>>6PSU:HELIX   42 AE6 ASP I  942  LEU I  979  1                                  38    
DKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 42 AE6 ASP I 942 LEU I 979 1 38 ATOM 11426 N ASP I 942 186.141 203.228 181.821 1.00 23.53 N ATOM 11427 CA ASP I 942 187.291 202.573 182.418 1.00 23.53 C ATOM 11428 C ASP I 942 188.592 203.078 181.813 1.00 23.53 C ATOM 11429 O ASP I 942 188.615 203.681 180.739 1.00 23.53 O ATOM 11430 CB ASP I 942 187.201 201.059 182.245 1.00 23.53 C ATOM 11431 CG ASP I 942 188.052 200.315 183.243 1.00 23.53 C ATOM 11432 OD1 ASP I 942 187.828 199.103 183.433 1.00 23.53 O ATOM 11433 OD2 ASP I 942 188.948 200.950 183.835 1.00 23.53 O ATOM 11434 N LYS I 943 189.683 202.821 182.534 1.00 21.27 N ATOM 11435 CA LYS I 943 191.013 203.173 182.051 1.00 21.27 C ATOM 11436 C LYS I 943 191.297 202.510 180.712 1.00 21.27 C ATOM 11437 O LYS I 943 191.695 203.170 179.745 1.00 21.27 O ATOM 11438 CB LYS I 943 192.060 202.772 183.091 1.00 21.27 C ATOM 11439 CG LYS I 943 193.501 202.849 182.619 1.00 21.27 C ATOM 11440 CD LYS I 943 194.031 204.273 182.628 1.00 21.27 C ATOM 11441 CE LYS I 943 195.542 204.293 182.421 1.00 21.27 C ATOM 11442 NZ LYS I 943 196.111 205.662 182.245 1.00 21.27 N ATOM 11443 N ARG I 944 191.087 201.199 180.632 1.00 18.65 N ATOM 11444 CA ARG I 944 191.264 200.531 179.352 1.00 18.65 C ATOM 11445 C ARG I 944 190.222 200.975 178.342 1.00 18.65 C ATOM 11446 O ARG I 944 190.503 201.003 177.140 1.00 18.65 O ATOM 11447 CB ARG I 944 191.206 199.021 179.510 1.00 18.65 C ATOM 11448 CG ARG I 944 191.262 198.322 178.180 1.00 18.65 C ATOM 11449 CD ARG I 944 191.705 196.898 178.334 1.00 18.65 C ATOM 11450 NE ARG I 944 192.271 196.379 177.098 1.00 18.65 N ATOM 11451 CZ ARG I 944 193.536 196.015 176.964 1.00 18.65 C ATOM 11452 NH1 ARG I 944 194.360 196.109 177.996 1.00 18.65 N ATOM 11453 NH2 ARG I 944 193.969 195.553 175.804 1.00 18.65 N ATOM 11454 N ALA I 945 189.022 201.320 178.804 1.00 21.65 N ATOM 11455 CA ALA I 945 188.009 201.821 177.887 1.00 21.65 C ATOM 11456 C ALA I 945 188.484 203.089 177.198 1.00 21.65 C ATOM 11457 O ALA I 945 188.422 203.196 175.972 1.00 21.65 O ATOM 11458 CB ALA I 945 186.706 202.078 178.632 1.00 21.65 C ATOM 11459 N LEU I 946 189.000 204.048 177.972 1.00 23.95 N ATOM 11460 CA LEU I 946 189.463 205.305 177.392 1.00 23.95 C ATOM 11461 C LEU I 946 190.737 205.103 176.584 1.00 23.95 C ATOM 11462 O LEU I 946 190.982 205.821 175.608 1.00 23.95 O ATOM 11463 CB LEU I 946 189.676 206.345 178.493 1.00 23.95 C ATOM 11464 CG LEU I 946 188.493 206.539 179.449 1.00 23.95 C ATOM 11465 CD1 LEU I 946 188.697 207.709 180.394 1.00 23.95 C ATOM 11466 CD2 LEU I 946 187.215 206.722 178.669 1.00 23.95 C ATOM 11467 N GLU I 947 191.559 204.125 176.963 1.00 24.29 N ATOM 11468 CA GLU I 947 192.726 203.809 176.147 1.00 24.29 C ATOM 11469 C GLU I 947 192.304 203.305 174.773 1.00 24.29 C ATOM 11470 O GLU I 947 192.818 203.751 173.738 1.00 24.29 O ATOM 11471 CB GLU I 947 193.588 202.774 176.860 1.00 24.29 C ATOM 11472 CG GLU I 947 194.217 203.285 178.133 1.00 24.29 C ATOM 11473 CD GLU I 947 194.544 202.173 179.103 1.00 24.29 C ATOM 11474 OE1 GLU I 947 194.164 201.013 178.839 1.00 24.29 O ATOM 11475 OE2 GLU I 947 195.190 202.456 180.129 1.00 24.29 O ATOM 11476 N ILE I 948 191.352 202.374 174.750 1.00 22.64 N ATOM 11477 CA ILE I 948 190.781 201.910 173.494 1.00 22.64 C ATOM 11478 C ILE I 948 190.123 203.063 172.758 1.00 22.64 C ATOM 11479 O ILE I 948 190.097 203.098 171.527 1.00 22.64 O ATOM 11480 CB ILE I 948 189.790 200.766 173.760 1.00 22.64 C ATOM 11481 CG1 ILE I 948 190.545 199.497 174.127 1.00 22.64 C ATOM 11482 CG2 ILE I 948 188.927 200.518 172.559 1.00 22.64 C ATOM 11483 CD1 ILE I 948 189.667 198.310 174.219 1.00 22.64 C ATOM 11484 N GLU I 949 189.595 204.030 173.501 1.00 27.58 N ATOM 11485 CA GLU I 949 189.029 205.225 172.888 1.00 27.58 C ATOM 11486 C GLU I 949 190.081 205.994 172.103 1.00 27.58 C ATOM 11487 O GLU I 949 189.853 206.373 170.949 1.00 27.58 O ATOM 11488 CB GLU I 949 188.421 206.123 173.963 1.00 27.58 C ATOM 11489 CG GLU I 949 187.462 207.143 173.417 1.00 27.58 C ATOM 11490 CD GLU I 949 186.236 206.506 172.812 1.00 27.58 C ATOM 11491 OE1 GLU I 949 185.850 205.412 173.269 1.00 27.58 O ATOM 11492 OE2 GLU I 949 185.658 207.095 171.878 1.00 27.58 O ATOM 11493 N GLU I 950 191.220 206.265 172.735 1.00 26.75 N ATOM 11494 CA GLU I 950 192.312 206.934 172.039 1.00 26.75 C ATOM 11495 C GLU I 950 192.735 206.146 170.812 1.00 26.75 C ATOM 11496 O GLU I 950 192.928 206.717 169.728 1.00 26.75 O ATOM 11497 CB GLU I 950 193.496 207.123 172.983 1.00 26.75 C ATOM 11498 CG GLU I 950 194.595 208.026 172.445 1.00 26.75 C ATOM 11499 CD GLU I 950 195.639 207.275 171.636 1.00 26.75 C ATOM 11500 OE1 GLU I 950 195.959 206.126 172.005 1.00 26.75 O ATOM 11501 OE2 GLU I 950 196.139 207.833 170.634 1.00 26.75 O ATOM 11502 N MET I 951 192.891 204.830 170.970 1.00 26.30 N ATOM 11503 CA MET I 951 193.319 203.996 169.851 1.00 26.30 C ATOM 11504 C MET I 951 192.329 204.089 168.699 1.00 26.30 C ATOM 11505 O MET I 951 192.716 204.261 167.539 1.00 26.30 O ATOM 11506 CB MET I 951 193.480 202.550 170.312 1.00 26.30 C ATOM 11507 CG MET I 951 194.741 201.888 169.810 1.00 26.30 C ATOM 11508 SD MET I 951 194.868 200.185 170.355 1.00 26.30 S ATOM 11509 CE MET I 951 194.919 200.413 172.129 1.00 26.30 C ATOM 11510 N GLN I 952 191.039 204.020 169.014 1.00 27.27 N ATOM 11511 CA GLN I 952 190.010 204.070 167.988 1.00 27.27 C ATOM 11512 C GLN I 952 190.006 205.414 167.280 1.00 27.27 C ATOM 11513 O GLN I 952 189.896 205.477 166.048 1.00 27.27 O ATOM 11514 CB GLN I 952 188.650 203.803 168.623 1.00 27.27 C ATOM 11515 CG GLN I 952 187.675 203.222 167.668 1.00 27.27 C ATOM 11516 CD GLN I 952 188.271 202.050 166.963 1.00 27.27 C ATOM 11517 OE1 GLN I 952 188.507 202.086 165.760 1.00 27.27 O ATOM 11518 NE2 GLN I 952 188.548 201.001 167.714 1.00 27.27 N ATOM 11519 N LEU I 953 190.094 206.501 168.046 1.00 28.66 N ATOM 11520 CA LEU I 953 190.069 207.825 167.444 1.00 28.66 C ATOM 11521 C LEU I 953 191.231 207.995 166.484 1.00 28.66 C ATOM 11522 O LEU I 953 191.048 208.453 165.350 1.00 28.66 O ATOM 11523 CB LEU I 953 190.113 208.906 168.521 1.00 28.66 C ATOM 11524 CG LEU I 953 189.058 208.883 169.627 1.00 28.66 C ATOM 11525 CD1 LEU I 953 189.553 209.669 170.822 1.00 28.66 C ATOM 11526 CD2 LEU I 953 187.726 209.414 169.132 1.00 28.66 C ATOM 11527 N LYS I 954 192.437 207.624 166.919 1.00 30.73 N ATOM 11528 CA LYS I 954 193.578 207.708 166.017 1.00 30.73 C ATOM 11529 C LYS I 954 193.389 206.794 164.819 1.00 30.73 C ATOM 11530 O LYS I 954 193.844 207.106 163.717 1.00 30.73 O ATOM 11531 CB LYS I 954 194.876 207.349 166.735 1.00 30.73 C ATOM 11532 CG LYS I 954 195.968 206.937 165.762 1.00 30.73 C ATOM 11533 CD LYS I 954 196.995 206.027 166.398 1.00 30.73 C ATOM 11534 CE LYS I 954 197.855 205.373 165.330 1.00 30.73 C ATOM 11535 NZ LYS I 954 198.879 204.457 165.902 1.00 30.73 N ATOM 11536 N GLN I 955 192.718 205.659 165.013 1.00 30.08 N ATOM 11537 CA GLN I 955 192.495 204.751 163.896 1.00 30.08 C ATOM 11538 C GLN I 955 191.665 205.428 162.817 1.00 30.08 C ATOM 11539 O GLN I 955 192.033 205.428 161.637 1.00 30.08 O ATOM 11540 CB GLN I 955 191.810 203.481 164.390 1.00 30.08 C ATOM 11541 CG GLN I 955 192.052 202.273 163.509 1.00 30.08 C ATOM 11542 CD GLN I 955 193.516 202.058 163.204 1.00 30.08 C ATOM 11543 OE1 GLN I 955 194.231 201.418 163.971 1.00 30.08 O ATOM 11544 NE2 GLN I 955 193.975 202.608 162.088 1.00 30.08 N ATOM 11545 N ALA I 956 190.567 206.058 163.220 1.00 30.92 N ATOM 11546 CA ALA I 956 189.722 206.744 162.250 1.00 30.92 C ATOM 11547 C ALA I 956 190.449 207.925 161.617 1.00 30.92 C ATOM 11548 O ALA I 956 190.369 208.136 160.397 1.00 30.92 O ATOM 11549 CB ALA I 956 188.424 207.198 162.915 1.00 30.92 C ATOM 11550 N LYS I 957 191.166 208.710 162.426 1.00 33.86 N ATOM 11551 CA LYS I 957 191.845 209.875 161.871 1.00 33.86 C ATOM 11552 C LYS I 957 192.917 209.464 160.877 1.00 33.86 C ATOM 11553 O LYS I 957 193.027 210.058 159.805 1.00 33.86 O ATOM 11554 CB LYS I 957 192.474 210.736 162.961 1.00 33.86 C ATOM 11555 CG LYS I 957 193.523 211.668 162.363 1.00 33.86 C ATOM 11556 CD LYS I 957 194.074 212.675 163.341 1.00 33.86 C ATOM 11557 CE LYS I 957 194.996 212.033 164.363 1.00 33.86 C ATOM 11558 NZ LYS I 957 195.721 213.066 165.163 1.00 33.86 N ATOM 11559 N LYS I 958 193.735 208.472 161.223 1.00 36.51 N ATOM 11560 CA LYS I 958 194.772 208.020 160.307 1.00 36.51 C ATOM 11561 C LYS I 958 194.155 207.370 159.078 1.00 36.51 C ATOM 11562 O LYS I 958 194.737 207.410 157.988 1.00 36.51 O ATOM 11563 CB LYS I 958 195.718 207.063 161.032 1.00 36.51 C ATOM 11564 CG LYS I 958 196.900 206.590 160.213 1.00 36.51 C ATOM 11565 CD LYS I 958 197.705 205.568 160.998 1.00 36.51 C ATOM 11566 CE LYS I 958 197.099 204.179 160.884 1.00 36.51 C ATOM 11567 NZ LYS I 958 197.585 203.252 161.940 1.00 36.51 N ATOM 11568 N ASP I 959 192.969 206.778 159.230 1.00 37.53 N ATOM 11569 CA ASP I 959 192.189 206.388 158.066 1.00 37.53 C ATOM 11570 C ASP I 959 191.995 207.562 157.128 1.00 37.53 C ATOM 11571 O ASP I 959 192.340 207.489 155.942 1.00 37.53 O ATOM 11572 CB ASP I 959 190.833 205.846 158.503 1.00 37.53 C ATOM 11573 CG ASP I 959 189.930 205.536 157.331 1.00 37.53 C ATOM 11574 OD1 ASP I 959 190.156 204.517 156.649 1.00 37.53 O ATOM 11575 OD2 ASP I 959 188.997 206.325 157.085 1.00 37.53 O ATOM 11576 N LEU I 960 191.432 208.650 157.646 1.00 40.71 N ATOM 11577 CA LEU I 960 191.205 209.815 156.799 1.00 40.71 C ATOM 11578 C LEU I 960 192.508 210.406 156.288 1.00 40.71 C ATOM 11579 O LEU I 960 192.547 210.911 155.171 1.00 40.71 O ATOM 11580 CB LEU I 960 190.401 210.879 157.530 1.00 40.71 C ATOM 11581 CG LEU I 960 188.920 210.821 157.194 1.00 40.71 C ATOM 11582 CD1 LEU I 960 188.248 209.658 157.913 1.00 40.71 C ATOM 11583 CD2 LEU I 960 188.278 212.150 157.531 1.00 40.71 C ATOM 11584 N SER I 961 193.579 210.336 157.074 1.00 43.65 N ATOM 11585 CA SER I 961 194.865 210.858 156.624 1.00 43.65 C ATOM 11586 C SER I 961 195.372 210.097 155.413 1.00 43.65 C ATOM 11587 O SER I 961 195.723 210.700 154.389 1.00 43.65 O ATOM 11588 CB SER I 961 195.896 210.781 157.746 1.00 43.65 C ATOM 11589 OG SER I 961 197.204 210.729 157.209 1.00 43.65 O ATOM 11590 N GLU I 962 195.400 208.769 155.502 1.00 39.19 N ATOM 11591 CA GLU I 962 195.907 207.978 154.392 1.00 39.19 C ATOM 11592 C GLU I 962 194.984 208.061 153.188 1.00 39.19 C ATOM 11593 O GLU I 962 195.454 208.083 152.044 1.00 39.19 O ATOM 11594 CB GLU I 962 196.119 206.534 154.832 1.00 39.19 C ATOM 11595 CG GLU I 962 197.458 206.336 155.523 1.00 39.19 C ATOM 11596 CD GLU I 962 197.478 205.136 156.437 1.00 39.19 C ATOM 11597 OE1 GLU I 962 196.400 204.735 156.922 1.00 39.19 O ATOM 11598 OE2 GLU I 962 198.576 204.587 156.665 1.00 39.19 O ATOM 11599 N GLU I 963 193.669 208.139 153.413 1.00 43.84 N ATOM 11600 CA GLU I 963 192.763 208.253 152.273 1.00 43.84 C ATOM 11601 C GLU I 963 192.857 209.629 151.622 1.00 43.84 C ATOM 11602 O GLU I 963 192.837 209.732 150.391 1.00 43.84 O ATOM 11603 CB GLU I 963 191.335 207.924 152.691 1.00 43.84 C ATOM 11604 CG GLU I 963 190.785 208.777 153.783 1.00 43.84 C ATOM 11605 CD GLU I 963 190.100 209.999 153.268 1.00 43.84 C ATOM 11606 OE1 GLU I 963 189.791 210.037 152.060 1.00 43.84 O ATOM 11607 OE2 GLU I 963 189.853 210.908 154.078 1.00 43.84 O ATOM 11608 N LEU I 964 192.972 210.696 152.424 1.00 44.82 N ATOM 11609 CA LEU I 964 193.308 212.006 151.877 1.00 44.82 C ATOM 11610 C LEU I 964 194.563 211.940 151.036 1.00 44.82 C ATOM 11611 O LEU I 964 194.624 212.535 149.962 1.00 44.82 O ATOM 11612 CB LEU I 964 193.522 213.048 152.977 1.00 44.82 C ATOM 11613 CG LEU I 964 192.448 214.033 153.441 1.00 44.82 C ATOM 11614 CD1 LEU I 964 191.893 214.785 152.243 1.00 44.82 C ATOM 11615 CD2 LEU I 964 191.364 213.406 154.267 1.00 44.82 C ATOM 11616 N GLN I 965 195.579 211.226 151.507 1.00 39.98 N ATOM 11617 CA GLN I 965 196.853 211.282 150.806 1.00 39.98 C ATOM 11618 C GLN I 965 196.800 210.506 149.501 1.00 39.98 C ATOM 11619 O GLN I 965 197.334 210.958 148.486 1.00 39.98 O ATOM 11620 CB GLN I 965 197.973 210.774 151.706 1.00 39.98 C ATOM 11621 CG GLN I 965 198.204 211.662 152.913 1.00 39.98 C ATOM 11622 CD GLN I 965 197.684 213.068 152.698 1.00 39.98 C ATOM 11623 OE1 GLN I 965 198.247 213.839 151.923 1.00 39.98 O ATOM 11624 NE2 GLN I 965 196.587 213.400 153.370 1.00 39.98 N ATOM 11625 N ILE I 966 196.154 209.346 149.495 1.00 37.76 N ATOM 11626 CA ILE I 966 196.008 208.613 148.244 1.00 37.76 C ATOM 11627 C ILE I 966 195.161 209.411 147.258 1.00 37.76 C ATOM 11628 O ILE I 966 195.542 209.598 146.093 1.00 37.76 O ATOM 11629 CB ILE I 966 195.412 207.221 148.506 1.00 37.76 C ATOM 11630 CG1 ILE I 966 194.256 207.339 149.488 1.00 37.76 C ATOM 11631 CG2 ILE I 966 196.467 206.299 149.058 1.00 37.76 C ATOM 11632 CD1 ILE I 966 193.403 206.124 149.588 1.00 37.76 C ATOM 11633 N LEU I 967 194.002 209.903 147.711 1.00 44.74 N ATOM 11634 CA LEU I 967 193.135 210.655 146.815 1.00 44.74 C ATOM 11635 C LEU I 967 193.810 211.929 146.343 1.00 44.74 C ATOM 11636 O LEU I 967 193.598 212.355 145.206 1.00 44.74 O ATOM 11637 CB LEU I 967 191.807 210.980 147.501 1.00 44.74 C ATOM 11638 CG LEU I 967 191.831 211.954 148.681 1.00 44.74 C ATOM 11639 CD1 LEU I 967 191.677 213.399 148.239 1.00 44.74 C ATOM 11640 CD2 LEU I 967 190.743 211.608 149.666 1.00 44.74 C ATOM 11641 N GLU I 968 194.651 212.534 147.179 1.00 45.58 N ATOM 11642 CA GLU I 968 195.311 213.763 146.773 1.00 45.58 C ATOM 11643 C GLU I 968 196.428 213.475 145.793 1.00 45.58 C ATOM 11644 O GLU I 968 196.656 214.260 144.875 1.00 45.58 O ATOM 11645 CB GLU I 968 195.840 214.526 147.990 1.00 45.58 C ATOM 11646 CG GLU I 968 196.996 213.886 148.751 1.00 45.58 C ATOM 11647 CD GLU I 968 198.368 214.300 148.232 1.00 45.58 C ATOM 11648 OE1 GLU I 968 198.442 215.223 147.395 1.00 45.58 O ATOM 11649 OE2 GLU I 968 199.374 213.711 148.682 1.00 45.58 O ATOM 11650 N ALA I 969 197.148 212.372 145.977 1.00 44.91 N ATOM 11651 CA ALA I 969 198.133 211.982 144.980 1.00 44.91 C ATOM 11652 C ALA I 969 197.467 211.805 143.626 1.00 44.91 C ATOM 11653 O ALA I 969 197.921 212.358 142.617 1.00 44.91 O ATOM 11654 CB ALA I 969 198.832 210.701 145.414 1.00 44.91 C ATOM 11655 N GLY I 970 196.344 211.091 143.604 1.00 51.29 N ATOM 11656 CA GLY I 970 195.620 210.924 142.355 1.00 51.29 C ATOM 11657 C GLY I 970 195.131 212.241 141.778 1.00 51.29 C ATOM 11658 O GLY I 970 195.295 212.513 140.588 1.00 51.29 O ATOM 11659 N LEU I 971 194.548 213.089 142.623 1.00 51.45 N ATOM 11660 CA LEU I 971 193.907 214.300 142.128 1.00 51.45 C ATOM 11661 C LEU I 971 194.938 215.332 141.695 1.00 51.45 C ATOM 11662 O LEU I 971 194.774 215.995 140.668 1.00 51.45 O ATOM 11663 CB LEU I 971 192.978 214.870 143.196 1.00 51.45 C ATOM 11664 CG LEU I 971 192.031 215.944 142.675 1.00 51.45 C ATOM 11665 CD1 LEU I 971 190.668 215.817 143.307 1.00 51.45 C ATOM 11666 CD2 LEU I 971 192.606 217.314 142.946 1.00 51.45 C ATOM 11667 N PHE I 972 196.013 215.485 142.460 1.00 54.67 N ATOM 11668 CA PHE I 972 197.068 216.392 142.052 1.00 54.67 C ATOM 11669 C PHE I 972 197.833 215.871 140.844 1.00 54.67 C ATOM 11670 O PHE I 972 198.331 216.678 140.058 1.00 54.67 O ATOM 11671 CB PHE I 972 198.009 216.658 143.225 1.00 54.67 C ATOM 11672 CG PHE I 972 197.411 217.542 144.289 1.00 54.67 C ATOM 11673 CD1 PHE I 972 196.288 218.302 144.024 1.00 54.67 C ATOM 11674 CD2 PHE I 972 197.965 217.603 145.554 1.00 54.67 C ATOM 11675 CE1 PHE I 972 195.736 219.112 144.994 1.00 54.67 C ATOM 11676 CE2 PHE I 972 197.412 218.411 146.530 1.00 54.67 C ATOM 11677 CZ PHE I 972 196.297 219.165 146.247 1.00 54.67 C ATOM 11678 N SER I 973 197.916 214.554 140.641 1.00 52.23 N ATOM 11679 CA SER I 973 198.500 214.071 139.395 1.00 52.23 C ATOM 11680 C SER I 973 197.567 214.334 138.222 1.00 52.23 C ATOM 11681 O SER I 973 198.017 214.675 137.123 1.00 52.23 O ATOM 11682 CB SER I 973 198.843 212.590 139.508 1.00 52.23 C ATOM 11683 OG SER I 973 199.862 212.399 140.471 1.00 52.23 O ATOM 11684 N ARG I 974 196.258 214.193 138.440 1.00 51.65 N ATOM 11685 CA ARG I 974 195.291 214.642 137.444 1.00 51.65 C ATOM 11686 C ARG I 974 195.491 216.114 137.118 1.00 51.65 C ATOM 11687 O ARG I 974 195.386 216.521 135.960 1.00 51.65 O ATOM 11688 CB ARG I 974 193.859 214.421 137.932 1.00 51.65 C ATOM 11689 CG ARG I 974 193.408 212.987 138.021 1.00 51.65 C ATOM 11690 CD ARG I 974 193.567 212.269 136.701 1.00 51.65 C ATOM 11691 NE ARG I 974 194.736 211.398 136.727 1.00 51.65 N ATOM 11692 CZ ARG I 974 195.286 210.852 135.651 1.00 51.65 C ATOM 11693 NH1 ARG I 974 194.784 211.102 134.453 1.00 51.65 N ATOM 11694 NH2 ARG I 974 196.343 210.063 135.772 1.00 51.65 N ATOM 11695 N ILE I 975 195.767 216.930 138.134 1.00 58.55 N ATOM 11696 CA ILE I 975 195.962 218.358 137.906 1.00 58.55 C ATOM 11697 C ILE I 975 197.234 218.599 137.105 1.00 58.55 C ATOM 11698 O ILE I 975 197.254 219.414 136.175 1.00 58.55 O ATOM 11699 CB ILE I 975 195.987 219.120 139.242 1.00 58.55 C ATOM 11700 CG1 ILE I 975 194.643 218.976 139.955 1.00 58.55 C ATOM 11701 CG2 ILE I 975 196.328 220.587 139.008 1.00 58.55 C ATOM 11702 CD1 ILE I 975 194.650 219.495 141.361 1.00 58.55 C ATOM 11703 N ARG I 976 198.317 217.903 137.460 1.00 65.45 N ATOM 11704 CA ARG I 976 199.551 218.022 136.691 1.00 65.45 C ATOM 11705 C ARG I 976 199.359 217.570 135.254 1.00 65.45 C ATOM 11706 O ARG I 976 200.029 218.080 134.354 1.00 65.45 O ATOM 11707 CB ARG I 976 200.680 217.220 137.336 1.00 65.45 C ATOM 11708 CG ARG I 976 202.060 217.705 136.917 1.00 65.45 C ATOM 11709 CD ARG I 976 202.140 219.223 137.078 1.00 65.45 C ATOM 11710 NE ARG I 976 203.207 219.855 136.297 1.00 65.45 N ATOM 11711 CZ ARG I 976 204.408 220.155 136.778 1.00 65.45 C ATOM 11712 NH1 ARG I 976 204.701 219.875 138.037 1.00 65.45 N ATOM 11713 NH2 ARG I 976 205.316 220.736 136.006 1.00 65.45 N ATOM 11714 N ALA I 977 198.449 216.627 135.017 1.00 60.99 N ATOM 11715 CA ALA I 977 198.183 216.190 133.651 1.00 60.99 C ATOM 11716 C ALA I 977 197.300 217.185 132.907 1.00 60.99 C ATOM 11717 O ALA I 977 197.499 217.421 131.712 1.00 60.99 O ATOM 11718 CB ALA I 977 197.545 214.803 133.657 1.00 60.99 C ATOM 11719 N VAL I 978 196.320 217.775 133.594 1.00 64.23 N ATOM 11720 CA VAL I 978 195.492 218.810 132.980 1.00 64.23 C ATOM 11721 C VAL I 978 196.352 220.004 132.603 1.00 64.23 C ATOM 11722 O VAL I 978 196.127 220.659 131.578 1.00 64.23 O ATOM 11723 CB VAL I 978 194.340 219.212 133.921 1.00 64.23 C ATOM 11724 CG1 VAL I 978 193.461 220.259 133.260 1.00 64.23 C ATOM 11725 CG2 VAL I 978 193.511 217.997 134.293 1.00 64.23 C ATOM 11726 N LEU I 979 197.364 220.289 133.411 1.00 67.59 N ATOM 11727 CA LEU I 979 198.345 221.312 133.092 1.00 67.59 C ATOM 11728 C LEU I 979 199.395 220.821 132.112 1.00 67.59 C ATOM 11729 O LEU I 979 200.438 221.466 131.975 1.00 67.59 O ATOM 11730 CB LEU I 979 199.023 221.815 134.367 1.00 67.59 C ATOM 11731 CG LEU I 979 198.278 222.881 135.170 1.00 67.59 C ATOM 11732 CD1 LEU I 979 198.071 224.114 134.312 1.00 67.59 C ATOM 11733 CD2 LEU I 979 196.953 222.372 135.725 1.00 67.59 C