>>6M17:HELIX   24 AC6 SER A  477  TYR A  507  1                                  31    
SGQYWLSLLDSYAGSIPLLIIAFCEMFSVVY
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 24 AC6 SER A 477 TYR A 507 1 31 ATOM 3700 N SER A 477 119.809 140.714 142.291 1.00 53.15 N ATOM 3701 CA SER A 477 120.018 139.321 141.925 1.00 53.15 C ATOM 3702 C SER A 477 120.793 139.170 140.628 1.00 53.15 C ATOM 3703 O SER A 477 120.664 138.146 139.952 1.00 53.15 O ATOM 3704 CB SER A 477 118.676 138.607 141.819 1.00 53.15 C ATOM 3705 OG SER A 477 117.952 139.087 140.705 1.00 53.15 O ATOM 3706 N GLY A 478 121.593 140.166 140.259 1.00 54.51 N ATOM 3707 CA GLY A 478 122.298 140.154 138.995 1.00 54.51 C ATOM 3708 C GLY A 478 123.530 139.287 138.945 1.00 54.51 C ATOM 3709 O GLY A 478 124.079 139.092 137.859 1.00 54.51 O ATOM 3710 N GLN A 479 123.993 138.774 140.080 1.00 54.43 N ATOM 3711 CA GLN A 479 125.085 137.814 140.054 1.00 54.43 C ATOM 3712 C GLN A 479 124.592 136.389 139.885 1.00 54.43 C ATOM 3713 O GLN A 479 125.316 135.553 139.337 1.00 54.43 O ATOM 3714 CB GLN A 479 125.923 137.912 141.328 1.00 54.43 C ATOM 3715 CG GLN A 479 127.358 137.464 141.140 1.00 54.43 C ATOM 3716 CD GLN A 479 127.563 136.006 141.474 1.00 54.43 C ATOM 3717 OE1 GLN A 479 127.224 135.554 142.565 1.00 54.43 O ATOM 3718 NE2 GLN A 479 128.114 135.258 140.530 1.00 54.43 N ATOM 3719 N TYR A 480 123.376 136.095 140.338 1.00 55.47 N ATOM 3720 CA TYR A 480 122.786 134.788 140.105 1.00 55.47 C ATOM 3721 C TYR A 480 122.354 134.601 138.660 1.00 55.47 C ATOM 3722 O TYR A 480 122.269 133.462 138.196 1.00 55.47 O ATOM 3723 CB TYR A 480 121.587 134.577 141.026 1.00 55.47 C ATOM 3724 CG TYR A 480 121.859 134.846 142.485 1.00 55.47 C ATOM 3725 CD1 TYR A 480 122.988 134.340 143.108 1.00 55.47 C ATOM 3726 CD2 TYR A 480 120.979 135.605 143.241 1.00 55.47 C ATOM 3727 CE1 TYR A 480 123.234 134.585 144.438 1.00 55.47 C ATOM 3728 CE2 TYR A 480 121.218 135.854 144.571 1.00 55.47 C ATOM 3729 CZ TYR A 480 122.344 135.339 145.163 1.00 55.47 C ATOM 3730 OH TYR A 480 122.582 135.588 146.490 1.00 55.47 O ATOM 3731 N TRP A 481 122.074 135.692 137.947 1.00 54.61 N ATOM 3732 CA TRP A 481 121.738 135.608 136.533 1.00 54.61 C ATOM 3733 C TRP A 481 122.970 135.402 135.669 1.00 54.61 C ATOM 3734 O TRP A 481 122.876 134.787 134.604 1.00 54.61 O ATOM 3735 CB TRP A 481 121.015 136.875 136.086 1.00 54.61 C ATOM 3736 CG TRP A 481 119.558 136.891 136.386 1.00 54.61 C ATOM 3737 CD1 TRP A 481 118.934 137.597 137.365 1.00 54.61 C ATOM 3738 CD2 TRP A 481 118.535 136.182 135.689 1.00 54.61 C ATOM 3739 NE1 TRP A 481 117.584 137.368 137.329 1.00 54.61 N ATOM 3740 CE2 TRP A 481 117.313 136.501 136.306 1.00 54.61 C ATOM 3741 CE3 TRP A 481 118.533 135.306 134.602 1.00 54.61 C ATOM 3742 CZ2 TRP A 481 116.103 135.974 135.876 1.00 54.61 C ATOM 3743 CZ3 TRP A 481 117.332 134.786 134.177 1.00 54.61 C ATOM 3744 CH2 TRP A 481 116.134 135.120 134.812 1.00 54.61 C ATOM 3745 N LEU A 482 124.124 135.907 136.097 1.00 54.00 N ATOM 3746 CA LEU A 482 125.330 135.764 135.296 1.00 54.00 C ATOM 3747 C LEU A 482 125.940 134.381 135.442 1.00 54.00 C ATOM 3748 O LEU A 482 126.521 133.868 134.485 1.00 54.00 O ATOM 3749 CB LEU A 482 126.349 136.837 135.679 1.00 54.00 C ATOM 3750 CG LEU A 482 127.527 137.096 134.738 1.00 54.00 C ATOM 3751 CD1 LEU A 482 127.770 138.578 134.653 1.00 54.00 C ATOM 3752 CD2 LEU A 482 128.788 136.403 135.209 1.00 54.00 C ATOM 3753 N SER A 483 125.810 133.733 136.586 1.00 56.03 N ATOM 3754 CA SER A 483 126.381 132.397 136.705 1.00 56.03 C ATOM 3755 C SER A 483 125.681 131.403 135.771 1.00 56.03 C ATOM 3756 O SER A 483 126.247 130.955 134.753 1.00 56.03 O ATOM 3757 CB SER A 483 126.299 131.914 138.147 1.00 56.03 C ATOM 3758 OG SER A 483 127.240 132.601 138.946 1.00 56.03 O ATOM 3759 N LEU A 484 124.436 131.099 136.121 1.00 57.26 N ATOM 3760 CA LEU A 484 123.585 130.197 135.364 1.00 57.26 C ATOM 3761 C LEU A 484 123.773 130.414 133.876 1.00 57.26 C ATOM 3762 O LEU A 484 124.296 129.545 133.167 1.00 57.26 O ATOM 3763 CB LEU A 484 122.124 130.433 135.749 1.00 57.26 C ATOM 3764 CG LEU A 484 121.037 130.345 134.681 1.00 57.26 C ATOM 3765 CD1 LEU A 484 120.464 128.941 134.649 1.00 57.26 C ATOM 3766 CD2 LEU A 484 119.939 131.355 134.956 1.00 57.26 C ATOM 3767 N LEU A 485 123.338 131.583 133.414 1.00 58.81 N ATOM 3768 CA LEU A 485 123.449 131.966 132.014 1.00 58.81 C ATOM 3769 C LEU A 485 124.824 131.600 131.505 1.00 58.81 C ATOM 3770 O LEU A 485 124.948 130.823 130.570 1.00 58.81 O ATOM 3771 CB LEU A 485 123.215 133.464 131.851 1.00 58.81 C ATOM 3772 CG LEU A 485 122.957 133.964 130.435 1.00 58.81 C ATOM 3773 CD1 LEU A 485 121.688 134.798 130.405 1.00 58.81 C ATOM 3774 CD2 LEU A 485 124.143 134.771 129.939 1.00 58.81 C ATOM 3775 N ASP A 486 125.845 132.152 132.153 1.00 61.51 N ATOM 3776 CA ASP A 486 127.239 131.898 131.818 1.00 61.51 C ATOM 3777 C ASP A 486 127.435 130.428 131.507 1.00 61.51 C ATOM 3778 O ASP A 486 127.481 130.038 130.342 1.00 61.51 O ATOM 3779 CB ASP A 486 128.136 132.319 132.985 1.00 61.51 C ATOM 3780 CG ASP A 486 129.546 131.767 132.879 1.00 61.51 C ATOM 3781 OD1 ASP A 486 129.952 131.371 131.772 1.00 61.51 O ATOM 3782 OD2 ASP A 486 130.253 131.734 133.906 1.00 61.51 O ATOM 3783 N SER A 487 127.522 129.624 132.557 1.00 62.79 N ATOM 3784 CA SER A 487 127.703 128.187 132.429 1.00 62.79 C ATOM 3785 C SER A 487 126.941 127.562 131.263 1.00 62.79 C ATOM 3786 O SER A 487 127.541 126.947 130.376 1.00 62.79 O ATOM 3787 CB SER A 487 127.298 127.493 133.728 1.00 62.79 C ATOM 3788 OG SER A 487 125.913 127.207 133.739 1.00 62.79 O ATOM 3789 N TYR A 488 125.622 127.723 131.247 1.00 64.72 N ATOM 3790 CA TYR A 488 124.848 127.098 130.175 1.00 64.72 C ATOM 3791 C TYR A 488 125.168 127.543 128.751 1.00 64.72 C ATOM 3792 O TYR A 488 125.458 126.715 127.895 1.00 64.72 O ATOM 3793 CB TYR A 488 123.351 127.168 130.460 1.00 64.72 C ATOM 3794 CG TYR A 488 122.898 126.026 131.329 1.00 64.72 C ATOM 3795 CD1 TYR A 488 122.804 124.744 130.820 1.00 64.72 C ATOM 3796 CD2 TYR A 488 122.599 126.223 132.667 1.00 64.72 C ATOM 3797 CE1 TYR A 488 122.404 123.691 131.614 1.00 64.72 C ATOM 3798 CE2 TYR A 488 122.198 125.177 133.470 1.00 64.72 C ATOM 3799 CZ TYR A 488 122.103 123.913 132.938 1.00 64.72 C ATOM 3800 OH TYR A 488 121.703 122.867 133.734 1.00 64.72 O ATOM 3801 N ALA A 489 125.118 128.842 128.498 1.00 65.67 N ATOM 3802 CA ALA A 489 125.384 129.362 127.166 1.00 65.67 C ATOM 3803 C ALA A 489 126.853 129.272 126.810 1.00 65.67 C ATOM 3804 O ALA A 489 127.253 129.643 125.712 1.00 65.67 O ATOM 3805 CB ALA A 489 124.904 130.797 127.056 1.00 65.67 C ATOM 3806 N GLY A 490 127.658 128.776 127.741 1.00 70.45 N ATOM 3807 CA GLY A 490 129.082 128.657 127.509 1.00 70.45 C ATOM 3808 C GLY A 490 129.512 127.218 127.368 1.00 70.45 C ATOM 3809 O GLY A 490 130.632 126.931 126.951 1.00 70.45 O ATOM 3810 N SER A 491 128.620 126.301 127.720 1.00 69.81 N ATOM 3811 CA SER A 491 128.948 124.889 127.619 1.00 69.81 C ATOM 3812 C SER A 491 128.245 124.214 126.455 1.00 69.81 C ATOM 3813 O SER A 491 128.886 123.644 125.581 1.00 69.81 O ATOM 3814 CB SER A 491 128.623 124.163 128.929 1.00 69.81 C ATOM 3815 OG SER A 491 127.304 123.646 128.924 1.00 69.81 O ATOM 3816 N ILE A 492 126.921 124.278 126.447 1.00 69.71 N ATOM 3817 CA ILE A 492 126.161 123.630 125.396 1.00 69.71 C ATOM 3818 C ILE A 492 126.485 124.171 124.006 1.00 69.71 C ATOM 3819 O ILE A 492 127.151 123.475 123.241 1.00 69.71 O ATOM 3820 CB ILE A 492 124.655 123.486 125.707 1.00 69.71 C ATOM 3821 CG1 ILE A 492 123.902 123.040 124.455 1.00 69.71 C ATOM 3822 CG2 ILE A 492 124.094 124.743 126.358 1.00 69.71 C ATOM 3823 CD1 ILE A 492 124.465 121.771 123.855 1.00 69.71 C ATOM 3824 N PRO A 493 126.084 125.399 123.710 1.00 66.75 N ATOM 3825 CA PRO A 493 126.347 126.026 122.406 1.00 66.75 C ATOM 3826 C PRO A 493 127.721 125.793 121.738 1.00 66.75 C ATOM 3827 O PRO A 493 127.754 125.828 120.508 1.00 66.75 O ATOM 3828 CB PRO A 493 126.167 127.519 122.702 1.00 66.75 C ATOM 3829 CG PRO A 493 125.204 127.557 123.839 1.00 66.75 C ATOM 3830 CD PRO A 493 125.517 126.353 124.681 1.00 66.75 C ATOM 3831 N LEU A 494 128.811 125.578 122.477 1.00 69.79 N ATOM 3832 CA LEU A 494 130.114 125.392 121.810 1.00 69.79 C ATOM 3833 C LEU A 494 130.281 124.083 121.022 1.00 69.79 C ATOM 3834 O LEU A 494 130.601 124.076 119.842 1.00 69.79 O ATOM 3835 CB LEU A 494 131.260 125.594 122.797 1.00 69.79 C ATOM 3836 CG LEU A 494 131.497 127.056 123.173 1.00 69.79 C ATOM 3837 CD1 LEU A 494 132.864 127.225 123.815 1.00 69.79 C ATOM 3838 CD2 LEU A 494 131.356 127.957 121.957 1.00 69.79 C ATOM 3839 N LEU A 495 130.054 122.992 121.726 1.00 68.53 N ATOM 3840 CA LEU A 495 130.128 121.600 121.296 1.00 68.53 C ATOM 3841 C LEU A 495 129.318 121.330 120.026 1.00 68.53 C ATOM 3842 O LEU A 495 129.871 120.859 119.016 1.00 68.53 O ATOM 3843 CB LEU A 495 129.657 120.662 122.406 1.00 68.53 C ATOM 3844 CG LEU A 495 130.382 120.754 123.747 1.00 68.53 C ATOM 3845 CD1 LEU A 495 130.027 119.569 124.629 1.00 68.53 C ATOM 3846 CD2 LEU A 495 131.883 120.842 123.541 1.00 68.53 C ATOM 3847 N ILE A 496 128.020 121.636 120.051 1.00 67.51 N ATOM 3848 CA ILE A 496 127.220 121.353 118.842 1.00 67.51 C ATOM 3849 C ILE A 496 127.766 121.940 117.524 1.00 67.51 C ATOM 3850 O ILE A 496 127.962 121.220 116.529 1.00 67.51 O ATOM 3851 CB ILE A 496 125.738 121.734 119.019 1.00 67.51 C ATOM 3852 CG1 ILE A 496 125.112 120.894 120.125 1.00 67.51 C ATOM 3853 CG2 ILE A 496 124.959 121.502 117.734 1.00 67.51 C ATOM 3854 CD1 ILE A 496 124.880 119.458 119.726 1.00 67.51 C ATOM 3855 N ILE A 497 128.000 123.246 117.512 1.00 67.10 N ATOM 3856 CA ILE A 497 128.488 123.908 116.311 1.00 67.10 C ATOM 3857 C ILE A 497 129.875 123.438 115.911 1.00 67.10 C ATOM 3858 O ILE A 497 130.195 123.377 114.732 1.00 67.10 O ATOM 3859 CB ILE A 497 128.512 125.434 116.472 1.00 67.10 C ATOM 3860 CG1 ILE A 497 127.112 125.958 116.775 1.00 67.10 C ATOM 3861 CG2 ILE A 497 129.060 126.085 115.216 1.00 67.10 C ATOM 3862 CD1 ILE A 497 127.110 127.318 117.432 1.00 67.10 C ATOM 3863 N ALA A 498 130.699 123.111 116.897 1.00 67.00 N ATOM 3864 CA ALA A 498 132.050 122.653 116.636 1.00 67.00 C ATOM 3865 C ALA A 498 131.956 121.349 115.889 1.00 67.00 C ATOM 3866 O ALA A 498 132.711 121.110 114.958 1.00 67.00 O ATOM 3867 CB ALA A 498 132.819 122.476 117.929 1.00 67.00 C ATOM 3868 N PHE A 499 131.021 120.497 116.291 1.00 67.78 N ATOM 3869 CA PHE A 499 130.867 119.231 115.587 1.00 67.78 C ATOM 3870 C PHE A 499 130.279 119.414 114.193 1.00 67.78 C ATOM 3871 O PHE A 499 130.623 118.670 113.287 1.00 67.78 O ATOM 3872 CB PHE A 499 130.010 118.237 116.360 1.00 67.78 C ATOM 3873 CG PHE A 499 129.717 116.983 115.590 1.00 67.78 C ATOM 3874 CD1 PHE A 499 130.740 116.131 115.227 1.00 67.78 C ATOM 3875 CD2 PHE A 499 128.428 116.668 115.213 1.00 67.78 C ATOM 3876 CE1 PHE A 499 130.483 114.980 114.514 1.00 67.78 C ATOM 3877 CE2 PHE A 499 128.162 115.519 114.497 1.00 67.78 C ATOM 3878 CZ PHE A 499 129.192 114.673 114.147 1.00 67.78 C ATOM 3879 N CYS A 500 129.391 120.389 114.012 1.00 69.83 N ATOM 3880 CA CYS A 500 128.800 120.592 112.678 1.00 69.83 C ATOM 3881 C CYS A 500 129.759 121.128 111.598 1.00 69.83 C ATOM 3882 O CYS A 500 129.539 120.929 110.410 1.00 69.83 O ATOM 3883 CB CYS A 500 127.562 121.471 112.769 1.00 69.83 C ATOM 3884 SG CYS A 500 126.057 120.533 113.079 1.00 69.83 S ATOM 3885 N GLU A 501 130.812 121.807 112.033 1.00 69.83 N ATOM 3886 CA GLU A 501 131.856 122.390 111.199 1.00 69.83 C ATOM 3887 C GLU A 501 132.844 121.331 110.733 1.00 69.83 C ATOM 3888 O GLU A 501 133.378 121.422 109.625 1.00 69.83 O ATOM 3889 CB GLU A 501 132.593 123.490 111.960 1.00 69.83 C ATOM 3890 CG GLU A 501 131.757 124.712 112.271 1.00 69.83 C ATOM 3891 CD GLU A 501 132.583 125.847 112.833 1.00 69.83 C ATOM 3892 OE1 GLU A 501 132.023 126.941 113.048 1.00 69.83 O ATOM 3893 OE2 GLU A 501 133.793 125.646 113.059 1.00 69.83 O ATOM 3894 N MET A 502 133.105 120.326 111.570 1.00 71.39 N ATOM 3895 CA MET A 502 134.016 119.256 111.184 1.00 71.39 C ATOM 3896 C MET A 502 133.336 118.254 110.264 1.00 71.39 C ATOM 3897 O MET A 502 133.993 117.650 109.412 1.00 71.39 O ATOM 3898 CB MET A 502 134.547 118.551 112.431 1.00 71.39 C ATOM 3899 CG MET A 502 135.720 117.619 112.195 1.00 71.39 C ATOM 3900 SD MET A 502 137.265 118.483 111.878 1.00 71.39 S ATOM 3901 CE MET A 502 137.789 118.870 113.544 1.00 71.39 C ATOM 3902 N PHE A 503 132.027 118.071 110.410 1.00 70.00 N ATOM 3903 CA PHE A 503 131.317 117.097 109.592 1.00 70.00 C ATOM 3904 C PHE A 503 131.059 117.628 108.190 1.00 70.00 C ATOM 3905 O PHE A 503 131.259 116.914 107.203 1.00 70.00 O ATOM 3906 CB PHE A 503 130.004 116.708 110.268 1.00 70.00 C ATOM 3907 CG PHE A 503 129.035 116.015 109.360 1.00 70.00 C ATOM 3908 CD1 PHE A 503 129.277 114.723 108.928 1.00 70.00 C ATOM 3909 CD2 PHE A 503 127.875 116.650 108.948 1.00 70.00 C ATOM 3910 CE1 PHE A 503 128.383 114.080 108.095 1.00 70.00 C ATOM 3911 CE2 PHE A 503 126.979 116.014 108.114 1.00 70.00 C ATOM 3912 CZ PHE A 503 127.234 114.727 107.688 1.00 70.00 C ATOM 3913 N SER A 504 130.620 118.878 108.080 1.00 69.04 N ATOM 3914 CA SER A 504 130.180 119.416 106.800 1.00 69.04 C ATOM 3915 C SER A 504 131.321 119.739 105.849 1.00 69.04 C ATOM 3916 O SER A 504 131.070 119.925 104.655 1.00 69.04 O ATOM 3917 CB SER A 504 129.342 120.668 107.024 1.00 69.04 C ATOM 3918 OG SER A 504 130.157 121.818 107.078 1.00 69.04 O ATOM 3919 N VAL A 505 132.553 119.819 106.331 1.00 69.10 N ATOM 3920 CA VAL A 505 133.681 120.048 105.439 1.00 69.10 C ATOM 3921 C VAL A 505 134.191 118.740 104.849 1.00 69.10 C ATOM 3922 O VAL A 505 134.445 118.652 103.647 1.00 69.10 O ATOM 3923 CB VAL A 505 134.790 120.815 106.190 1.00 69.10 C ATOM 3924 CG1 VAL A 505 136.075 120.856 105.387 1.00 69.10 C ATOM 3925 CG2 VAL A 505 134.329 122.219 106.487 1.00 69.10 C ATOM 3926 N VAL A 506 134.310 117.684 105.661 1.00 71.12 N ATOM 3927 CA VAL A 506 134.915 116.446 105.186 1.00 71.12 C ATOM 3928 C VAL A 506 133.896 115.430 104.689 1.00 71.12 C ATOM 3929 O VAL A 506 134.295 114.365 104.202 1.00 71.12 O ATOM 3930 CB VAL A 506 135.797 115.807 106.278 1.00 71.12 C ATOM 3931 CG1 VAL A 506 136.747 116.834 106.851 1.00 71.12 C ATOM 3932 CG2 VAL A 506 134.947 115.216 107.363 1.00 71.12 C ATOM 3933 N TYR A 507 132.596 115.723 104.771 1.00 72.63 N ATOM 3934 CA TYR A 507 131.590 114.782 104.295 1.00 72.63 C ATOM 3935 C TYR A 507 130.487 115.393 103.442 1.00 72.63 C ATOM 3936 O TYR A 507 129.725 114.635 102.835 1.00 72.63 O ATOM 3937 CB TYR A 507 130.945 114.037 105.473 1.00 72.63 C ATOM 3938 CG TYR A 507 131.846 112.985 106.072 1.00 72.63 C ATOM 3939 CD1 TYR A 507 132.422 112.005 105.278 1.00 72.63 C ATOM 3940 CD2 TYR A 507 132.125 112.975 107.430 1.00 72.63 C ATOM 3941 CE1 TYR A 507 133.254 111.046 105.817 1.00 72.63 C ATOM 3942 CE2 TYR A 507 132.958 112.020 107.980 1.00 72.63 C ATOM 3943 CZ TYR A 507 133.518 111.059 107.167 1.00 72.63 C ATOM 3944 OH TYR A 507 134.344 110.104 107.708 1.00 72.63 O