>>6MZL:HELIX   57 AG3 VAL E  940  LYS E  971  1                                  32    
VRAQLKFFEQLDQIEKQRKDEQEREILMRAAK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 57 AG3 VAL E 940 LYS E 971 1 32 ATOM 13563 N VAL E 940 200.941 294.648 179.065 1.00370.00 N ATOM 13564 CA VAL E 940 199.832 293.700 178.995 1.00370.00 C ATOM 13565 C VAL E 940 199.189 293.742 177.620 1.00370.00 C ATOM 13566 O VAL E 940 199.199 292.747 176.891 1.00370.00 O ATOM 13567 CB VAL E 940 198.792 293.964 180.095 1.00370.00 C ATOM 13568 N ARG E 941 198.623 294.895 177.255 1.00370.00 N ATOM 13569 CA ARG E 941 198.240 295.099 175.866 1.00370.00 C ATOM 13570 C ARG E 941 199.473 295.146 174.986 1.00370.00 C ATOM 13571 O ARG E 941 199.422 294.745 173.820 1.00370.00 O ATOM 13572 CB ARG E 941 197.424 296.380 175.716 1.00370.00 C ATOM 13573 N ALA E 942 200.588 295.620 175.541 1.00370.00 N ATOM 13574 CA ALA E 942 201.882 295.389 174.921 1.00370.00 C ATOM 13575 C ALA E 942 202.199 293.905 174.861 1.00370.00 C ATOM 13576 O ALA E 942 202.647 293.405 173.826 1.00370.00 O ATOM 13577 CB ALA E 942 202.969 296.132 175.690 1.00370.00 C ATOM 13578 N GLN E 943 201.965 293.180 175.954 1.00370.00 N ATOM 13579 CA GLN E 943 202.216 291.746 175.923 1.00370.00 C ATOM 13580 C GLN E 943 201.196 291.029 175.059 1.00370.00 C ATOM 13581 O GLN E 943 201.500 289.981 174.484 1.00370.00 O ATOM 13582 CB GLN E 943 202.204 291.169 177.332 1.00370.00 C ATOM 13583 N LEU E 944 199.993 291.587 174.945 1.00370.00 N ATOM 13584 CA LEU E 944 199.033 291.056 173.991 1.00370.00 C ATOM 13585 C LEU E 944 199.514 291.270 172.568 1.00370.00 C ATOM 13586 O LEU E 944 199.335 290.403 171.711 1.00370.00 O ATOM 13587 CB LEU E 944 197.672 291.709 174.200 1.00370.00 C ATOM 13588 N LYS E 945 200.159 292.406 172.307 1.00370.00 N ATOM 13589 CA LYS E 945 200.764 292.622 171.002 1.00370.00 C ATOM 13590 C LYS E 945 201.954 291.705 170.789 1.00370.00 C ATOM 13591 O LYS E 945 202.252 291.331 169.656 1.00370.00 O ATOM 13592 CB LYS E 945 201.187 294.079 170.857 1.00370.00 C ATOM 13593 N PHE E 946 202.631 291.320 171.865 1.00370.00 N ATOM 13594 CA PHE E 946 203.730 290.369 171.746 1.00370.00 C ATOM 13595 C PHE E 946 203.215 288.977 171.422 1.00370.00 C ATOM 13596 O PHE E 946 203.814 288.253 170.620 1.00370.00 O ATOM 13597 CB PHE E 946 204.537 290.346 173.038 1.00370.00 C ATOM 13598 N PHE E 947 202.111 288.584 172.052 1.00370.00 N ATOM 13599 CA PHE E 947 201.453 287.341 171.686 1.00370.00 C ATOM 13600 C PHE E 947 200.903 287.415 170.278 1.00370.00 C ATOM 13601 O PHE E 947 200.886 286.409 169.571 1.00370.00 O ATOM 13602 CB PHE E 947 200.331 287.028 172.666 1.00370.00 C ATOM 13603 N GLU E 948 200.470 288.601 169.855 1.00370.00 N ATOM 13604 CA GLU E 948 200.075 288.809 168.472 1.00370.00 C ATOM 13605 C GLU E 948 201.262 288.693 167.537 1.00370.00 C ATOM 13606 O GLU E 948 201.111 288.233 166.409 1.00370.00 O ATOM 13607 CB GLU E 948 199.418 290.177 168.313 1.00370.00 C ATOM 13608 N GLN E 949 202.446 289.085 167.997 1.00370.00 N ATOM 13609 CA GLN E 949 203.647 288.929 167.188 1.00370.00 C ATOM 13610 C GLN E 949 204.039 287.466 167.079 1.00370.00 C ATOM 13611 O GLN E 949 204.432 286.999 166.002 1.00370.00 O ATOM 13612 CB GLN E 949 204.789 289.740 167.793 1.00370.00 C ATOM 13613 N LEU E 950 203.934 286.735 168.188 1.00370.00 N ATOM 13614 CA LEU E 950 204.187 285.299 168.175 1.00370.00 C ATOM 13615 C LEU E 950 203.181 284.578 167.289 1.00370.00 C ATOM 13616 O LEU E 950 203.546 283.693 166.503 1.00370.00 O ATOM 13617 CB LEU E 950 204.138 284.755 169.600 1.00370.00 C ATOM 13618 N ASP E 951 201.914 284.983 167.368 1.00370.00 N ATOM 13619 CA ASP E 951 200.880 284.399 166.531 1.00370.00 C ATOM 13620 C ASP E 951 201.036 284.816 165.080 1.00370.00 C ATOM 13621 O ASP E 951 200.671 284.057 164.184 1.00370.00 O ATOM 13622 CB ASP E 951 199.501 284.799 167.051 1.00370.00 C ATOM 13623 N GLN E 952 201.588 286.001 164.828 1.00370.00 N ATOM 13624 CA GLN E 952 201.851 286.418 163.460 1.00370.00 C ATOM 13625 C GLN E 952 202.992 285.615 162.868 1.00370.00 C ATOM 13626 O GLN E 952 202.960 285.263 161.686 1.00370.00 O ATOM 13627 CB GLN E 952 202.169 287.910 163.421 1.00370.00 C ATOM 13628 N ILE E 953 203.994 285.298 163.691 1.00370.00 N ATOM 13629 CA ILE E 953 205.085 284.431 163.258 1.00370.00 C ATOM 13630 C ILE E 953 204.564 283.036 162.948 1.00370.00 C ATOM 13631 O ILE E 953 204.899 282.445 161.915 1.00370.00 O ATOM 13632 CB ILE E 953 206.190 284.396 164.328 1.00370.00 C ATOM 13633 N GLU E 954 203.703 282.505 163.818 1.00370.00 N ATOM 13634 CA GLU E 954 203.153 281.173 163.588 1.00370.00 C ATOM 13635 C GLU E 954 202.170 281.156 162.424 1.00370.00 C ATOM 13636 O GLU E 954 202.086 280.160 161.705 1.00370.00 O ATOM 13637 CB GLU E 954 202.478 280.657 164.856 1.00370.00 C ATOM 13638 N LYS E 955 201.440 282.248 162.207 1.00370.00 N ATOM 13639 CA LYS E 955 200.497 282.302 161.099 1.00370.00 C ATOM 13640 C LYS E 955 201.225 282.480 159.780 1.00370.00 C ATOM 13641 O LYS E 955 200.799 281.944 158.753 1.00370.00 O ATOM 13642 CB LYS E 955 199.497 283.435 161.319 1.00370.00 C ATOM 13643 N GLN E 956 202.330 283.226 159.792 1.00370.00 N ATOM 13644 CA GLN E 956 203.185 283.292 158.618 1.00370.00 C ATOM 13645 C GLN E 956 203.831 281.944 158.354 1.00370.00 C ATOM 13646 O GLN E 956 203.991 281.543 157.199 1.00370.00 O ATOM 13647 CB GLN E 956 204.245 284.375 158.805 1.00370.00 C ATOM 13648 N ARG E 957 204.168 281.212 159.418 1.00370.00 N ATOM 13649 CA ARG E 957 204.673 279.856 159.259 1.00370.00 C ATOM 13650 C ARG E 957 203.599 278.918 158.730 1.00370.00 C ATOM 13651 O ARG E 957 203.900 278.006 157.961 1.00370.00 O ATOM 13652 CB ARG E 957 205.216 279.348 160.591 1.00370.00 C ATOM 13653 N LYS E 958 202.342 279.152 159.097 1.00370.00 N ATOM 13654 CA LYS E 958 201.257 278.310 158.611 1.00370.00 C ATOM 13655 C LYS E 958 200.937 278.608 157.154 1.00370.00 C ATOM 13656 O LYS E 958 200.665 277.693 156.372 1.00370.00 O ATOM 13657 CB LYS E 958 200.020 278.507 159.483 1.00370.00 C ATOM 13658 N ASP E 959 200.965 279.886 156.773 1.00370.00 N ATOM 13659 CA ASP E 959 200.803 280.253 155.372 1.00370.00 C ATOM 13660 C ASP E 959 201.979 279.774 154.538 1.00370.00 C ATOM 13661 O ASP E 959 201.800 279.365 153.386 1.00370.00 O ATOM 13662 CB ASP E 959 200.645 281.765 155.242 1.00370.00 C ATOM 13663 N GLU E 960 203.180 279.796 155.114 1.00370.00 N ATOM 13664 CA GLU E 960 204.340 279.219 154.457 1.00370.00 C ATOM 13665 C GLU E 960 204.223 277.708 154.350 1.00370.00 C ATOM 13666 O GLU E 960 204.693 277.127 153.374 1.00370.00 O ATOM 13667 CB GLU E 960 205.609 279.602 155.215 1.00370.00 C ATOM 13668 N GLN E 961 203.590 277.059 155.326 1.00370.00 N ATOM 13669 CA GLN E 961 203.359 275.623 155.236 1.00370.00 C ATOM 13670 C GLN E 961 202.317 275.308 154.175 1.00370.00 C ATOM 13671 O GLN E 961 202.401 274.277 153.496 1.00370.00 O ATOM 13672 CB GLN E 961 202.923 275.083 156.595 1.00370.00 C ATOM 13673 N GLU E 962 201.328 276.188 154.030 1.00370.00 N ATOM 13674 CA GLU E 962 200.364 276.067 152.946 1.00370.00 C ATOM 13675 C GLU E 962 201.049 276.204 151.597 1.00370.00 C ATOM 13676 O GLU E 962 200.832 275.387 150.693 1.00370.00 O ATOM 13677 CB GLU E 962 199.274 277.125 153.102 1.00370.00 C ATOM 13678 N ARG E 963 201.915 277.210 151.462 1.00370.00 N ATOM 13679 CA ARG E 963 202.702 277.373 150.245 1.00370.00 C ATOM 13680 C ARG E 963 203.674 276.219 150.048 1.00370.00 C ATOM 13681 O ARG E 963 203.993 275.866 148.911 1.00370.00 O ATOM 13682 CB ARG E 963 203.456 278.700 150.287 1.00370.00 C ATOM 13683 N GLU E 964 204.119 275.598 151.138 1.00370.00 N ATOM 13684 CA GLU E 964 205.044 274.479 151.046 1.00370.00 C ATOM 13685 C GLU E 964 204.347 273.231 150.539 1.00370.00 C ATOM 13686 O GLU E 964 204.903 272.489 149.726 1.00370.00 O ATOM 13687 CB GLU E 964 205.672 274.220 152.413 1.00370.00 C ATOM 13688 N ILE E 965 203.130 272.984 151.016 1.00370.00 N ATOM 13689 CA ILE E 965 202.340 271.885 150.482 1.00370.00 C ATOM 13690 C ILE E 965 201.964 272.165 149.034 1.00370.00 C ATOM 13691 O ILE E 965 201.918 271.251 148.203 1.00370.00 O ATOM 13692 CB ILE E 965 201.100 271.649 151.360 1.00370.00 C ATOM 13693 N LEU E 966 201.731 273.438 148.704 1.00370.00 N ATOM 13694 CA LEU E 966 201.434 273.811 147.324 1.00370.00 C ATOM 13695 C LEU E 966 202.640 273.607 146.422 1.00370.00 C ATOM 13696 O LEU E 966 202.493 273.260 145.248 1.00370.00 O ATOM 13697 CB LEU E 966 200.972 275.265 147.265 1.00370.00 C ATOM 13698 N MET E 967 203.837 273.824 146.950 1.00370.00 N ATOM 13699 CA MET E 967 205.040 273.589 146.171 1.00370.00 C ATOM 13700 C MET E 967 205.372 272.110 146.091 1.00370.00 C ATOM 13701 O MET E 967 205.965 271.667 145.104 1.00370.00 O ATOM 13702 CB MET E 967 206.210 274.362 146.773 1.00370.00 C ATOM 13703 N ARG E 968 205.021 271.346 147.126 1.00370.00 N ATOM 13704 CA ARG E 968 205.140 269.896 147.060 1.00370.00 C ATOM 13705 C ARG E 968 204.195 269.337 146.013 1.00370.00 C ATOM 13706 O ARG E 968 204.516 268.358 145.331 1.00370.00 O ATOM 13707 CB ARG E 968 204.851 269.283 148.428 1.00370.00 C ATOM 13708 N ALA E 969 203.024 269.954 145.879 1.00370.00 N ATOM 13709 CA ALA E 969 202.167 269.680 144.736 1.00370.00 C ATOM 13710 C ALA E 969 202.826 270.139 143.443 1.00370.00 C ATOM 13711 O ALA E 969 202.749 269.450 142.419 1.00370.00 O ATOM 13712 CB ALA E 969 200.815 270.362 144.925 1.00370.00 C ATOM 13713 N ALA E 970 203.496 271.292 143.476 1.00370.00 N ATOM 13714 CA ALA E 970 204.213 271.773 142.303 1.00370.00 C ATOM 13715 C ALA E 970 205.476 270.963 142.062 1.00370.00 C ATOM 13716 O ALA E 970 206.005 270.957 140.945 1.00370.00 O ATOM 13717 CB ALA E 970 204.552 273.254 142.463 1.00370.00 C ATOM 13718 N LYS E 971 205.972 270.285 143.090 1.00370.00 N ATOM 13719 CA LYS E 971 207.066 269.344 142.931 1.00370.00 C ATOM 13720 C LYS E 971 206.581 268.115 142.176 1.00370.00 C ATOM 13721 O LYS E 971 205.387 267.817 142.170 1.00370.00 O ATOM 13722 CB LYS E 971 207.634 268.941 144.291 1.00370.00 C