>>6M17:HELIX   96 AK6 SER C  477  TYR C  507  1                                  31    
SGQYWLSLLDSYAGSIPLLIIAFCEMFSVVY
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 96 AK6 SER C 477 TYR C 507 1 31 ATOM 16053 N SER C 477 193.247 172.342 142.291 1.00 53.15 N ATOM 16054 CA SER C 477 193.038 173.735 141.925 1.00 53.15 C ATOM 16055 C SER C 477 192.263 173.886 140.628 1.00 53.15 C ATOM 16056 O SER C 477 192.392 174.910 139.952 1.00 53.15 O ATOM 16057 CB SER C 477 194.380 174.449 141.819 1.00 53.15 C ATOM 16058 OG SER C 477 195.104 173.969 140.705 1.00 53.15 O ATOM 16059 N GLY C 478 191.463 172.890 140.259 1.00 54.51 N ATOM 16060 CA GLY C 478 190.758 172.902 138.995 1.00 54.51 C ATOM 16061 C GLY C 478 189.526 173.769 138.945 1.00 54.51 C ATOM 16062 O GLY C 478 188.977 173.964 137.859 1.00 54.51 O ATOM 16063 N GLN C 479 189.063 174.282 140.080 1.00 54.43 N ATOM 16064 CA GLN C 479 187.971 175.242 140.054 1.00 54.43 C ATOM 16065 C GLN C 479 188.464 176.667 139.885 1.00 54.43 C ATOM 16066 O GLN C 479 187.740 177.503 139.337 1.00 54.43 O ATOM 16067 CB GLN C 479 187.133 175.144 141.328 1.00 54.43 C ATOM 16068 CG GLN C 479 185.698 175.592 141.140 1.00 54.43 C ATOM 16069 CD GLN C 479 185.493 177.050 141.474 1.00 54.43 C ATOM 16070 OE1 GLN C 479 185.832 177.502 142.565 1.00 54.43 O ATOM 16071 NE2 GLN C 479 184.942 177.798 140.530 1.00 54.43 N ATOM 16072 N TYR C 480 189.680 176.961 140.338 1.00 55.47 N ATOM 16073 CA TYR C 480 190.270 178.268 140.105 1.00 55.47 C ATOM 16074 C TYR C 480 190.702 178.455 138.660 1.00 55.47 C ATOM 16075 O TYR C 480 190.787 179.594 138.196 1.00 55.47 O ATOM 16076 CB TYR C 480 191.469 178.479 141.026 1.00 55.47 C ATOM 16077 CG TYR C 480 191.197 178.210 142.485 1.00 55.47 C ATOM 16078 CD1 TYR C 480 190.068 178.716 143.108 1.00 55.47 C ATOM 16079 CD2 TYR C 480 192.077 177.451 143.241 1.00 55.47 C ATOM 16080 CE1 TYR C 480 189.822 178.471 144.438 1.00 55.47 C ATOM 16081 CE2 TYR C 480 191.838 177.202 144.571 1.00 55.47 C ATOM 16082 CZ TYR C 480 190.712 177.717 145.163 1.00 55.47 C ATOM 16083 OH TYR C 480 190.474 177.468 146.490 1.00 55.47 O ATOM 16084 N TRP C 481 190.982 177.364 137.947 1.00 54.61 N ATOM 16085 CA TRP C 481 191.318 177.448 136.533 1.00 54.61 C ATOM 16086 C TRP C 481 190.086 177.654 135.669 1.00 54.61 C ATOM 16087 O TRP C 481 190.180 178.269 134.604 1.00 54.61 O ATOM 16088 CB TRP C 481 192.041 176.181 136.086 1.00 54.61 C ATOM 16089 CG TRP C 481 193.498 176.165 136.386 1.00 54.61 C ATOM 16090 CD1 TRP C 481 194.122 175.459 137.365 1.00 54.61 C ATOM 16091 CD2 TRP C 481 194.521 176.874 135.689 1.00 54.61 C ATOM 16092 NE1 TRP C 481 195.472 175.688 137.329 1.00 54.61 N ATOM 16093 CE2 TRP C 481 195.743 176.555 136.306 1.00 54.61 C ATOM 16094 CE3 TRP C 481 194.523 177.750 134.602 1.00 54.61 C ATOM 16095 CZ2 TRP C 481 196.953 177.082 135.876 1.00 54.61 C ATOM 16096 CZ3 TRP C 481 195.724 178.270 134.177 1.00 54.61 C ATOM 16097 CH2 TRP C 481 196.922 177.936 134.812 1.00 54.61 C ATOM 16098 N LEU C 482 188.932 177.149 136.097 1.00 54.00 N ATOM 16099 CA LEU C 482 187.726 177.292 135.296 1.00 54.00 C ATOM 16100 C LEU C 482 187.116 178.675 135.442 1.00 54.00 C ATOM 16101 O LEU C 482 186.535 179.188 134.485 1.00 54.00 O ATOM 16102 CB LEU C 482 186.707 176.219 135.679 1.00 54.00 C ATOM 16103 CG LEU C 482 185.529 175.960 134.738 1.00 54.00 C ATOM 16104 CD1 LEU C 482 185.286 174.478 134.653 1.00 54.00 C ATOM 16105 CD2 LEU C 482 184.268 176.653 135.209 1.00 54.00 C ATOM 16106 N SER C 483 187.246 179.323 136.586 1.00 56.03 N ATOM 16107 CA SER C 483 186.675 180.659 136.705 1.00 56.03 C ATOM 16108 C SER C 483 187.375 181.653 135.771 1.00 56.03 C ATOM 16109 O SER C 483 186.809 182.101 134.753 1.00 56.03 O ATOM 16110 CB SER C 483 186.757 181.142 138.147 1.00 56.03 C ATOM 16111 OG SER C 483 185.816 180.455 138.946 1.00 56.03 O ATOM 16112 N LEU C 484 188.620 181.957 136.121 1.00 57.26 N ATOM 16113 CA LEU C 484 189.471 182.859 135.364 1.00 57.26 C ATOM 16114 C LEU C 484 189.283 182.642 133.876 1.00 57.26 C ATOM 16115 O LEU C 484 188.760 183.511 133.167 1.00 57.26 O ATOM 16116 CB LEU C 484 190.932 182.623 135.749 1.00 57.26 C ATOM 16117 CG LEU C 484 192.019 182.711 134.681 1.00 57.26 C ATOM 16118 CD1 LEU C 484 192.592 184.115 134.649 1.00 57.26 C ATOM 16119 CD2 LEU C 484 193.117 181.701 134.956 1.00 57.26 C ATOM 16120 N LEU C 485 189.718 181.473 133.414 1.00 58.81 N ATOM 16121 CA LEU C 485 189.607 181.090 132.014 1.00 58.81 C ATOM 16122 C LEU C 485 188.232 181.456 131.505 1.00 58.81 C ATOM 16123 O LEU C 485 188.108 182.233 130.570 1.00 58.81 O ATOM 16124 CB LEU C 485 189.841 179.592 131.851 1.00 58.81 C ATOM 16125 CG LEU C 485 190.099 179.092 130.435 1.00 58.81 C ATOM 16126 CD1 LEU C 485 191.368 178.258 130.405 1.00 58.81 C ATOM 16127 CD2 LEU C 485 188.913 178.285 129.939 1.00 58.81 C ATOM 16128 N ASP C 486 187.211 180.904 132.153 1.00 61.51 N ATOM 16129 CA ASP C 486 185.817 181.158 131.818 1.00 61.51 C ATOM 16130 C ASP C 486 185.621 182.628 131.507 1.00 61.51 C ATOM 16131 O ASP C 486 185.575 183.018 130.342 1.00 61.51 O ATOM 16132 CB ASP C 486 184.920 180.737 132.985 1.00 61.51 C ATOM 16133 CG ASP C 486 183.510 181.289 132.879 1.00 61.51 C ATOM 16134 OD1 ASP C 486 183.104 181.685 131.772 1.00 61.51 O ATOM 16135 OD2 ASP C 486 182.803 181.322 133.906 1.00 61.51 O ATOM 16136 N SER C 487 185.534 183.432 132.557 1.00 62.79 N ATOM 16137 CA SER C 487 185.353 184.869 132.429 1.00 62.79 C ATOM 16138 C SER C 487 186.115 185.494 131.263 1.00 62.79 C ATOM 16139 O SER C 487 185.515 186.109 130.376 1.00 62.79 O ATOM 16140 CB SER C 487 185.758 185.563 133.728 1.00 62.79 C ATOM 16141 OG SER C 487 187.143 185.849 133.739 1.00 62.79 O ATOM 16142 N TYR C 488 187.434 185.333 131.247 1.00 64.72 N ATOM 16143 CA TYR C 488 188.208 185.958 130.175 1.00 64.72 C ATOM 16144 C TYR C 488 187.888 185.513 128.751 1.00 64.72 C ATOM 16145 O TYR C 488 187.598 186.341 127.895 1.00 64.72 O ATOM 16146 CB TYR C 488 189.705 185.888 130.460 1.00 64.72 C ATOM 16147 CG TYR C 488 190.158 187.030 131.329 1.00 64.72 C ATOM 16148 CD1 TYR C 488 190.252 188.312 130.820 1.00 64.72 C ATOM 16149 CD2 TYR C 488 190.457 186.833 132.667 1.00 64.72 C ATOM 16150 CE1 TYR C 488 190.652 189.365 131.614 1.00 64.72 C ATOM 16151 CE2 TYR C 488 190.858 187.879 133.470 1.00 64.72 C ATOM 16152 CZ TYR C 488 190.953 189.143 132.938 1.00 64.72 C ATOM 16153 OH TYR C 488 191.353 190.189 133.734 1.00 64.72 O ATOM 16154 N ALA C 489 187.938 184.214 128.498 1.00 65.67 N ATOM 16155 CA ALA C 489 187.672 183.694 127.166 1.00 65.67 C ATOM 16156 C ALA C 489 186.203 183.784 126.810 1.00 65.67 C ATOM 16157 O ALA C 489 185.803 183.413 125.712 1.00 65.67 O ATOM 16158 CB ALA C 489 188.152 182.259 127.056 1.00 65.67 C ATOM 16159 N GLY C 490 185.398 184.280 127.741 1.00 70.45 N ATOM 16160 CA GLY C 490 183.974 184.399 127.509 1.00 70.45 C ATOM 16161 C GLY C 490 183.544 185.838 127.368 1.00 70.45 C ATOM 16162 O GLY C 490 182.424 186.125 126.951 1.00 70.45 O ATOM 16163 N SER C 491 184.436 186.755 127.720 1.00 69.81 N ATOM 16164 CA SER C 491 184.108 188.167 127.619 1.00 69.81 C ATOM 16165 C SER C 491 184.811 188.842 126.455 1.00 69.81 C ATOM 16166 O SER C 491 184.170 189.412 125.581 1.00 69.81 O ATOM 16167 CB SER C 491 184.433 188.893 128.929 1.00 69.81 C ATOM 16168 OG SER C 491 185.752 189.410 128.924 1.00 69.81 O ATOM 16169 N ILE C 492 186.135 188.778 126.447 1.00 69.71 N ATOM 16170 CA ILE C 492 186.895 189.426 125.396 1.00 69.71 C ATOM 16171 C ILE C 492 186.571 188.885 124.006 1.00 69.71 C ATOM 16172 O ILE C 492 185.905 189.581 123.241 1.00 69.71 O ATOM 16173 CB ILE C 492 188.401 189.570 125.707 1.00 69.71 C ATOM 16174 CG1 ILE C 492 189.154 190.016 124.455 1.00 69.71 C ATOM 16175 CG2 ILE C 492 188.962 188.313 126.358 1.00 69.71 C ATOM 16176 CD1 ILE C 492 188.591 191.285 123.855 1.00 69.71 C ATOM 16177 N PRO C 493 186.972 187.657 123.710 1.00 66.75 N ATOM 16178 CA PRO C 493 186.709 187.030 122.406 1.00 66.75 C ATOM 16179 C PRO C 493 185.335 187.263 121.738 1.00 66.75 C ATOM 16180 O PRO C 493 185.302 187.228 120.508 1.00 66.75 O ATOM 16181 CB PRO C 493 186.889 185.537 122.702 1.00 66.75 C ATOM 16182 CG PRO C 493 187.852 185.499 123.839 1.00 66.75 C ATOM 16183 CD PRO C 493 187.539 186.703 124.681 1.00 66.75 C ATOM 16184 N LEU C 494 184.245 187.478 122.477 1.00 69.79 N ATOM 16185 CA LEU C 494 182.942 187.664 121.810 1.00 69.79 C ATOM 16186 C LEU C 494 182.775 188.973 121.022 1.00 69.79 C ATOM 16187 O LEU C 494 182.455 188.980 119.842 1.00 69.79 O ATOM 16188 CB LEU C 494 181.796 187.462 122.797 1.00 69.79 C ATOM 16189 CG LEU C 494 181.559 186.000 123.173 1.00 69.79 C ATOM 16190 CD1 LEU C 494 180.192 185.831 123.815 1.00 69.79 C ATOM 16191 CD2 LEU C 494 181.700 185.099 121.957 1.00 69.79 C ATOM 16192 N LEU C 495 183.002 190.064 121.726 1.00 68.53 N ATOM 16193 CA LEU C 495 182.928 191.456 121.296 1.00 68.53 C ATOM 16194 C LEU C 495 183.738 191.726 120.026 1.00 68.53 C ATOM 16195 O LEU C 495 183.185 192.197 119.016 1.00 68.53 O ATOM 16196 CB LEU C 495 183.399 192.394 122.406 1.00 68.53 C ATOM 16197 CG LEU C 495 182.674 192.302 123.747 1.00 68.53 C ATOM 16198 CD1 LEU C 495 183.029 193.487 124.629 1.00 68.53 C ATOM 16199 CD2 LEU C 495 181.173 192.214 123.541 1.00 68.53 C ATOM 16200 N ILE C 496 185.036 191.420 120.051 1.00 67.51 N ATOM 16201 CA ILE C 496 185.836 191.703 118.842 1.00 67.51 C ATOM 16202 C ILE C 496 185.290 191.116 117.524 1.00 67.51 C ATOM 16203 O ILE C 496 185.094 191.836 116.529 1.00 67.51 O ATOM 16204 CB ILE C 496 187.318 191.322 119.019 1.00 67.51 C ATOM 16205 CG1 ILE C 496 187.944 192.162 120.125 1.00 67.51 C ATOM 16206 CG2 ILE C 496 188.097 191.554 117.734 1.00 67.51 C ATOM 16207 CD1 ILE C 496 188.176 193.598 119.726 1.00 67.51 C ATOM 16208 N ILE C 497 185.056 189.810 117.512 1.00 67.10 N ATOM 16209 CA ILE C 497 184.568 189.148 116.311 1.00 67.10 C ATOM 16210 C ILE C 497 183.181 189.618 115.911 1.00 67.10 C ATOM 16211 O ILE C 497 182.861 189.679 114.732 1.00 67.10 O ATOM 16212 CB ILE C 497 184.544 187.622 116.472 1.00 67.10 C ATOM 16213 CG1 ILE C 497 185.944 187.098 116.775 1.00 67.10 C ATOM 16214 CG2 ILE C 497 183.996 186.971 115.216 1.00 67.10 C ATOM 16215 CD1 ILE C 497 185.946 185.738 117.432 1.00 67.10 C ATOM 16216 N ALA C 498 182.357 189.945 116.897 1.00 67.00 N ATOM 16217 CA ALA C 498 181.006 190.403 116.636 1.00 67.00 C ATOM 16218 C ALA C 498 181.100 191.707 115.889 1.00 67.00 C ATOM 16219 O ALA C 498 180.345 191.946 114.958 1.00 67.00 O ATOM 16220 CB ALA C 498 180.237 190.580 117.929 1.00 67.00 C ATOM 16221 N PHE C 499 182.035 192.559 116.291 1.00 67.78 N ATOM 16222 CA PHE C 499 182.189 193.825 115.587 1.00 67.78 C ATOM 16223 C PHE C 499 182.777 193.642 114.193 1.00 67.78 C ATOM 16224 O PHE C 499 182.433 194.386 113.287 1.00 67.78 O ATOM 16225 CB PHE C 499 183.046 194.819 116.360 1.00 67.78 C ATOM 16226 CG PHE C 499 183.339 196.073 115.590 1.00 67.78 C ATOM 16227 CD1 PHE C 499 182.316 196.925 115.227 1.00 67.78 C ATOM 16228 CD2 PHE C 499 184.628 196.388 115.213 1.00 67.78 C ATOM 16229 CE1 PHE C 499 182.573 198.076 114.514 1.00 67.78 C ATOM 16230 CE2 PHE C 499 184.894 197.537 114.497 1.00 67.78 C ATOM 16231 CZ PHE C 499 183.864 198.383 114.147 1.00 67.78 C ATOM 16232 N CYS C 500 183.665 192.667 114.012 1.00 69.83 N ATOM 16233 CA CYS C 500 184.256 192.464 112.678 1.00 69.83 C ATOM 16234 C CYS C 500 183.297 191.928 111.598 1.00 69.83 C ATOM 16235 O CYS C 500 183.517 192.127 110.410 1.00 69.83 O ATOM 16236 CB CYS C 500 185.494 191.585 112.769 1.00 69.83 C ATOM 16237 SG CYS C 500 186.999 192.523 113.079 1.00 69.83 S ATOM 16238 N GLU C 501 182.244 191.249 112.033 1.00 69.83 N ATOM 16239 CA GLU C 501 181.200 190.666 111.199 1.00 69.83 C ATOM 16240 C GLU C 501 180.212 191.725 110.733 1.00 69.83 C ATOM 16241 O GLU C 501 179.678 191.634 109.625 1.00 69.83 O ATOM 16242 CB GLU C 501 180.463 189.566 111.960 1.00 69.83 C ATOM 16243 CG GLU C 501 181.299 188.344 112.271 1.00 69.83 C ATOM 16244 CD GLU C 501 180.473 187.209 112.833 1.00 69.83 C ATOM 16245 OE1 GLU C 501 181.033 186.115 113.048 1.00 69.83 O ATOM 16246 OE2 GLU C 501 179.263 187.410 113.059 1.00 69.83 O ATOM 16247 N MET C 502 179.951 192.730 111.570 1.00 71.39 N ATOM 16248 CA MET C 502 179.040 193.800 111.184 1.00 71.39 C ATOM 16249 C MET C 502 179.720 194.802 110.264 1.00 71.39 C ATOM 16250 O MET C 502 179.063 195.406 109.412 1.00 71.39 O ATOM 16251 CB MET C 502 178.509 194.505 112.431 1.00 71.39 C ATOM 16252 CG MET C 502 177.336 195.437 112.195 1.00 71.39 C ATOM 16253 SD MET C 502 175.791 194.573 111.878 1.00 71.39 S ATOM 16254 CE MET C 502 175.267 194.186 113.544 1.00 71.39 C ATOM 16255 N PHE C 503 181.029 194.985 110.410 1.00 70.00 N ATOM 16256 CA PHE C 503 181.739 195.959 109.592 1.00 70.00 C ATOM 16257 C PHE C 503 181.997 195.428 108.190 1.00 70.00 C ATOM 16258 O PHE C 503 181.797 196.142 107.203 1.00 70.00 O ATOM 16259 CB PHE C 503 183.052 196.348 110.268 1.00 70.00 C ATOM 16260 CG PHE C 503 184.021 197.041 109.360 1.00 70.00 C ATOM 16261 CD1 PHE C 503 183.779 198.333 108.928 1.00 70.00 C ATOM 16262 CD2 PHE C 503 185.181 196.406 108.948 1.00 70.00 C ATOM 16263 CE1 PHE C 503 184.673 198.976 108.095 1.00 70.00 C ATOM 16264 CE2 PHE C 503 186.077 197.042 108.114 1.00 70.00 C ATOM 16265 CZ PHE C 503 185.822 198.329 107.688 1.00 70.00 C ATOM 16266 N SER C 504 182.436 194.178 108.080 1.00 69.04 N ATOM 16267 CA SER C 504 182.876 193.640 106.800 1.00 69.04 C ATOM 16268 C SER C 504 181.735 193.317 105.849 1.00 69.04 C ATOM 16269 O SER C 504 181.986 193.131 104.655 1.00 69.04 O ATOM 16270 CB SER C 504 183.714 192.388 107.024 1.00 69.04 C ATOM 16271 OG SER C 504 182.899 191.238 107.078 1.00 69.04 O ATOM 16272 N VAL C 505 180.503 193.237 106.331 1.00 69.10 N ATOM 16273 CA VAL C 505 179.375 193.008 105.439 1.00 69.10 C ATOM 16274 C VAL C 505 178.865 194.316 104.849 1.00 69.10 C ATOM 16275 O VAL C 505 178.611 194.404 103.647 1.00 69.10 O ATOM 16276 CB VAL C 505 178.266 192.241 106.190 1.00 69.10 C ATOM 16277 CG1 VAL C 505 176.981 192.200 105.387 1.00 69.10 C ATOM 16278 CG2 VAL C 505 178.727 190.837 106.487 1.00 69.10 C ATOM 16279 N VAL C 506 178.746 195.372 105.661 1.00 71.12 N ATOM 16280 CA VAL C 506 178.141 196.610 105.186 1.00 71.12 C ATOM 16281 C VAL C 506 179.160 197.626 104.689 1.00 71.12 C ATOM 16282 O VAL C 506 178.761 198.691 104.202 1.00 71.12 O ATOM 16283 CB VAL C 506 177.259 197.249 106.278 1.00 71.12 C ATOM 16284 CG1 VAL C 506 176.309 196.222 106.851 1.00 71.12 C ATOM 16285 CG2 VAL C 506 178.109 197.840 107.363 1.00 71.12 C ATOM 16286 N TYR C 507 180.460 197.333 104.771 1.00 72.63 N ATOM 16287 CA TYR C 507 181.466 198.274 104.295 1.00 72.63 C ATOM 16288 C TYR C 507 182.569 197.663 103.442 1.00 72.63 C ATOM 16289 O TYR C 507 183.331 198.421 102.835 1.00 72.63 O ATOM 16290 CB TYR C 507 182.111 199.019 105.473 1.00 72.63 C ATOM 16291 CG TYR C 507 181.210 200.071 106.072 1.00 72.63 C ATOM 16292 CD1 TYR C 507 180.634 201.051 105.278 1.00 72.63 C ATOM 16293 CD2 TYR C 507 180.931 200.081 107.430 1.00 72.63 C ATOM 16294 CE1 TYR C 507 179.802 202.010 105.817 1.00 72.63 C ATOM 16295 CE2 TYR C 507 180.098 201.036 107.980 1.00 72.63 C ATOM 16296 CZ TYR C 507 179.538 201.997 107.167 1.00 72.63 C ATOM 16297 OH TYR C 507 178.712 202.952 107.708 1.00 72.63 O