>>6PST:HELIX  117 AM9 VAL L  262  GLU L  293  1                                  32    
VPKQFDYLVNSMRVMMDRVRTQERLIMKLCVE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 117 AM9 VAL L 262 GLU L 293 1 32 ATOM 28488 N VAL L 262 165.858 144.512 233.421 1.00 99.94 N ATOM 28489 CA VAL L 262 166.037 144.879 232.021 1.00 99.94 C ATOM 28490 C VAL L 262 165.198 146.128 231.789 1.00 99.94 C ATOM 28491 O VAL L 262 164.148 146.287 232.429 1.00 99.94 O ATOM 28492 CB VAL L 262 165.637 143.730 231.082 1.00 99.94 C ATOM 28493 CG1 VAL L 262 165.551 144.211 229.647 1.00 99.94 C ATOM 28494 CG2 VAL L 262 166.635 142.585 231.198 1.00 99.94 C ATOM 28495 N PRO L 263 165.626 147.047 230.920 1.00 99.30 N ATOM 28496 CA PRO L 263 164.853 148.284 230.726 1.00 99.30 C ATOM 28497 C PRO L 263 163.426 148.055 230.260 1.00 99.30 C ATOM 28498 O PRO L 263 162.513 148.710 230.773 1.00 99.30 O ATOM 28499 CB PRO L 263 165.674 149.039 229.672 1.00 99.30 C ATOM 28500 CG PRO L 263 167.058 148.530 229.847 1.00 99.30 C ATOM 28501 CD PRO L 263 166.917 147.085 230.212 1.00 99.30 C ATOM 28502 N LYS L 264 163.202 147.128 229.327 1.00100.86 N ATOM 28503 CA LYS L 264 161.880 146.981 228.724 1.00100.86 C ATOM 28504 C LYS L 264 160.848 146.494 229.736 1.00100.86 C ATOM 28505 O LYS L 264 159.692 146.937 229.718 1.00100.86 O ATOM 28506 CB LYS L 264 161.962 146.024 227.540 1.00100.86 C ATOM 28507 CG LYS L 264 163.161 146.256 226.638 1.00100.86 C ATOM 28508 CD LYS L 264 163.358 145.093 225.672 1.00100.86 C ATOM 28509 CE LYS L 264 164.032 143.889 226.333 1.00100.86 C ATOM 28510 NZ LYS L 264 163.196 143.179 227.343 1.00100.86 N ATOM 28511 N GLN L 265 161.242 145.582 230.626 1.00101.15 N ATOM 28512 CA GLN L 265 160.330 145.142 231.675 1.00101.15 C ATOM 28513 C GLN L 265 159.994 146.291 232.618 1.00101.15 C ATOM 28514 O GLN L 265 158.854 146.419 233.084 1.00101.15 O ATOM 28515 CB GLN L 265 160.946 143.973 232.443 1.00101.15 C ATOM 28516 CG GLN L 265 161.222 142.735 231.596 1.00101.15 C ATOM 28517 CD GLN L 265 159.966 141.952 231.273 1.00101.15 C ATOM 28518 OE1 GLN L 265 158.855 142.460 231.405 1.00101.15 O ATOM 28519 NE2 GLN L 265 160.136 140.704 230.852 1.00101.15 N ATOM 28520 N PHE L 266 160.976 147.144 232.904 1.00100.76 N ATOM 28521 CA PHE L 266 160.715 148.303 233.747 1.00100.76 C ATOM 28522 C PHE L 266 159.753 149.271 233.067 1.00100.76 C ATOM 28523 O PHE L 266 158.880 149.852 233.722 1.00100.76 O ATOM 28524 CB PHE L 266 162.034 148.986 234.106 1.00100.76 C ATOM 28525 CG PHE L 266 161.881 150.404 234.570 1.00100.76 C ATOM 28526 CD1 PHE L 266 161.133 150.705 235.698 1.00100.76 C ATOM 28527 CD2 PHE L 266 162.497 151.435 233.885 1.00100.76 C ATOM 28528 CE1 PHE L 266 160.997 152.008 236.124 1.00100.76 C ATOM 28529 CE2 PHE L 266 162.366 152.738 234.307 1.00100.76 C ATOM 28530 CZ PHE L 266 161.615 153.025 235.429 1.00100.76 C ATOM 28531 N ASP L 267 159.888 149.445 231.753 1.00 99.27 N ATOM 28532 CA ASP L 267 158.909 150.237 231.018 1.00 99.27 C ATOM 28533 C ASP L 267 157.526 149.613 231.117 1.00 99.27 C ATOM 28534 O ASP L 267 156.520 150.323 231.221 1.00 99.27 O ATOM 28535 CB ASP L 267 159.326 150.363 229.555 1.00 99.27 C ATOM 28536 CG ASP L 267 160.799 150.628 229.398 1.00 99.27 C ATOM 28537 OD1 ASP L 267 161.321 151.515 230.101 1.00 99.27 O ATOM 28538 OD2 ASP L 267 161.444 149.929 228.594 1.00 99.27 O ATOM 28539 N TYR L 268 157.459 148.283 231.061 1.00101.45 N ATOM 28540 CA TYR L 268 156.178 147.606 231.218 1.00101.45 C ATOM 28541 C TYR L 268 155.559 147.922 232.572 1.00101.45 C ATOM 28542 O TYR L 268 154.346 148.136 232.678 1.00101.45 O ATOM 28543 CB TYR L 268 156.361 146.098 231.048 1.00101.45 C ATOM 28544 CG TYR L 268 155.118 145.298 231.373 1.00101.45 C ATOM 28545 CD1 TYR L 268 154.121 145.117 230.427 1.00101.45 C ATOM 28546 CD2 TYR L 268 154.940 144.731 232.628 1.00101.45 C ATOM 28547 CE1 TYR L 268 152.987 144.396 230.722 1.00101.45 C ATOM 28548 CE2 TYR L 268 153.807 144.017 232.929 1.00101.45 C ATOM 28549 CZ TYR L 268 152.837 143.848 231.973 1.00101.45 C ATOM 28550 OH TYR L 268 151.710 143.125 232.281 1.00101.45 O ATOM 28551 N LEU L 269 156.379 147.937 233.621 1.00 98.33 N ATOM 28552 CA LEU L 269 155.883 148.315 234.943 1.00 98.33 C ATOM 28553 C LEU L 269 155.384 149.753 234.948 1.00 98.33 C ATOM 28554 O LEU L 269 154.360 150.070 235.575 1.00 98.33 O ATOM 28555 CB LEU L 269 156.984 148.135 235.982 1.00 98.33 C ATOM 28556 CG LEU L 269 157.712 146.806 235.855 1.00 98.33 C ATOM 28557 CD1 LEU L 269 158.627 146.579 237.046 1.00 98.33 C ATOM 28558 CD2 LEU L 269 156.697 145.702 235.738 1.00 98.33 C ATOM 28559 N VAL L 270 156.114 150.635 234.262 1.00 97.21 N ATOM 28560 CA VAL L 270 155.701 152.029 234.135 1.00 97.21 C ATOM 28561 C VAL L 270 154.314 152.114 233.517 1.00 97.21 C ATOM 28562 O VAL L 270 153.430 152.812 234.025 1.00 97.21 O ATOM 28563 CB VAL L 270 156.734 152.813 233.308 1.00 97.21 C ATOM 28564 CG1 VAL L 270 156.229 154.212 233.034 1.00 97.21 C ATOM 28565 CG2 VAL L 270 158.071 152.858 234.026 1.00 97.21 C ATOM 28566 N ASN L 271 154.101 151.388 232.421 1.00 97.04 N ATOM 28567 CA ASN L 271 152.805 151.397 231.750 1.00 97.04 C ATOM 28568 C ASN L 271 151.719 150.752 232.603 1.00 97.04 C ATOM 28569 O ASN L 271 150.554 151.157 232.532 1.00 97.04 O ATOM 28570 CB ASN L 271 152.924 150.689 230.405 1.00 97.04 C ATOM 28571 CG ASN L 271 154.169 151.095 229.653 1.00 97.04 C ATOM 28572 OD1 ASN L 271 154.730 152.160 229.901 1.00 97.04 O ATOM 28573 ND2 ASN L 271 154.617 150.245 228.740 1.00 97.04 N ATOM 28574 N SER L 272 152.078 149.752 233.408 1.00 95.91 N ATOM 28575 CA SER L 272 151.120 149.169 234.341 1.00 95.91 C ATOM 28576 C SER L 272 150.601 150.223 235.311 1.00 95.91 C ATOM 28577 O SER L 272 149.384 150.408 235.463 1.00 95.91 O ATOM 28578 CB SER L 272 151.775 148.009 235.097 1.00 95.91 C ATOM 28579 OG SER L 272 150.846 147.350 235.936 1.00 95.91 O ATOM 28580 N MET L 273 151.519 150.936 235.967 1.00102.30 N ATOM 28581 CA MET L 273 151.106 151.982 236.899 1.00102.30 C ATOM 28582 C MET L 273 150.355 153.094 236.177 1.00102.30 C ATOM 28583 O MET L 273 149.413 153.681 236.728 1.00102.30 O ATOM 28584 CB MET L 273 152.320 152.541 237.636 1.00102.30 C ATOM 28585 CG MET L 273 153.252 151.474 238.158 1.00102.30 C ATOM 28586 SD MET L 273 154.299 152.075 239.491 1.00102.30 S ATOM 28587 CE MET L 273 155.355 150.652 239.738 1.00102.30 C ATOM 28588 N ARG L 274 150.760 153.394 234.940 1.00 99.83 N ATOM 28589 CA ARG L 274 150.057 154.394 234.145 1.00 99.83 C ATOM 28590 C ARG L 274 148.599 154.009 233.954 1.00 99.83 C ATOM 28591 O ARG L 274 147.702 154.808 234.223 1.00 99.83 O ATOM 28592 CB ARG L 274 150.731 154.570 232.785 1.00 99.83 C ATOM 28593 CG ARG L 274 152.107 155.189 232.821 1.00 99.83 C ATOM 28594 CD ARG L 274 152.462 155.731 231.448 1.00 99.83 C ATOM 28595 NE ARG L 274 153.899 155.694 231.195 1.00 99.83 N ATOM 28596 CZ ARG L 274 154.712 156.735 231.334 1.00 99.83 C ATOM 28597 NH1 ARG L 274 154.233 157.910 231.723 1.00 99.83 N ATOM 28598 NH2 ARG L 274 156.005 156.603 231.076 1.00 99.83 N ATOM 28599 N VAL L 275 148.348 152.784 233.488 1.00102.33 N ATOM 28600 CA VAL L 275 146.975 152.339 233.254 1.00102.33 C ATOM 28601 C VAL L 275 146.190 152.308 234.560 1.00102.33 C ATOM 28602 O VAL L 275 144.992 152.618 234.589 1.00102.33 O ATOM 28603 CB VAL L 275 146.966 150.966 232.558 1.00102.33 C ATOM 28604 CG1 VAL L 275 145.633 150.272 232.776 1.00102.33 C ATOM 28605 CG2 VAL L 275 147.240 151.132 231.079 1.00102.33 C ATOM 28606 N MET L 276 146.851 151.936 235.658 1.00106.34 N ATOM 28607 CA MET L 276 146.190 151.924 236.959 1.00106.34 C ATOM 28608 C MET L 276 145.677 153.314 237.323 1.00106.34 C ATOM 28609 O MET L 276 144.472 153.524 237.548 1.00106.34 O ATOM 28610 CB MET L 276 147.167 151.407 238.018 1.00106.34 C ATOM 28611 CG MET L 276 146.579 151.272 239.410 1.00106.34 C ATOM 28612 SD MET L 276 145.440 149.879 239.555 1.00106.34 S ATOM 28613 CE MET L 276 146.560 148.494 239.367 1.00106.34 C ATOM 28614 N MET L 277 146.592 154.283 237.373 1.00104.57 N ATOM 28615 CA MET L 277 146.205 155.654 237.677 1.00104.57 C ATOM 28616 C MET L 277 145.237 156.219 236.647 1.00104.57 C ATOM 28617 O MET L 277 144.396 157.049 236.997 1.00104.57 O ATOM 28618 CB MET L 277 147.450 156.537 237.778 1.00104.57 C ATOM 28619 CG MET L 277 147.158 157.994 238.088 1.00104.57 C ATOM 28620 SD MET L 277 146.383 158.250 239.694 1.00104.57 S ATOM 28621 CE MET L 277 146.191 160.030 239.699 1.00104.57 C ATOM 28622 N ASP L 278 145.313 155.771 235.395 1.00102.37 N ATOM 28623 CA ASP L 278 144.427 156.293 234.364 1.00102.37 C ATOM 28624 C ASP L 278 142.998 155.815 234.568 1.00102.37 C ATOM 28625 O ASP L 278 142.055 156.600 234.442 1.00102.37 O ATOM 28626 CB ASP L 278 144.933 155.891 232.979 1.00102.37 C ATOM 28627 CG ASP L 278 146.167 156.661 232.565 1.00102.37 C ATOM 28628 OD1 ASP L 278 146.256 157.862 232.891 1.00102.37 O ATOM 28629 OD2 ASP L 278 147.052 156.062 231.920 1.00102.37 O ATOM 28630 N ARG L 279 142.816 154.529 234.877 1.00104.13 N ATOM 28631 CA ARG L 279 141.477 154.040 235.186 1.00104.13 C ATOM 28632 C ARG L 279 140.930 154.709 236.439 1.00104.13 C ATOM 28633 O ARG L 279 139.740 155.046 236.502 1.00104.13 O ATOM 28634 CB ARG L 279 141.487 152.523 235.348 1.00104.13 C ATOM 28635 CG ARG L 279 140.908 151.766 234.169 1.00104.13 C ATOM 28636 CD ARG L 279 140.662 150.317 234.549 1.00104.13 C ATOM 28637 NE ARG L 279 139.588 150.180 235.531 1.00104.13 N ATOM 28638 CZ ARG L 279 139.464 149.159 236.375 1.00104.13 C ATOM 28639 NH1 ARG L 279 140.358 148.178 236.377 1.00104.13 N ATOM 28640 NH2 ARG L 279 138.447 149.123 237.225 1.00104.13 N ATOM 28641 N VAL L 280 141.786 154.926 237.443 1.00105.39 N ATOM 28642 CA VAL L 280 141.353 155.648 238.641 1.00105.39 C ATOM 28643 C VAL L 280 140.854 157.046 238.279 1.00105.39 C ATOM 28644 O VAL L 280 139.722 157.438 238.604 1.00105.39 O ATOM 28645 CB VAL L 280 142.497 155.716 239.667 1.00105.39 C ATOM 28646 CG1 VAL L 280 142.199 156.780 240.717 1.00105.39 C ATOM 28647 CG2 VAL L 280 142.715 154.354 240.308 1.00105.39 C ATOM 28648 N ARG L 281 141.694 157.823 237.596 1.00104.52 N ATOM 28649 CA ARG L 281 141.322 159.194 237.287 1.00104.52 C ATOM 28650 C ARG L 281 140.164 159.255 236.304 1.00104.52 C ATOM 28651 O ARG L 281 139.426 160.237 236.296 1.00104.52 O ATOM 28652 CB ARG L 281 142.522 159.965 236.743 1.00104.52 C ATOM 28653 CG ARG L 281 142.346 161.470 236.833 1.00104.52 C ATOM 28654 CD ARG L 281 143.466 162.223 236.149 1.00104.52 C ATOM 28655 NE ARG L 281 144.787 161.887 236.670 1.00104.52 N ATOM 28656 CZ ARG L 281 145.583 160.959 236.149 1.00104.52 C ATOM 28657 NH1 ARG L 281 145.192 160.257 235.093 1.00104.52 N ATOM 28658 NH2 ARG L 281 146.771 160.730 236.684 1.00104.52 N ATOM 28659 N THR L 282 139.970 158.221 235.480 1.00106.80 N ATOM 28660 CA THR L 282 138.822 158.216 234.576 1.00106.80 C ATOM 28661 C THR L 282 137.538 157.872 235.314 1.00106.80 C ATOM 28662 O THR L 282 136.453 158.315 234.915 1.00106.80 O ATOM 28663 CB THR L 282 139.053 157.243 233.421 1.00106.80 C ATOM 28664 OG1 THR L 282 140.138 157.712 232.612 1.00106.80 O ATOM 28665 CG2 THR L 282 137.802 157.133 232.564 1.00106.80 C ATOM 28666 N GLN L 283 137.636 157.082 236.383 1.00105.39 N ATOM 28667 CA GLN L 283 136.521 157.009 237.316 1.00105.39 C ATOM 28668 C GLN L 283 136.208 158.390 237.866 1.00105.39 C ATOM 28669 O GLN L 283 135.042 158.802 237.913 1.00105.39 O ATOM 28670 CB GLN L 283 136.839 156.032 238.446 1.00105.39 C ATOM 28671 CG GLN L 283 136.981 154.594 237.983 1.00105.39 C ATOM 28672 CD GLN L 283 135.785 154.125 237.180 1.00105.39 C ATOM 28673 OE1 GLN L 283 134.664 154.595 237.377 1.00105.39 O ATOM 28674 NE2 GLN L 283 136.020 153.202 236.260 1.00105.39 N ATOM 28675 N GLU L 284 137.252 159.128 238.258 1.00106.52 N ATOM 28676 CA GLU L 284 137.072 160.524 238.662 1.00106.52 C ATOM 28677 C GLU L 284 136.394 161.337 237.561 1.00106.52 C ATOM 28678 O GLU L 284 135.549 162.194 237.841 1.00106.52 O ATOM 28679 CB GLU L 284 138.421 161.152 239.027 1.00106.52 C ATOM 28680 CG GLU L 284 139.195 160.440 240.139 1.00106.52 C ATOM 28681 CD GLU L 284 140.615 160.971 240.313 1.00106.52 C ATOM 28682 OE1 GLU L 284 140.788 162.200 240.458 1.00106.52 O ATOM 28683 OE2 GLU L 284 141.563 160.156 240.299 1.00106.52 O ATOM 28684 N ARG L 285 136.754 161.076 236.304 1.00105.40 N ATOM 28685 CA ARG L 285 136.223 161.845 235.182 1.00105.40 C ATOM 28686 C ARG L 285 134.731 161.607 235.007 1.00105.40 C ATOM 28687 O ARG L 285 133.935 162.555 235.017 1.00105.40 O ATOM 28688 CB ARG L 285 136.956 161.472 233.892 1.00105.40 C ATOM 28689 CG ARG L 285 138.460 161.646 233.935 1.00105.40 C ATOM 28690 CD ARG L 285 138.840 162.822 234.812 1.00105.40 C ATOM 28691 NE ARG L 285 140.232 163.218 234.645 1.00105.40 N ATOM 28692 CZ ARG L 285 140.616 164.284 233.954 1.00105.40 C ATOM 28693 NH1 ARG L 285 139.708 165.053 233.370 1.00105.40 N ATOM 28694 NH2 ARG L 285 141.902 164.585 233.853 1.00105.40 N ATOM 28695 N LEU L 286 134.338 160.341 234.848 1.00105.88 N ATOM 28696 CA LEU L 286 132.925 160.014 234.680 1.00105.88 C ATOM 28697 C LEU L 286 132.115 160.393 235.914 1.00105.88 C ATOM 28698 O LEU L 286 130.913 160.661 235.815 1.00105.88 O ATOM 28699 CB LEU L 286 132.759 158.527 234.365 1.00105.88 C ATOM 28700 CG LEU L 286 131.313 158.039 234.238 1.00105.88 C ATOM 28701 CD1 LEU L 286 130.580 158.781 233.137 1.00105.88 C ATOM 28702 CD2 LEU L 286 131.263 156.535 233.997 1.00105.88 C ATOM 28703 N ILE L 287 132.750 160.425 237.087 1.00106.12 N ATOM 28704 CA ILE L 287 132.051 160.858 238.293 1.00106.12 C ATOM 28705 C ILE L 287 131.787 162.356 238.244 1.00106.12 C ATOM 28706 O ILE L 287 130.635 162.806 238.216 1.00106.12 O ATOM 28707 CB ILE L 287 132.858 160.481 239.547 1.00106.12 C ATOM 28708 CG1 ILE L 287 132.719 158.995 239.850 1.00106.12 C ATOM 28709 CG2 ILE L 287 132.419 161.317 240.741 1.00106.12 C ATOM 28710 CD1 ILE L 287 133.439 158.573 241.108 1.00106.12 C ATOM 28711 N MET L 288 132.857 163.149 238.218 1.00108.21 N ATOM 28712 CA MET L 288 132.728 164.590 238.397 1.00108.21 C ATOM 28713 C MET L 288 132.024 165.237 237.212 1.00108.21 C ATOM 28714 O MET L 288 131.154 166.096 237.392 1.00108.21 O ATOM 28715 CB MET L 288 134.108 165.210 238.616 1.00108.21 C ATOM 28716 CG MET L 288 134.071 166.689 238.914 1.00108.21 C ATOM 28717 SD MET L 288 135.357 167.581 238.025 1.00108.21 S ATOM 28718 CE MET L 288 135.138 166.901 236.386 1.00108.21 C ATOM 28719 N LYS L 289 132.388 164.843 235.989 1.00109.21 N ATOM 28720 CA LYS L 289 131.761 165.433 234.811 1.00109.21 C ATOM 28721 C LYS L 289 130.267 165.142 234.752 1.00109.21 C ATOM 28722 O LYS L 289 129.524 165.898 234.118 1.00109.21 O ATOM 28723 CB LYS L 289 132.457 164.928 233.545 1.00109.21 C ATOM 28724 CG LYS L 289 133.954 165.198 233.541 1.00109.21 C ATOM 28725 CD LYS L 289 134.685 164.361 232.507 1.00109.21 C ATOM 28726 CE LYS L 289 134.406 164.830 231.090 1.00109.21 C ATOM 28727 NZ LYS L 289 135.275 164.118 230.111 1.00109.21 N ATOM 28728 N LEU L 290 129.810 164.078 235.405 1.00108.83 N ATOM 28729 CA LEU L 290 128.390 163.803 235.538 1.00108.83 C ATOM 28730 C LEU L 290 127.810 164.402 236.814 1.00108.83 C ATOM 28731 O LEU L 290 126.620 164.216 237.094 1.00108.83 O ATOM 28732 CB LEU L 290 128.136 162.297 235.484 1.00108.83 C ATOM 28733 CG LEU L 290 128.276 161.645 234.104 1.00108.83 C ATOM 28734 CD1 LEU L 290 127.591 160.283 234.079 1.00108.83 C ATOM 28735 CD2 LEU L 290 127.721 162.550 233.016 1.00108.83 C ATOM 28736 N CYS L 291 128.624 165.109 237.589 1.00110.46 N ATOM 28737 CA CYS L 291 128.159 165.970 238.669 1.00110.46 C ATOM 28738 C CYS L 291 128.411 167.438 238.379 1.00110.46 C ATOM 28739 O CYS L 291 127.586 168.285 238.728 1.00110.46 O ATOM 28740 CB CYS L 291 128.840 165.594 239.993 1.00110.46 C ATOM 28741 SG CYS L 291 128.591 163.888 240.521 1.00110.46 S ATOM 28742 N VAL L 292 129.527 167.755 237.723 1.00110.73 N ATOM 28743 CA VAL L 292 129.836 169.141 237.395 1.00110.73 C ATOM 28744 C VAL L 292 128.958 169.635 236.254 1.00110.73 C ATOM 28745 O VAL L 292 128.477 170.773 236.273 1.00110.73 O ATOM 28746 CB VAL L 292 131.330 169.284 237.056 1.00110.73 C ATOM 28747 CG1 VAL L 292 131.575 170.578 236.296 1.00110.73 C ATOM 28748 CG2 VAL L 292 132.157 169.246 238.326 1.00110.73 C ATOM 28749 N GLU L 293 128.757 168.805 235.233 1.00111.18 N ATOM 28750 CA GLU L 293 127.978 169.200 234.068 1.00111.18 C ATOM 28751 C GLU L 293 126.602 168.559 234.023 1.00111.18 C ATOM 28752 O GLU L 293 125.668 169.169 233.493 1.00111.18 O ATOM 28753 CB GLU L 293 128.739 168.862 232.783 1.00111.18 C ATOM 28754 CG GLU L 293 130.024 169.652 232.604 1.00111.18 C ATOM 28755 CD GLU L 293 131.223 168.763 232.344 1.00111.18 C ATOM 28756 OE1 GLU L 293 131.194 167.579 232.742 1.00111.18 O ATOM 28757 OE2 GLU L 293 132.198 169.251 231.736 1.00111.18 O