.666 1.00 49.16 C ATOM 1039 N TRP A 138 135.082 148.704 137.630 1.00 46.78 N ATOM 1040 CA TRP A 138 134.696 149.241 138.929 1.00 46.78 C ATOM 1041 C TRP A 138 135.800 149.057 139.959 1.00 46.78 C ATOM 1042 O TRP A 138 135.965 149.900 140.844 1.00 46.78 O ATOM 1043 CB TRP A 138 133.399 148.583 139.395 1.00 46.78 C ATOM 1044 CG TRP A 138 133.133 148.666 140.861 1.00 46.78 C ATOM 1045 CD1 TRP A 138 133.325 147.684 141.780 1.00 46.78 C ATOM 1046 CD2 TRP A 138 132.608 149.786 141.579 1.00 46.78 C ATOM 1047 NE1 TRP A 138 132.959 148.119 143.027 1.00 46.78 N ATOM 1048 CE2 TRP A 138 132.516 149.409 142.929 1.00 46.78 C ATOM 1049 CE3 TRP A 138 132.210 151.072 141.212 1.00 46.78 C ATOM 1050 CZ2 TRP A 138 132.044 150.269 143.909 1.00 46.78 C ATOM 1051 CZ3 TRP A 138 131.743 151.920 142.186 1.00 46.78 C ATOM 1052 CH2 TRP A 138 131.663 151.517 143.518 1.00 46.78 C ATOM 1053 N TYR A 139 136.581 147.988 139.847 1.00 47.89 N ATOM 1054 CA TYR A 139 137.702 147.777 140.749 1.00 47.89 C ATOM 1055 C TYR A 139 138.932 148.580 140.360 1.00 47.89 C ATOM 1056 O TYR A 139 139.813 148.779 141.199 1.00 47.89 O ATOM 1057 CB TYR A 139 138.050 146.295 140.800 1.00 47.89 C ATOM 1058 CG TYR A 139 137.317 145.542 141.873 1.00 47.89 C ATOM 1059 CD1 TYR A 139 136.001 145.151 141.696 1.00 47.89 C ATOM 1060 CD2 TYR A 139 137.943 145.217 143.063 1.00 47.89 C ATOM 1061 CE1 TYR A 139 135.330 144.465 142.675 1.00 47.89 C ATOM 1062 CE2 TYR A 139 137.279 144.530 144.046 1.00 47.89 C ATOM 1063 CZ TYR A 139 135.975 144.157 143.847 1.00 47.89 C ATOM 1064 OH TYR A 139 135.317 143.472 144.833 1.00 47.89 O ATOM 1065 N LEU A 140 139.018 149.033 139.116 1.00 46.23 N ATOM 1066 CA LEU A 140 140.089 149.921 138.688 1.00 46.23 C ATOM 1067 C LEU A 140 139.823 151.367 139.081 1.00 46.23 C ATOM 1068 O LEU A 140 140.768 152.116 139.351 1.00 46.23 O ATOM 1069 CB LEU A 140 140.270 149.808 137.173 1.00 46.23 C ATOM 1070 CG LEU A 140 141.315 150.657 136.464 1.00 46.23 C ATOM 1071 CD1 LEU A 140 142.677 150.419 137.068 1.00 46.23 C ATOM 1072 CD2 LEU A 140 141.310 150.334 134.992 1.00 46.23 C ATOM 1073 N PHE A 141 138.554 151.771 139.132 1.00 44.64 N ATOM 1074 CA PHE A 141 138.216 153.116 139.577 1.00 44.64 C ATOM 1075 C PHE A 141 138.406 153.266 141.077 1.00 44.64 C ATOM 1076 O PHE A 141 138.686 154.368 141.558 1.00 44.64 O ATOM 1077 CB PHE A 141 136.772 153.448 139.204 1.00 44.64 C ATOM 1078 CG PHE A 141 136.519 153.517 137.727 1.00 44.64 C ATOM 1079 CD1 PHE A 141 137.537 153.821 136.840 1.00 44.64 C ATOM 1080 CD2 PHE A 141 135.250 153.294 137.228 1.00 44.64 C ATOM 1081 CE1 PHE A 141 137.297 153.883 135.485 1.00 44.64 C ATOM 1082 CE2 PHE A 141 135.005 153.357 135.874 1.00 44.64 C ATOM 1083 CZ PHE A 141 136.030 153.653 135.003 1.00 44.64 C ATOM 1084 N ASN A 142 138.264 152.176 141.825 1.00 47.91 N ATOM 1085 CA ASN A 142 138.333 152.184 143.277 1.00 47.91 C ATOM 1086 C ASN A 142 139.750 152.041 143.809 1.00 47.91 C ATOM 1087 O ASN A 142 139.931 151.877 145.016 1.00 47.91 O ATOM 1088 CB ASN A 142 137.452 151.079 143.842 1.00 47.91 C ATOM 1089 CG ASN A 142 136.043 151.538 144.073 1.00 47.91 C ATOM 1090 OD1 ASN A 142 135.126 151.139 143.365 1.00 47.91 O ATOM 1091 ND2 ASN A 142 135.859 152.393 145.065 1.00 47.91 N