>>6P5C:HELIX   29 AD2 ASN A  780  GLU A  818  1                                  39    
NFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 29 AD2 ASN A 780 GLU A 818 1 39 ATOM 4239 N ASN A 780 7.443 15.352 46.337 1.00 35.70 N ATOM 4240 CA ASN A 780 8.708 16.026 46.758 1.00 35.03 C ATOM 4241 C ASN A 780 8.394 17.505 47.057 1.00 34.89 C ATOM 4242 O ASN A 780 7.828 18.193 46.172 1.00 33.24 O ATOM 4243 CB ASN A 780 9.824 15.838 45.720 1.00 37.40 C ATOM 4244 CG ASN A 780 11.171 16.384 46.164 1.00 41.03 C ATOM 4245 OD1 ASN A 780 11.402 17.593 46.156 1.00 40.65 O ATOM 4246 ND2 ASN A 780 12.083 15.494 46.523 1.00 38.03 N ATOM 4247 N PHE A 781 8.714 17.975 48.269 1.00 37.03 N ATOM 4248 CA PHE A 781 8.429 19.341 48.789 1.00 37.58 C ATOM 4249 C PHE A 781 9.093 20.410 47.905 1.00 36.39 C ATOM 4250 O PHE A 781 8.415 21.399 47.583 1.00 35.88 O ATOM 4251 CB PHE A 781 8.897 19.494 50.241 1.00 41.65 C ATOM 4252 CG PHE A 781 8.650 20.851 50.865 1.00 44.74 C ATOM 4253 CD1 PHE A 781 7.389 21.201 51.344 1.00 44.89 C ATOM 4254 CD2 PHE A 781 9.678 21.778 50.989 1.00 46.41 C ATOM 4255 CE1 PHE A 781 7.158 22.442 51.923 1.00 43.98 C ATOM 4256 CE2 PHE A 781 9.443 23.024 51.560 1.00 48.25 C ATOM 4257 CZ PHE A 781 8.184 23.356 52.025 1.00 46.11 C ATOM 4258 N ASN A 782 10.372 20.243 47.550 1.00 35.24 N ATOM 4259 CA ASN A 782 11.161 21.246 46.782 1.00 37.15 C ATOM 4260 C ASN A 782 10.579 21.401 45.364 1.00 37.01 C ATOM 4261 O ASN A 782 10.448 22.544 44.927 1.00 31.02 O ATOM 4262 CB ASN A 782 12.650 20.892 46.712 1.00 38.28 C ATOM 4263 CG ASN A 782 13.391 21.184 48.003 1.00 42.58 C ATOM 4264 OD1 ASN A 782 12.861 21.828 48.917 1.00 40.25 O ATOM 4265 ND2 ASN A 782 14.616 20.692 48.093 1.00 39.63 N ATOM 4266 N VAL A 783 10.270 20.284 44.687 1.00 33.84 N ATOM 4267 CA VAL A 783 9.699 20.252 43.315 1.00 33.48 C ATOM 4268 C VAL A 783 8.289 20.871 43.361 1.00 29.56 C ATOM 4269 O VAL A 783 8.017 21.751 42.536 1.00 27.94 O ATOM 4270 CB VAL A 783 9.750 18.820 42.752 1.00 37.23 C ATOM 4271 CG1 VAL A 783 9.030 18.678 41.417 1.00 37.56 C ATOM 4272 CG2 VAL A 783 11.191 18.341 42.624 1.00 35.63 C ATOM 4273 N ARG A 784 7.469 20.508 44.345 1.00 28.35 N ATOM 4274 CA ARG A 784 6.116 21.083 44.544 1.00 30.04 C ATOM 4275 C ARG A 784 6.227 22.596 44.787 1.00 26.63 C ATOM 4276 O ARG A 784 5.493 23.339 44.136 1.00 24.14 O ATOM 4277 CB ARG A 784 5.359 20.414 45.692 1.00 30.07 C ATOM 4278 CG ARG A 784 4.064 21.127 46.036 1.00 34.96 C ATOM 4279 CD ARG A 784 3.016 20.305 46.765 1.00 42.26 C ATOM 4280 NE ARG A 784 3.422 20.168 48.148 1.00 49.91 N ATOM 4281 CZ ARG A 784 3.855 19.045 48.705 1.00 52.84 C ATOM 4282 NH1 ARG A 784 3.869 17.909 48.020 1.00 50.97 N ATOM 4283 NH2 ARG A 784 4.254 19.070 49.967 1.00 55.99 N ATOM 4284 N SER A 785 7.089 23.032 45.707 1.00 25.65 N ATOM 4285 CA SER A 785 7.246 24.469 46.082 1.00 26.57 C ATOM 4286 C SER A 785 7.665 25.285 44.858 1.00 22.75 C ATOM 4287 O SER A 785 7.167 26.381 44.714 1.00 22.38 O ATOM 4288 CB SER A 785 8.230 24.675 47.201 1.00 25.95 C ATOM 4289 OG SER A 785 7.769 24.020 48.366 1.00 30.50 O ATOM 4290 N PHE A 786 8.537 24.753 44.011 1.00 21.30 N ATOM 4291 CA PHE A 786 9.027 25.473 42.807 1.00 24.79 C ATOM 4292 C PHE A 786 7.835 25.693 41.853 1.00 21.61 C ATOM 4293 O PHE A 786 7.612 26.815 41.376 1.00 19.44 O ATOM 4294 CB PHE A 786 10.240 24.733 42.234 1.00 29.33 C ATOM 4295 CG PHE A 786 11.068 25.466 41.205 1.00 38.45 C ATOM 4296 CD1 PHE A 786 11.040 26.854 41.087 1.00 45.38 C ATOM 4297 CD2 PHE A 786 11.920 24.755 40.366 1.00 47.05 C ATOM 4298 CE1 PHE A 786 11.811 27.504 40.129 1.00 49.08 C ATOM 4299 CE2 PHE A 786 12.698 25.407 39.413 1.00 51.91 C ATOM 4300 CZ PHE A 786 12.640 26.781 39.296 1.00 50.48 C ATOM 4301 N ALA A 787 7.016 24.662 41.645 1.00 19.69 N ATOM 4302 CA ALA A 787 5.771 24.763 40.854 1.00 18.43 C ATOM 4303 C ALA A 787 4.824 25.798 41.480 1.00 17.67 C ATOM 4304 O ALA A 787 4.176 26.532 40.743 1.00 16.89 O ATOM 4305 CB ALA A 787 5.136 23.404 40.743 1.00 18.40 C ATOM 4306 N GLU A 788 4.759 25.913 42.804 1.00 18.44 N ATOM 4307 CA GLU A 788 3.819 26.876 43.439 1.00 20.11 C ATOM 4308 C GLU A 788 4.305 28.307 43.148 1.00 20.44 C ATOM 4309 O GLU A 788 3.460 29.218 42.917 1.00 19.99 O ATOM 4310 CB GLU A 788 3.671 26.574 44.936 1.00 20.95 C ATOM 4311 CG GLU A 788 2.848 25.324 45.224 1.00 22.57 C ATOM 4312 CD GLU A 788 2.825 24.826 46.672 1.00 25.25 C ATOM 4313 OE1 GLU A 788 2.010 23.936 47.000 1.00 26.90 O ATOM 4314 OE2 GLU A 788 3.635 25.298 47.462 1.00 27.86 O ATOM 4315 N ARG A 789 5.620 28.505 43.123 1.00 19.79 N ATOM 4316 CA ARG A 789 6.213 29.847 42.924 1.00 20.45 C ATOM 4317 C ARG A 789 5.923 30.252 41.478 1.00 19.61 C ATOM 4318 O ARG A 789 5.534 31.374 41.255 1.00 18.33 O ATOM 4319 CB ARG A 789 7.687 29.808 43.324 1.00 21.61 C ATOM 4320 CG ARG A 789 7.887 29.503 44.802 1.00 25.32 C ATOM 4321 CD ARG A 789 9.199 30.035 45.390 1.00 29.59 C ATOM 4322 NE ARG A 789 10.336 29.296 44.885 1.00 32.87 N ATOM 4323 CZ ARG A 789 10.704 28.066 45.282 1.00 37.98 C ATOM 4324 NH1 ARG A 789 10.041 27.418 46.227 1.00 39.38 N ATOM 4325 NH2 ARG A 789 11.743 27.482 44.713 1.00 38.69 N ATOM 4326 N MET A 790 6.035 29.308 40.554 1.00 18.90 N ATOM 4327 CA MET A 790 5.760 29.533 39.128 1.00 17.70 C ATOM 4328 C MET A 790 4.288 29.889 38.968 1.00 15.91 C ATOM 4329 O MET A 790 3.992 30.753 38.122 1.00 14.31 O ATOM 4330 CB MET A 790 6.099 28.275 38.334 1.00 18.85 C ATOM 4331 CG MET A 790 7.591 28.040 38.255 1.00 20.57 C ATOM 4332 SD MET A 790 7.906 26.552 37.280 1.00 24.04 S ATOM 4333 CE MET A 790 9.657 26.319 37.595 1.00 25.36 C ATOM 4334 N ALA A 791 3.402 29.252 39.749 1.00 14.43 N ATOM 4335 CA ALA A 791 1.957 29.511 39.669 1.00 13.33 C ATOM 4336 C ALA A 791 1.716 30.930 40.155 1.00 13.17 C ATOM 4337 O ALA A 791 0.920 31.597 39.590 1.00 13.01 O ATOM 4338 CB ALA A 791 1.165 28.509 40.455 1.00 13.59 C ATOM 4339 N MET A 792 2.439 31.355 41.175 1.00 14.72 N ATOM 4340 CA MET A 792 2.321 32.711 41.748 1.00 15.68 C ATOM 4341 C MET A 792 2.959 33.741 40.784 1.00 15.58 C ATOM 4342 O MET A 792 2.345 34.782 40.534 1.00 16.29 O ATOM 4343 CB MET A 792 2.964 32.696 43.135 1.00 17.17 C ATOM 4344 CG MET A 792 2.087 31.973 44.154 1.00 19.44 C ATOM 4345 SD MET A 792 2.735 32.016 45.835 1.00 24.07 S ATOM 4346 CE MET A 792 3.848 30.614 45.891 1.00 25.49 C ATOM 4347 N ASN A 793 4.075 33.416 40.150 1.00 14.37 N ATOM 4348 CA ASN A 793 4.886 34.417 39.412 1.00 15.25 C ATOM 4349 C ASN A 793 4.432 34.511 37.944 1.00 15.47 C ATOM 4350 O ASN A 793 4.418 35.614 37.416 1.00 13.66 O ATOM 4351 CB ASN A 793 6.373 34.103 39.558 1.00 15.08 C ATOM 4352 CG ASN A 793 7.230 35.053 38.762 1.00 16.51 C ATOM 4353 OD1 ASN A 793 7.694 34.712 37.669 1.00 15.35 O ATOM 4354 ND2 ASN A 793 7.372 36.265 39.276 1.00 17.47 N ATOM 4355 N THR A 794 4.113 33.385 37.294 1.00 15.19 N ATOM 4356 CA THR A 794 3.982 33.325 35.823 1.00 15.13 C ATOM 4357 C THR A 794 2.872 34.257 35.351 1.00 15.15 C ATOM 4358 O THR A 794 3.075 35.010 34.402 1.00 16.32 O ATOM 4359 CB THR A 794 3.859 31.891 35.301 1.00 15.84 C ATOM 4360 OG1 THR A 794 5.107 31.224 35.511 1.00 14.44 O ATOM 4361 CG2 THR A 794 3.499 31.866 33.837 1.00 16.03 C ATOM 4362 N PRO A 795 1.667 34.282 35.963 1.00 14.55 N ATOM 4363 CA PRO A 795 0.666 35.242 35.553 1.00 14.65 C ATOM 4364 C PRO A 795 1.123 36.700 35.660 1.00 15.07 C ATOM 4365 O PRO A 795 0.586 37.522 34.944 1.00 15.02 O ATOM 4366 CB PRO A 795 -0.477 34.976 36.537 1.00 14.38 C ATOM 4367 CG PRO A 795 -0.316 33.528 36.832 1.00 13.67 C ATOM 4368 CD PRO A 795 1.171 33.358 36.984 1.00 13.96 C ATOM 4369 N ILE A 796 1.993 37.029 36.613 1.00 16.01 N ATOM 4370 CA ILE A 796 2.447 38.444 36.770 1.00 16.07 C ATOM 4371 C ILE A 796 3.454 38.755 35.654 1.00 15.60 C ATOM 4372 O ILE A 796 3.193 39.686 34.890 1.00 15.49 O ATOM 4373 CB ILE A 796 3.020 38.705 38.175 1.00 16.82 C ATOM 4374 CG1 ILE A 796 1.941 38.496 39.245 1.00 18.05 C ATOM 4375 CG2 ILE A 796 3.645 40.096 38.239 1.00 15.83 C ATOM 4376 CD1 ILE A 796 2.447 38.184 40.644 1.00 17.22 C ATOM 4377 N GLN A 797 4.550 37.996 35.579 1.00 15.14 N ATOM 4378 CA GLN A 797 5.659 38.219 34.618 1.00 16.10 C ATOM 4379 C GLN A 797 5.107 38.060 33.187 1.00 16.77 C ATOM 4380 O GLN A 797 5.441 38.904 32.352 1.00 18.13 O ATOM 4381 CB GLN A 797 6.824 37.261 34.877 1.00 16.65 C ATOM 4382 CG GLN A 797 8.054 37.559 34.024 1.00 17.84 C ATOM 4383 CD GLN A 797 9.191 36.578 34.206 1.00 19.74 C ATOM 4384 OE1 GLN A 797 9.641 35.983 33.219 1.00 22.42 O ATOM 4385 NE2 GLN A 797 9.623 36.347 35.452 1.00 16.70 N ATOM 4386 N GLY A 798 4.285 37.031 32.942 1.00 14.67 N ATOM 4387 CA GLY A 798 3.669 36.718 31.643 1.00 14.11 C ATOM 4388 C GLY A 798 2.692 37.783 31.215 1.00 15.02 C ATOM 4389 O GLY A 798 2.748 38.182 30.052 1.00 15.17 O ATOM 4390 N SER A 799 1.810 38.248 32.106 1.00 14.43 N ATOM 4391 CA SER A 799 0.898 39.370 31.758 1.00 13.45 C ATOM 4392 C SER A 799 1.700 40.630 31.388 1.00 12.18 C ATOM 4393 O SER A 799 1.323 41.286 30.441 1.00 11.22 O ATOM 4394 CB SER A 799 -0.072 39.624 32.848 1.00 12.61 C ATOM 4395 OG SER A 799 -0.891 38.489 32.965 1.00 13.50 O ATOM 4396 N ALA A 800 2.772 40.941 32.112 1.00 11.87 N ATOM 4397 CA ALA A 800 3.680 42.063 31.810 1.00 12.36 C ATOM 4398 C ALA A 800 4.269 41.865 30.403 1.00 11.84 C ATOM 4399 O ALA A 800 4.351 42.819 29.626 1.00 12.26 O ATOM 4400 CB ALA A 800 4.759 42.167 32.888 1.00 12.57 C ATOM 4401 N ALA A 801 4.610 40.643 30.039 1.00 11.90 N ATOM 4402 CA ALA A 801 5.197 40.359 28.711 1.00 11.85 C ATOM 4403 C ALA A 801 4.111 40.581 27.656 1.00 12.04 C ATOM 4404 O ALA A 801 4.387 41.247 26.610 1.00 12.15 O ATOM 4405 CB ALA A 801 5.788 38.977 28.692 1.00 11.70 C ATOM 4406 N ASP A 802 2.887 40.146 27.941 1.00 12.31 N ATOM 4407 CA ASP A 802 1.760 40.284 26.986 1.00 13.05 C ATOM 4408 C ASP A 802 1.571 41.779 26.696 1.00 13.37 C ATOM 4409 O ASP A 802 1.385 42.153 25.527 1.00 15.49 O ATOM 4410 CB ASP A 802 0.452 39.716 27.525 1.00 13.62 C ATOM 4411 CG ASP A 802 0.373 38.213 27.672 1.00 14.72 C ATOM 4412 OD1 ASP A 802 1.267 37.491 27.121 1.00 16.28 O ATOM 4413 OD2 ASP A 802 -0.560 37.780 28.371 1.00 14.39 O ATOM 4414 N ILE A 803 1.599 42.609 27.724 1.00 12.84 N ATOM 4415 CA ILE A 803 1.258 44.049 27.590 1.00 13.19 C ATOM 4416 C ILE A 803 2.328 44.744 26.761 1.00 13.30 C ATOM 4417 O ILE A 803 1.969 45.498 25.862 1.00 13.65 O ATOM 4418 CB ILE A 803 1.092 44.707 28.964 1.00 13.66 C ATOM 4419 CG1 ILE A 803 -0.128 44.147 29.687 1.00 13.54 C ATOM 4420 CG2 ILE A 803 1.055 46.237 28.860 1.00 13.17 C ATOM 4421 CD1 ILE A 803 -0.164 44.547 31.131 1.00 14.30 C ATOM 4422 N ILE A 804 3.599 44.537 27.065 1.00 14.02 N ATOM 4423 CA ILE A 804 4.671 45.231 26.288 1.00 14.84 C ATOM 4424 C ILE A 804 4.657 44.745 24.831 1.00 14.26 C ATOM 4425 O ILE A 804 4.850 45.591 23.959 1.00 14.62 O ATOM 4426 CB ILE A 804 6.063 45.160 26.933 1.00 14.74 C ATOM 4427 CG1 ILE A 804 7.000 46.151 26.242 1.00 15.72 C ATOM 4428 CG2 ILE A 804 6.640 43.762 26.927 1.00 15.50 C ATOM 4429 CD1 ILE A 804 8.225 46.530 27.052 1.00 15.40 C ATOM 4430 N LYS A 805 4.342 43.478 24.553 1.00 14.54 N ATOM 4431 CA LYS A 805 4.269 42.990 23.148 1.00 14.24 C ATOM 4432 C LYS A 805 3.118 43.696 22.427 1.00 15.14 C ATOM 4433 O LYS A 805 3.315 44.117 21.276 1.00 14.72 O ATOM 4434 CB LYS A 805 4.091 41.474 23.065 1.00 14.37 C ATOM 4435 CG LYS A 805 5.299 40.632 23.484 1.00 13.67 C ATOM 4436 CD LYS A 805 5.019 39.148 23.382 1.00 13.85 C ATOM 4437 CE LYS A 805 6.235 38.274 23.532 1.00 14.26 C ATOM 4438 NZ LYS A 805 5.874 36.837 23.643 1.00 14.54 N ATOM 4439 N LYS A 806 1.958 43.843 23.074 1.00 15.96 N ATOM 4440 CA LYS A 806 0.847 44.591 22.456 1.00 16.97 C ATOM 4441 C LYS A 806 1.262 46.054 22.207 1.00 16.35 C ATOM 4442 O LYS A 806 0.870 46.615 21.172 1.00 15.26 O ATOM 4443 CB LYS A 806 -0.449 44.546 23.270 1.00 18.37 C ATOM 4444 CG LYS A 806 -1.621 45.167 22.510 1.00 18.48 C ATOM 4445 CD LYS A 806 -2.977 44.677 22.944 1.00 20.93 C ATOM 4446 CE LYS A 806 -4.149 45.441 22.334 1.00 21.90 C ATOM 4447 NZ LYS A 806 -3.970 46.921 22.372 1.00 21.64 N ATOM 4448 N ALA A 807 1.950 46.681 23.151 1.00 16.27 N ATOM 4449 CA ALA A 807 2.411 48.073 23.005 1.00 15.66 C ATOM 4450 C ALA A 807 3.347 48.134 21.797 1.00 16.10 C ATOM 4451 O ALA A 807 3.260 49.120 21.052 1.00 16.17 O ATOM 4452 CB ALA A 807 3.105 48.549 24.259 1.00 15.92 C ATOM 4453 N MET A 808 4.232 47.143 21.606 1.00 15.18 N ATOM 4454 CA MET A 808 5.159 47.189 20.449 1.00 14.61 C ATOM 4455 C MET A 808 4.329 47.190 19.156 1.00 14.34 C ATOM 4456 O MET A 808 4.565 48.055 18.314 1.00 14.26 O ATOM 4457 CB MET A 808 6.154 46.038 20.471 1.00 14.26 C ATOM 4458 CG MET A 808 7.077 46.139 21.644 1.00 14.56 C ATOM 4459 SD MET A 808 8.042 44.638 21.875 1.00 15.14 S ATOM 4460 CE MET A 808 9.163 44.804 20.491 1.00 13.97 C ATOM 4461 N ILE A 809 3.299 46.353 19.073 1.00 14.02 N ATOM 4462 CA ILE A 809 2.409 46.289 17.896 1.00 14.21 C ATOM 4463 C ILE A 809 1.702 47.635 17.727 1.00 14.99 C ATOM 4464 O ILE A 809 1.706 48.168 16.592 1.00 13.88 O ATOM 4465 CB ILE A 809 1.442 45.113 17.981 1.00 14.97 C ATOM 4466 CG1 ILE A 809 2.231 43.805 17.943 1.00 15.75 C ATOM 4467 CG2 ILE A 809 0.405 45.214 16.858 1.00 15.03 C ATOM 4468 CD1 ILE A 809 1.442 42.582 18.361 1.00 16.72 C ATOM 4469 N ASP A 810 1.138 48.182 18.798 1.00 15.46 N ATOM 4470 CA ASP A 810 0.351 49.431 18.713 1.00 15.47 C ATOM 4471 C ASP A 810 1.298 50.557 18.318 1.00 16.31 C ATOM 4472 O ASP A 810 0.936 51.371 17.456 1.00 15.54 O ATOM 4473 CB ASP A 810 -0.364 49.744 20.028 1.00 17.45 C ATOM 4474 CG ASP A 810 -1.448 48.762 20.436 1.00 18.27 C ATOM 4475 OD1 ASP A 810 -1.866 47.968 19.609 1.00 21.59 O ATOM 4476 OD2 ASP A 810 -1.862 48.815 21.589 1.00 21.90 O ATOM 4477 N LEU A 811 2.491 50.582 18.906 1.00 16.67 N ATOM 4478 CA LEU A 811 3.491 51.630 18.625 1.00 16.79 C ATOM 4479 C LEU A 811 3.982 51.596 17.163 1.00 17.49 C ATOM 4480 O LEU A 811 4.078 52.676 16.585 1.00 17.68 O ATOM 4481 CB LEU A 811 4.650 51.489 19.588 1.00 16.89 C ATOM 4482 CG LEU A 811 5.773 52.495 19.339 1.00 18.17 C ATOM 4483 CD1 LEU A 811 5.266 53.900 19.567 1.00 17.22 C ATOM 4484 CD2 LEU A 811 6.983 52.192 20.219 1.00 18.70 C ATOM 4485 N ASN A 812 4.270 50.445 16.574 1.00 18.57 N ATOM 4486 CA ASN A 812 4.660 50.360 15.141 1.00 21.02 C ATOM 4487 C ASN A 812 3.554 50.898 14.237 1.00 20.53 C ATOM 4488 O ASN A 812 3.879 51.649 13.296 1.00 19.40 O ATOM 4489 CB ASN A 812 4.939 48.941 14.662 1.00 24.99 C ATOM 4490 CG ASN A 812 6.351 48.776 14.160 1.00 30.03 C ATOM 4491 OD1 ASN A 812 6.551 48.323 13.038 1.00 38.52 O ATOM 4492 ND2 ASN A 812 7.321 49.129 14.983 1.00 36.14 N ATOM 4493 N ALA A 813 2.295 50.532 14.495 1.00 20.44 N ATOM 4494 CA ALA A 813 1.135 51.048 13.731 1.00 21.43 C ATOM 4495 C ALA A 813 1.062 52.577 13.896 1.00 21.98 C ATOM 4496 O ALA A 813 0.912 53.256 12.889 1.00 23.79 O ATOM 4497 CB ALA A 813 -0.151 50.350 14.139 1.00 21.75 C ATOM 4498 N ARG A 814 1.227 53.127 15.098 1.00 21.90 N ATOM 4499 CA ARG A 814 1.085 54.589 15.305 1.00 23.98 C ATOM 4500 C ARG A 814 2.225 55.328 14.588 1.00 20.95 C ATOM 4501 O ARG A 814 1.920 56.311 13.930 1.00 18.98 O ATOM 4502 CB ARG A 814 0.966 54.978 16.782 1.00 26.88 C ATOM 4503 CG ARG A 814 -0.273 54.404 17.451 1.00 34.45 C ATOM 4504 CD ARG A 814 -1.536 55.246 17.309 1.00 39.32 C ATOM 4505 NE ARG A 814 -1.399 56.543 17.964 1.00 43.27 N ATOM 4506 CZ ARG A 814 -1.337 57.715 17.335 1.00 44.52 C ATOM 4507 NH1 ARG A 814 -1.449 57.779 16.017 1.00 45.15 N ATOM 4508 NH2 ARG A 814 -1.212 58.829 18.038 1.00 41.27 N ATOM 4509 N LEU A 815 3.469 54.876 14.689 1.00 19.11 N ATOM 4510 CA LEU A 815 4.618 55.533 13.993 1.00 20.93 C ATOM 4511 C LEU A 815 4.391 55.599 12.472 1.00 20.01 C ATOM 4512 O LEU A 815 4.695 56.645 11.887 1.00 17.13 O ATOM 4513 CB LEU A 815 5.919 54.790 14.305 1.00 21.31 C ATOM 4514 CG LEU A 815 6.352 54.795 15.773 1.00 22.02 C ATOM 4515 CD1 LEU A 815 7.456 53.781 15.970 1.00 23.11 C ATOM 4516 CD2 LEU A 815 6.796 56.176 16.241 1.00 20.95 C ATOM 4517 N LYS A 816 3.841 54.552 11.863 1.00 23.59 N ATOM 4518 CA LYS A 816 3.515 54.529 10.408 1.00 29.88 C ATOM 4519 C LYS A 816 2.386 55.524 10.101 1.00 29.24 C ATOM 4520 O LYS A 816 2.589 56.361 9.196 1.00 27.66 O ATOM 4521 CB LYS A 816 3.164 53.118 9.929 1.00 36.20 C ATOM 4522 CG LYS A 816 4.376 52.196 9.824 1.00 48.16 C ATOM 4523 CD LYS A 816 4.143 50.928 9.019 1.00 57.86 C ATOM 4524 CE LYS A 816 5.210 49.870 9.251 1.00 64.70 C ATOM 4525 NZ LYS A 816 5.258 49.403 10.661 1.00 62.86 N ATOM 4526 N GLU A 817 1.281 55.472 10.848 1.00 27.43 N ATOM 4527 CA GLU A 817 0.148 56.430 10.729 1.00 30.96 C ATOM 4528 C GLU A 817 0.714 57.858 10.767 1.00 28.00 C ATOM 4529 O GLU A 817 0.314 58.671 9.945 1.00 26.69 O ATOM 4530 CB GLU A 817 -0.875 56.278 11.860 1.00 32.93 C ATOM 4531 CG GLU A 817 -1.728 55.016 11.824 1.00 41.43 C ATOM 4532 CD GLU A 817 -2.481 54.703 13.130 1.00 47.14 C ATOM 4533 OE1 GLU A 817 -2.945 55.671 13.824 1.00 38.61 O ATOM 4534 OE2 GLU A 817 -2.576 53.487 13.485 1.00 49.69 O ATOM 4535 N GLU A 818 1.641 58.125 11.685 1.00 25.92 N ATOM 4536 CA GLU A 818 2.128 59.490 11.999 1.00 26.09 C ATOM 4537 C GLU A 818 3.238 59.884 11.022 1.00 24.89 C ATOM 4538 O GLU A 818 3.711 60.997 11.150 1.00 25.91 O ATOM 4539 CB GLU A 818 2.668 59.529 13.430 1.00 29.03 C ATOM 4540 CG GLU A 818 1.593 59.384 14.492 1.00 31.21 C ATOM 4541 CD GLU A 818 0.565 60.491 14.432 1.00 35.01 C ATOM 4542 OE1 GLU A 818 -0.637 60.168 14.572 1.00 33.91 O ATOM 4543 OE2 GLU A 818 0.972 61.663 14.170 1.00 38.07 O