>>6P5C:HELIX    9 AA9 ASP A  439  ASN A  468  1                                  30    
DEPVLAEHLVRKAAAIWELERPFLDELRRN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 9 AA9 ASP A 439 ASN A 468 1 30 ATOM 1462 N ASP A 439 24.557 16.793 1.158 1.00 34.58 N ATOM 1463 CA ASP A 439 24.382 16.841 -0.319 1.00 36.72 C ATOM 1464 C ASP A 439 22.906 17.083 -0.652 1.00 34.87 C ATOM 1465 O ASP A 439 22.034 16.798 0.185 1.00 34.19 O ATOM 1466 CB ASP A 439 24.830 15.545 -0.997 1.00 40.29 C ATOM 1467 CG ASP A 439 26.287 15.189 -0.773 1.00 43.60 C ATOM 1468 OD1 ASP A 439 27.088 16.096 -0.463 1.00 44.99 O ATOM 1469 OD2 ASP A 439 26.609 14.005 -0.939 1.00 53.11 O ATOM 1470 N GLU A 440 22.643 17.516 -1.875 1.00 32.96 N ATOM 1471 CA GLU A 440 21.323 18.033 -2.300 1.00 34.82 C ATOM 1472 C GLU A 440 20.203 17.007 -2.105 1.00 36.03 C ATOM 1473 O GLU A 440 19.085 17.366 -1.749 1.00 31.78 O ATOM 1474 CB GLU A 440 21.408 18.430 -3.765 1.00 35.51 C ATOM 1475 CG GLU A 440 20.196 19.190 -4.221 1.00 37.30 C ATOM 1476 CD GLU A 440 20.416 19.872 -5.549 1.00 39.16 C ATOM 1477 OE1 GLU A 440 20.145 19.222 -6.561 1.00 38.53 O ATOM 1478 OE2 GLU A 440 20.870 21.040 -5.550 1.00 44.26 O ATOM 1479 N PRO A 441 20.409 15.703 -2.399 1.00 38.47 N ATOM 1480 CA PRO A 441 19.295 14.758 -2.353 1.00 35.24 C ATOM 1481 C PRO A 441 18.774 14.643 -0.910 1.00 32.51 C ATOM 1482 O PRO A 441 17.568 14.641 -0.732 1.00 29.49 O ATOM 1483 CB PRO A 441 19.890 13.443 -2.891 1.00 35.13 C ATOM 1484 CG PRO A 441 21.180 13.860 -3.580 1.00 36.65 C ATOM 1485 CD PRO A 441 21.676 15.069 -2.808 1.00 36.83 C ATOM 1486 N VAL A 442 19.689 14.565 0.062 1.00 30.23 N ATOM 1487 CA VAL A 442 19.387 14.513 1.525 1.00 31.34 C ATOM 1488 C VAL A 442 18.745 15.852 1.923 1.00 30.98 C ATOM 1489 O VAL A 442 17.682 15.821 2.574 1.00 28.09 O ATOM 1490 CB VAL A 442 20.650 14.212 2.365 1.00 35.01 C ATOM 1491 CG1 VAL A 442 20.371 14.243 3.865 1.00 33.26 C ATOM 1492 CG2 VAL A 442 21.305 12.884 1.978 1.00 34.51 C ATOM 1493 N LEU A 443 19.340 16.988 1.523 1.00 27.77 N ATOM 1494 CA LEU A 443 18.857 18.338 1.927 1.00 26.27 C ATOM 1495 C LEU A 443 17.414 18.536 1.454 1.00 25.89 C ATOM 1496 O LEU A 443 16.530 18.935 2.287 1.00 22.61 O ATOM 1497 CB LEU A 443 19.777 19.415 1.361 1.00 25.30 C ATOM 1498 CG LEU A 443 19.281 20.850 1.523 1.00 25.55 C ATOM 1499 CD1 LEU A 443 19.143 21.236 2.984 1.00 25.34 C ATOM 1500 CD2 LEU A 443 20.193 21.816 0.781 1.00 25.81 C ATOM 1501 N ALA A 444 17.174 18.269 0.174 1.00 23.96 N ATOM 1502 CA ALA A 444 15.882 18.559 -0.471 1.00 25.54 C ATOM 1503 C ALA A 444 14.817 17.672 0.162 1.00 25.15 C ATOM 1504 O ALA A 444 13.703 18.163 0.387 1.00 26.83 O ATOM 1505 CB ALA A 444 15.951 18.355 -1.966 1.00 25.96 C ATOM 1506 N GLU A 445 15.131 16.403 0.401 1.00 25.38 N ATOM 1507 CA GLU A 445 14.130 15.491 1.005 1.00 27.32 C ATOM 1508 C GLU A 445 13.786 16.038 2.388 1.00 23.05 C ATOM 1509 O GLU A 445 12.624 16.029 2.746 1.00 22.60 O ATOM 1510 CB GLU A 445 14.580 14.032 1.088 1.00 28.54 C ATOM 1511 CG GLU A 445 13.595 13.197 1.890 1.00 32.66 C ATOM 1512 CD GLU A 445 13.593 11.710 1.645 1.00 37.22 C ATOM 1513 OE1 GLU A 445 14.542 11.219 0.972 1.00 40.73 O ATOM 1514 OE2 GLU A 445 12.636 11.048 2.125 1.00 38.53 O ATOM 1515 N HIS A 446 14.773 16.532 3.127 1.00 23.82 N ATOM 1516 CA HIS A 446 14.551 17.064 4.490 1.00 21.98 C ATOM 1517 C HIS A 446 13.639 18.289 4.413 1.00 19.94 C ATOM 1518 O HIS A 446 12.653 18.327 5.130 1.00 19.22 O ATOM 1519 CB HIS A 446 15.875 17.368 5.179 1.00 22.53 C ATOM 1520 CG HIS A 446 15.657 17.930 6.540 1.00 23.30 C ATOM 1521 ND1 HIS A 446 14.788 17.347 7.446 1.00 21.70 N ATOM 1522 CD2 HIS A 446 16.193 19.000 7.160 1.00 22.79 C ATOM 1523 CE1 HIS A 446 14.842 18.022 8.574 1.00 22.07 C ATOM 1524 NE2 HIS A 446 15.676 19.042 8.418 1.00 20.99 N ATOM 1525 N LEU A 447 13.938 19.244 3.540 1.00 17.94 N ATOM 1526 CA LEU A 447 13.145 20.489 3.453 1.00 17.57 C ATOM 1527 C LEU A 447 11.717 20.175 2.996 1.00 17.37 C ATOM 1528 O LEU A 447 10.740 20.850 3.499 1.00 14.64 O ATOM 1529 CB LEU A 447 13.799 21.447 2.463 1.00 18.90 C ATOM 1530 CG LEU A 447 15.208 21.902 2.795 1.00 19.13 C ATOM 1531 CD1 LEU A 447 15.444 23.266 2.191 1.00 20.62 C ATOM 1532 CD2 LEU A 447 15.470 21.932 4.288 1.00 19.42 C ATOM 1533 N VAL A 448 11.576 19.258 2.037 1.00 15.51 N ATOM 1534 CA VAL A 448 10.221 18.878 1.549 1.00 15.85 C ATOM 1535 C VAL A 448 9.441 18.224 2.711 1.00 15.00 C ATOM 1536 O VAL A 448 8.325 18.587 2.931 1.00 13.87 O ATOM 1537 CB VAL A 448 10.313 17.992 0.305 1.00 16.38 C ATOM 1538 CG1 VAL A 448 9.021 17.246 0.043 1.00 16.64 C ATOM 1539 CG2 VAL A 448 10.738 18.804 -0.917 1.00 17.97 C ATOM 1540 N ARG A 449 10.034 17.334 3.480 1.00 16.11 N ATOM 1541 CA ARG A 449 9.355 16.727 4.665 1.00 16.40 C ATOM 1542 C ARG A 449 8.967 17.803 5.702 1.00 17.22 C ATOM 1543 O ARG A 449 7.868 17.686 6.304 1.00 16.98 O ATOM 1544 CB ARG A 449 10.250 15.675 5.316 1.00 16.04 C ATOM 1545 CG ARG A 449 10.229 14.330 4.598 1.00 18.01 C ATOM 1546 CD ARG A 449 11.149 13.291 5.261 1.00 17.43 C ATOM 1547 NE ARG A 449 11.093 12.017 4.564 1.00 18.73 N ATOM 1548 CZ ARG A 449 10.088 11.126 4.653 1.00 19.97 C ATOM 1549 NH1 ARG A 449 9.023 11.356 5.429 1.00 19.76 N ATOM 1550 NH2 ARG A 449 10.142 10.010 3.944 1.00 18.21 N ATOM 1551 N LYS A 450 9.819 18.807 5.953 1.00 15.77 N ATOM 1552 CA LYS A 450 9.471 19.882 6.913 1.00 14.77 C ATOM 1553 C LYS A 450 8.234 20.619 6.384 1.00 14.49 C ATOM 1554 O LYS A 450 7.250 20.845 7.165 1.00 14.62 O ATOM 1555 CB LYS A 450 10.661 20.804 7.159 1.00 14.73 C ATOM 1556 CG LYS A 450 11.765 20.180 7.993 1.00 15.91 C ATOM 1557 CD LYS A 450 12.599 21.169 8.817 1.00 16.86 C ATOM 1558 CE LYS A 450 13.441 22.128 8.002 1.00 17.87 C ATOM 1559 NZ LYS A 450 14.384 22.869 8.882 1.00 18.35 N ATOM 1560 N ALA A 451 8.232 20.930 5.096 1.00 13.54 N ATOM 1561 CA ALA A 451 7.133 21.665 4.446 1.00 13.96 C ATOM 1562 C ALA A 451 5.871 20.806 4.489 1.00 13.92 C ATOM 1563 O ALA A 451 4.813 21.352 4.818 1.00 14.01 O ATOM 1564 CB ALA A 451 7.511 22.051 3.042 1.00 14.46 C ATOM 1565 N ALA A 452 5.978 19.515 4.185 1.00 14.06 N ATOM 1566 CA ALA A 452 4.810 18.602 4.170 1.00 15.90 C ATOM 1567 C ALA A 452 4.230 18.539 5.600 1.00 17.35 C ATOM 1568 O ALA A 452 3.022 18.706 5.750 1.00 17.03 O ATOM 1569 CB ALA A 452 5.196 17.254 3.631 1.00 15.27 C ATOM 1570 N ALA A 453 5.089 18.439 6.617 1.00 18.21 N ATOM 1571 CA ALA A 453 4.701 18.462 8.055 1.00 19.24 C ATOM 1572 C ALA A 453 3.924 19.748 8.363 1.00 18.59 C ATOM 1573 O ALA A 453 2.749 19.658 8.870 1.00 17.27 O ATOM 1574 CB ALA A 453 5.911 18.331 8.958 1.00 17.60 C ATOM 1575 N ILE A 454 4.503 20.896 8.002 1.00 17.53 N ATOM 1576 CA ILE A 454 3.843 22.213 8.222 1.00 18.19 C ATOM 1577 C ILE A 454 2.469 22.230 7.546 1.00 18.74 C ATOM 1578 O ILE A 454 1.452 22.596 8.190 1.00 20.38 O ATOM 1579 CB ILE A 454 4.727 23.351 7.708 1.00 17.95 C ATOM 1580 CG1 ILE A 454 5.987 23.472 8.564 1.00 17.61 C ATOM 1581 CG2 ILE A 454 3.914 24.643 7.651 1.00 17.67 C ATOM 1582 CD1 ILE A 454 7.077 24.301 7.934 1.00 18.36 C ATOM 1583 N TRP A 455 2.427 21.867 6.281 1.00 19.92 N ATOM 1584 CA TRP A 455 1.168 21.733 5.508 1.00 20.97 C ATOM 1585 C TRP A 455 0.137 20.942 6.309 1.00 22.00 C ATOM 1586 O TRP A 455 -1.013 21.429 6.457 1.00 21.88 O ATOM 1587 CB TRP A 455 1.464 21.042 4.185 1.00 21.28 C ATOM 1588 CG TRP A 455 0.310 21.021 3.240 1.00 20.73 C ATOM 1589 CD1 TRP A 455 -0.341 19.915 2.779 1.00 20.56 C ATOM 1590 CD2 TRP A 455 -0.275 22.147 2.571 1.00 20.55 C ATOM 1591 NE1 TRP A 455 -1.306 20.288 1.881 1.00 21.06 N ATOM 1592 CE2 TRP A 455 -1.308 21.646 1.747 1.00 20.65 C ATOM 1593 CE3 TRP A 455 -0.068 23.534 2.616 1.00 21.19 C ATOM 1594 CZ2 TRP A 455 -2.098 22.472 0.947 1.00 20.75 C ATOM 1595 CZ3 TRP A 455 -0.838 24.349 1.810 1.00 20.81 C ATOM 1596 CH2 TRP A 455 -1.832 23.823 0.981 1.00 20.48 C ATOM 1597 N GLU A 456 0.524 19.777 6.838 1.00 22.38 N ATOM 1598 CA GLU A 456 -0.428 18.883 7.565 1.00 24.32 C ATOM 1599 C GLU A 456 -0.749 19.401 8.969 1.00 22.13 C ATOM 1600 O GLU A 456 -1.840 19.125 9.450 1.00 21.14 O ATOM 1601 CB GLU A 456 0.136 17.464 7.666 1.00 29.12 C ATOM 1602 CG GLU A 456 0.190 16.780 6.312 1.00 35.44 C ATOM 1603 CD GLU A 456 -1.173 16.504 5.688 1.00 35.67 C ATOM 1604 OE1 GLU A 456 -2.118 16.176 6.457 1.00 39.93 O ATOM 1605 OE2 GLU A 456 -1.273 16.596 4.452 1.00 32.91 O ATOM 1606 N LEU A 457 0.175 20.075 9.649 1.00 21.19 N ATOM 1607 CA LEU A 457 -0.003 20.353 11.095 1.00 19.61 C ATOM 1608 C LEU A 457 -0.726 21.681 11.329 1.00 19.04 C ATOM 1609 O LEU A 457 -1.128 21.942 12.474 1.00 21.38 O ATOM 1610 CB LEU A 457 1.363 20.318 11.777 1.00 20.17 C ATOM 1611 CG LEU A 457 2.032 18.952 11.792 1.00 20.42 C ATOM 1612 CD1 LEU A 457 3.453 19.080 12.256 1.00 21.76 C ATOM 1613 CD2 LEU A 457 1.295 17.975 12.681 1.00 22.33 C ATOM 1614 N GLU A 458 -0.900 22.500 10.306 1.00 19.50 N ATOM 1615 CA GLU A 458 -1.538 23.825 10.476 1.00 19.98 C ATOM 1616 C GLU A 458 -2.909 23.626 11.147 1.00 20.63 C ATOM 1617 O GLU A 458 -3.154 24.265 12.176 1.00 17.33 O ATOM 1618 CB GLU A 458 -1.641 24.551 9.138 1.00 19.60 C ATOM 1619 CG GLU A 458 -2.610 25.714 9.171 1.00 21.75 C ATOM 1620 CD GLU A 458 -2.513 26.698 8.019 1.00 22.72 C ATOM 1621 OE1 GLU A 458 -3.163 27.742 8.115 1.00 28.87 O ATOM 1622 OE2 GLU A 458 -1.739 26.458 7.074 1.00 24.62 O ATOM 1623 N ARG A 459 -3.744 22.753 10.581 1.00 22.76 N ATOM 1624 CA ARG A 459 -5.157 22.572 10.981 1.00 24.56 C ATOM 1625 C ARG A 459 -5.214 22.145 12.451 1.00 21.17 C ATOM 1626 O ARG A 459 -5.837 22.811 13.251 1.00 21.45 O ATOM 1627 CB ARG A 459 -5.847 21.622 9.994 1.00 29.25 C ATOM 1628 CG ARG A 459 -7.307 21.298 10.298 1.00 35.96 C ATOM 1629 CD ARG A 459 -8.123 22.484 10.787 1.00 43.87 C ATOM 1630 NE ARG A 459 -7.804 23.749 10.107 1.00 52.93 N ATOM 1631 CZ ARG A 459 -8.003 24.983 10.604 1.00 53.24 C ATOM 1632 NH1 ARG A 459 -8.523 25.155 11.813 1.00 53.13 N ATOM 1633 NH2 ARG A 459 -7.664 26.043 9.886 1.00 51.24 N ATOM 1634 N PRO A 460 -4.592 21.037 12.883 1.00 20.04 N ATOM 1635 CA PRO A 460 -4.673 20.633 14.291 1.00 18.99 C ATOM 1636 C PRO A 460 -4.017 21.588 15.309 1.00 19.08 C ATOM 1637 O PRO A 460 -4.546 21.731 16.399 1.00 16.83 O ATOM 1638 CB PRO A 460 -4.012 19.246 14.339 1.00 18.41 C ATOM 1639 CG PRO A 460 -3.275 19.119 13.018 1.00 19.31 C ATOM 1640 CD PRO A 460 -3.973 20.015 12.027 1.00 19.70 C ATOM 1641 N PHE A 461 -2.948 22.294 14.941 1.00 17.28 N ATOM 1642 CA PHE A 461 -2.369 23.325 15.838 1.00 17.60 C ATOM 1643 C PHE A 461 -3.403 24.441 16.025 1.00 16.73 C ATOM 1644 O PHE A 461 -3.684 24.839 17.181 1.00 16.53 O ATOM 1645 CB PHE A 461 -1.022 23.823 15.313 1.00 16.59 C ATOM 1646 CG PHE A 461 0.093 22.976 15.831 1.00 16.55 C ATOM 1647 CD1 PHE A 461 0.354 21.735 15.279 1.00 16.72 C ATOM 1648 CD2 PHE A 461 0.863 23.412 16.881 1.00 15.84 C ATOM 1649 CE1 PHE A 461 1.351 20.934 15.796 1.00 16.31 C ATOM 1650 CE2 PHE A 461 1.856 22.606 17.387 1.00 15.67 C ATOM 1651 CZ PHE A 461 2.114 21.380 16.837 1.00 15.42 C ATOM 1652 N LEU A 462 -4.019 24.876 14.929 1.00 17.28 N ATOM 1653 CA LEU A 462 -5.015 25.984 14.968 1.00 18.31 C ATOM 1654 C LEU A 462 -6.262 25.550 15.754 1.00 18.55 C ATOM 1655 O LEU A 462 -6.799 26.387 16.474 1.00 18.98 O ATOM 1656 CB LEU A 462 -5.388 26.419 13.551 1.00 18.17 C ATOM 1657 CG LEU A 462 -4.405 27.345 12.824 1.00 17.88 C ATOM 1658 CD1 LEU A 462 -4.929 27.645 11.414 1.00 17.12 C ATOM 1659 CD2 LEU A 462 -4.174 28.656 13.589 1.00 17.23 C ATOM 1660 N ASP A 463 -6.687 24.293 15.635 1.00 19.59 N ATOM 1661 CA ASP A 463 -7.871 23.742 16.348 1.00 21.13 C ATOM 1662 C ASP A 463 -7.581 23.792 17.850 1.00 19.27 C ATOM 1663 O ASP A 463 -8.402 24.324 18.588 1.00 18.99 O ATOM 1664 CB ASP A 463 -8.201 22.308 15.897 1.00 23.81 C ATOM 1665 CG ASP A 463 -8.960 22.226 14.574 1.00 27.36 C ATOM 1666 OD1 ASP A 463 -9.475 23.266 14.141 1.00 28.82 O ATOM 1667 OD2 ASP A 463 -9.027 21.113 13.976 1.00 29.25 O ATOM 1668 N GLU A 464 -6.434 23.264 18.278 1.00 18.28 N ATOM 1669 CA GLU A 464 -6.065 23.267 19.706 1.00 18.13 C ATOM 1670 C GLU A 464 -5.869 24.714 20.209 1.00 17.03 C ATOM 1671 O GLU A 464 -6.350 25.025 21.286 1.00 16.01 O ATOM 1672 CB GLU A 464 -4.851 22.388 19.972 1.00 17.43 C ATOM 1673 CG GLU A 464 -4.617 22.330 21.473 1.00 18.17 C ATOM 1674 CD GLU A 464 -3.507 21.429 21.957 1.00 19.99 C ATOM 1675 OE1 GLU A 464 -3.377 21.284 23.194 1.00 20.62 O ATOM 1676 OE2 GLU A 464 -2.776 20.888 21.104 1.00 19.92 O ATOM 1677 N LEU A 465 -5.188 25.589 19.483 1.00 16.99 N ATOM 1678 CA LEU A 465 -5.101 27.008 19.923 1.00 18.16 C ATOM 1679 C LEU A 465 -6.508 27.590 20.144 1.00 17.82 C ATOM 1680 O LEU A 465 -6.703 28.295 21.168 1.00 15.70 O ATOM 1681 CB LEU A 465 -4.347 27.829 18.874 1.00 18.33 C ATOM 1682 CG LEU A 465 -2.854 27.552 18.777 1.00 17.08 C ATOM 1683 CD1 LEU A 465 -2.332 28.130 17.482 1.00 17.68 C ATOM 1684 CD2 LEU A 465 -2.123 28.159 19.965 1.00 17.73 C ATOM 1685 N ARG A 466 -7.434 27.301 19.233 1.00 19.99 N ATOM 1686 CA ARG A 466 -8.856 27.766 19.262 1.00 23.79 C ATOM 1687 C ARG A 466 -9.528 27.226 20.533 1.00 21.10 C ATOM 1688 O ARG A 466 -10.117 28.008 21.256 1.00 17.42 O ATOM 1689 CB ARG A 466 -9.549 27.333 17.964 1.00 30.36 C ATOM 1690 CG ARG A 466 -11.024 27.687 17.856 1.00 42.79 C ATOM 1691 CD ARG A 466 -11.338 28.881 16.962 1.00 57.68 C ATOM 1692 NE ARG A 466 -12.615 29.507 17.333 1.00 69.65 N ATOM 1693 CZ ARG A 466 -12.817 30.257 18.429 1.00 79.36 C ATOM 1694 NH1 ARG A 466 -11.822 30.496 19.275 1.00 83.98 N ATOM 1695 NH2 ARG A 466 -14.016 30.764 18.685 1.00 74.47 N ATOM 1696 N ARG A 467 -9.333 25.952 20.861 1.00 20.37 N ATOM 1697 CA ARG A 467 -9.945 25.355 22.074 1.00 23.26 C ATOM 1698 C ARG A 467 -9.371 26.062 23.314 1.00 20.83 C ATOM 1699 O ARG A 467 -10.113 26.251 24.277 1.00 16.83 O ATOM 1700 CB ARG A 467 -9.709 23.838 22.116 1.00 25.24 C ATOM 1701 CG ARG A 467 -10.664 23.042 21.239 1.00 29.41 C ATOM 1702 CD ARG A 467 -10.486 21.526 21.322 1.00 32.00 C ATOM 1703 NE ARG A 467 -9.104 21.035 21.192 1.00 36.26 N ATOM 1704 CZ ARG A 467 -8.533 20.553 20.071 1.00 33.44 C ATOM 1705 NH1 ARG A 467 -9.210 20.492 18.934 1.00 34.94 N ATOM 1706 NH2 ARG A 467 -7.280 20.121 20.097 1.00 28.20 N ATOM 1707 N ASN A 468 -8.079 26.419 23.282 1.00 19.14 N ATOM 1708 CA ASN A 468 -7.392 27.115 24.404 1.00 17.67 C ATOM 1709 C ASN A 468 -7.714 28.616 24.415 1.00 16.25 C ATOM 1710 O ASN A 468 -7.174 29.294 25.315 1.00 14.67 O ATOM 1711 CB ASN A 468 -5.868 26.977 24.324 1.00 17.60 C ATOM 1712 CG ASN A 468 -5.355 25.588 24.626 1.00 19.39 C ATOM 1713 OD1 ASN A 468 -6.148 24.672 24.876 1.00 17.48 O ATOM 1714 ND2 ASN A 468 -4.030 25.431 24.584 1.00 18.37 N