>>6R1U:HELIX   29 AD2 SER H   52  ASN H   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 29 AD2 SER H 52 ASN H 81 1 30 ATOM 5649 N SER H 52 162.534 138.824 182.191 1.00 74.71 N ATOM 5650 CA SER H 52 161.785 137.798 181.488 1.00 74.71 C ATOM 5651 C SER H 52 162.262 137.684 180.042 1.00 74.71 C ATOM 5652 O SER H 52 163.026 138.510 179.548 1.00 74.71 O ATOM 5653 CB SER H 52 160.300 138.107 181.544 1.00 74.71 C ATOM 5654 OG SER H 52 160.052 139.324 180.876 1.00 74.71 O ATOM 5655 N SER H 53 161.789 136.639 179.359 1.00 74.76 N ATOM 5656 CA SER H 53 162.357 136.272 178.064 1.00 74.76 C ATOM 5657 C SER H 53 161.894 137.192 176.943 1.00 74.76 C ATOM 5658 O SER H 53 162.705 137.604 176.101 1.00 74.76 O ATOM 5659 CB SER H 53 161.999 134.828 177.723 1.00 74.76 C ATOM 5660 OG SER H 53 162.497 134.477 176.448 1.00 74.76 O ATOM 5661 N LYS H 54 160.599 137.510 176.903 1.00 67.40 N ATOM 5662 CA LYS H 54 160.122 138.411 175.863 1.00 67.40 C ATOM 5663 C LYS H 54 160.644 139.820 176.068 1.00 67.40 C ATOM 5664 O LYS H 54 160.841 140.542 175.090 1.00 67.40 O ATOM 5665 CB LYS H 54 158.601 138.415 175.797 1.00 67.40 C ATOM 5666 CG LYS H 54 158.030 137.148 175.213 1.00 67.40 C ATOM 5667 CD LYS H 54 156.523 137.218 175.112 1.00 67.40 C ATOM 5668 CE LYS H 54 156.101 138.148 173.993 1.00 67.40 C ATOM 5669 NZ LYS H 54 156.440 137.613 172.648 1.00 67.40 N ATOM 5670 N ALA H 55 160.916 140.207 177.311 1.00 71.18 N ATOM 5671 CA ALA H 55 161.574 141.485 177.547 1.00 71.18 C ATOM 5672 C ALA H 55 162.997 141.470 177.030 1.00 71.18 C ATOM 5673 O ALA H 55 163.494 142.493 176.543 1.00 71.18 O ATOM 5674 CB ALA H 55 161.557 141.815 179.032 1.00 71.18 C ATOM 5675 N MET H 56 163.658 140.321 177.121 1.00 75.88 N ATOM 5676 CA MET H 56 164.988 140.179 176.552 1.00 75.88 C ATOM 5677 C MET H 56 164.948 140.306 175.037 1.00 75.88 C ATOM 5678 O MET H 56 165.832 140.934 174.437 1.00 75.88 O ATOM 5679 CB MET H 56 165.582 138.843 176.976 1.00 75.88 C ATOM 5680 CG MET H 56 166.973 138.653 176.497 1.00 75.88 C ATOM 5681 SD MET H 56 168.000 139.986 177.113 1.00 75.88 S ATOM 5682 CE MET H 56 168.049 139.566 178.847 1.00 75.88 C ATOM 5683 N SER H 57 163.908 139.765 174.401 1.00 65.23 N ATOM 5684 CA SER H 57 163.800 139.964 172.962 1.00 65.23 C ATOM 5685 C SER H 57 163.397 141.398 172.612 1.00 65.23 C ATOM 5686 O SER H 57 163.747 141.881 171.521 1.00 65.23 O ATOM 5687 CB SER H 57 162.822 138.968 172.357 1.00 65.23 C ATOM 5688 OG SER H 57 162.741 139.162 170.963 1.00 65.23 O ATOM 5689 N ILE H 58 162.693 142.092 173.516 1.00 62.23 N ATOM 5690 CA ILE H 58 162.431 143.519 173.323 1.00 62.23 C ATOM 5691 C ILE H 58 163.734 144.292 173.296 1.00 62.23 C ATOM 5692 O ILE H 58 163.983 145.073 172.372 1.00 62.23 O ATOM 5693 CB ILE H 58 161.490 144.066 174.412 1.00 62.23 C ATOM 5694 CG1 ILE H 58 160.060 143.562 174.244 1.00 62.23 C ATOM 5695 CG2 ILE H 58 161.491 145.582 174.409 1.00 62.23 C ATOM 5696 CD1 ILE H 58 159.328 144.147 173.070 1.00 62.23 C ATOM 5697 N MET H 59 164.595 144.065 174.293 1.00 66.25 N ATOM 5698 CA MET H 59 165.864 144.783 174.336 1.00 66.25 C ATOM 5699 C MET H 59 166.761 144.417 173.173 1.00 66.25 C ATOM 5700 O MET H 59 167.514 145.270 172.691 1.00 66.25 O ATOM 5701 CB MET H 59 166.610 144.528 175.639 1.00 66.25 C ATOM 5702 CG MET H 59 166.027 145.210 176.839 1.00 66.25 C ATOM 5703 SD MET H 59 165.813 146.970 176.543 1.00 66.25 S ATOM 5704 CE MET H 59 167.488 147.507 176.216 1.00 66.25 C ATOM 5705 N ASN H 60 166.683 143.167 172.707 1.00 64.38 N ATOM 5706 CA ASN H 60 167.447 142.756 171.535 1.00 64.38 C ATOM 5707 C ASN H 60 167.036 143.557 170.306 1.00 64.38 C ATOM 5708 O ASN H 60 167.885 144.143 169.617 1.00 64.38 O ATOM 5709 CB ASN H 60 167.244 141.268 171.295 1.00 64.38 C ATOM 5710 CG ASN H 60 168.251 140.694 170.339 1.00 64.38 C ATOM 5711 OD1 ASN H 60 169.151 141.388 169.882 1.00 64.38 O ATOM 5712 ND2 ASN H 60 168.101 139.413 170.022 1.00 64.38 N ATOM 5713 N SER H 61 165.729 143.628 170.042 1.00 59.76 N ATOM 5714 CA SER H 61 165.273 144.416 168.902 1.00 59.76 C ATOM 5715 C SER H 61 165.474 145.909 169.102 1.00 59.76 C ATOM 5716 O SER H 61 165.584 146.641 168.113 1.00 59.76 O ATOM 5717 CB SER H 61 163.806 144.129 168.618 1.00 59.76 C ATOM 5718 OG SER H 61 163.631 142.795 168.179 1.00 59.76 O ATOM 5719 N PHE H 62 165.553 146.367 170.347 1.00 58.77 N ATOM 5720 CA PHE H 62 165.866 147.768 170.610 1.00 58.77 C ATOM 5721 C PHE H 62 167.289 148.093 170.205 1.00 58.77 C ATOM 5722 O PHE H 62 167.549 149.122 169.563 1.00 58.77 O ATOM 5723 CB PHE H 62 165.663 148.082 172.086 1.00 58.77 C ATOM 5724 CG PHE H 62 166.133 149.438 172.467 1.00 58.77 C ATOM 5725 CD1 PHE H 62 165.419 150.551 172.104 1.00 58.77 C ATOM 5726 CD2 PHE H 62 167.303 149.605 173.188 1.00 58.77 C ATOM 5727 CE1 PHE H 62 165.859 151.811 172.449 1.00 58.77 C ATOM 5728 CE2 PHE H 62 167.748 150.862 173.534 1.00 58.77 C ATOM 5729 CZ PHE H 62 167.025 151.968 173.161 1.00 58.77 C ATOM 5730 N VAL H 63 168.228 147.240 170.610 1.00 59.55 N ATOM 5731 CA VAL H 63 169.631 147.432 170.281 1.00 59.55 C ATOM 5732 C VAL H 63 169.851 147.354 168.775 1.00 59.55 C ATOM 5733 O VAL H 63 170.619 148.148 168.209 1.00 59.55 O ATOM 5734 CB VAL H 63 170.477 146.410 171.057 1.00 59.55 C ATOM 5735 CG1 VAL H 63 171.892 146.387 170.574 1.00 59.55 C ATOM 5736 CG2 VAL H 63 170.458 146.761 172.523 1.00 59.55 C ATOM 5737 N ASN H 64 169.142 146.444 168.089 1.00 59.32 N ATOM 5738 CA ASN H 64 169.232 146.438 166.628 1.00 59.32 C ATOM 5739 C ASN H 64 168.659 147.710 166.017 1.00 59.32 C ATOM 5740 O ASN H 64 169.282 148.282 165.120 1.00 59.32 O ATOM 5741 CB ASN H 64 168.551 145.216 166.021 1.00 59.32 C ATOM 5742 CG ASN H 64 169.441 143.995 166.027 1.00 59.32 C ATOM 5743 OD1 ASN H 64 170.649 144.103 165.830 1.00 59.32 O ATOM 5744 ND2 ASN H 64 168.851 142.826 166.212 1.00 59.32 N ATOM 5745 N ASP H 65 167.526 148.201 166.539 1.00 63.93 N ATOM 5746 CA ASP H 65 166.866 149.384 165.972 1.00 63.93 C ATOM 5747 C ASP H 65 167.733 150.630 166.092 1.00 63.93 C ATOM 5748 O ASP H 65 167.917 151.367 165.107 1.00 63.93 O ATOM 5749 CB ASP H 65 165.526 149.615 166.670 1.00 63.93 C ATOM 5750 CG ASP H 65 164.650 150.658 165.968 1.00 63.93 C ATOM 5751 OD1 ASP H 65 165.023 151.179 164.895 1.00 63.93 O ATOM 5752 OD2 ASP H 65 163.567 150.968 166.506 1.00 63.93 O ATOM 5753 N VAL H 66 168.255 150.894 167.295 1.00 60.61 N ATOM 5754 CA VAL H 66 169.161 152.026 167.470 1.00 60.61 C ATOM 5755 C VAL H 66 170.404 151.835 166.619 1.00 60.61 C ATOM 5756 O VAL H 66 170.856 152.774 165.954 1.00 60.61 O ATOM 5757 CB VAL H 66 169.508 152.219 168.955 1.00 60.61 C ATOM 5758 CG1 VAL H 66 170.581 153.282 169.142 1.00 60.61 C ATOM 5759 CG2 VAL H 66 168.272 152.615 169.700 1.00 60.61 C ATOM 5760 N PHE H 67 170.884 150.594 166.530 1.00 60.47 N ATOM 5761 CA PHE H 67 172.097 150.298 165.783 1.00 60.47 C ATOM 5762 C PHE H 67 171.966 150.625 164.298 1.00 60.47 C ATOM 5763 O PHE H 67 172.888 151.199 163.706 1.00 60.47 O ATOM 5764 CB PHE H 67 172.471 148.843 165.972 1.00 60.47 C ATOM 5765 CG PHE H 67 173.738 148.476 165.307 1.00 60.47 C ATOM 5766 CD1 PHE H 67 174.934 148.941 165.797 1.00 60.47 C ATOM 5767 CD2 PHE H 67 173.735 147.656 164.198 1.00 60.47 C ATOM 5768 CE1 PHE H 67 176.101 148.602 165.195 1.00 60.47 C ATOM 5769 CE2 PHE H 67 174.904 147.313 163.589 1.00 60.47 C ATOM 5770 CZ PHE H 67 176.088 147.790 164.088 1.00 60.47 C ATOM 5771 N GLU H 68 170.819 150.324 163.679 1.00 63.15 N ATOM 5772 CA GLU H 68 170.689 150.765 162.294 1.00 63.15 C ATOM 5773 C GLU H 68 170.322 152.240 162.185 1.00 63.15 C ATOM 5774 O GLU H 68 170.525 152.824 161.112 1.00 63.15 O ATOM 5775 CB GLU H 68 169.661 149.962 161.478 1.00 63.15 C ATOM 5776 CG GLU H 68 168.212 150.376 161.676 1.00 63.15 C ATOM 5777 CD GLU H 68 167.372 149.355 162.402 1.00 63.15 C ATOM 5778 OE1 GLU H 68 167.890 148.273 162.726 1.00 63.15 O ATOM 5779 OE2 GLU H 68 166.192 149.646 162.682 1.00 63.15 O ATOM 5780 N ARG H 69 169.790 152.861 163.248 1.00 61.77 N ATOM 5781 CA ARG H 69 169.555 154.302 163.187 1.00 61.77 C ATOM 5782 C ARG H 69 170.864 155.079 163.098 1.00 61.77 C ATOM 5783 O ARG H 69 171.093 155.810 162.130 1.00 61.77 O ATOM 5784 CB ARG H 69 168.741 154.784 164.380 1.00 61.77 C ATOM 5785 CG ARG H 69 167.254 154.587 164.263 1.00 61.77 C ATOM 5786 CD ARG H 69 166.572 155.190 165.482 1.00 61.77 C ATOM 5787 NE ARG H 69 165.120 155.058 165.449 1.00 61.77 N ATOM 5788 CZ ARG H 69 164.320 155.455 166.430 1.00 61.77 C ATOM 5789 NH1 ARG H 69 164.836 155.997 167.518 1.00 61.77 N ATOM 5790 NH2 ARG H 69 163.009 155.307 166.330 1.00 61.77 N ATOM 5791 N ILE H 70 171.746 154.931 164.096 1.00 63.06 N ATOM 5792 CA ILE H 70 173.024 155.645 164.018 1.00 63.06 C ATOM 5793 C ILE H 70 173.963 155.072 162.963 1.00 63.06 C ATOM 5794 O ILE H 70 174.886 155.769 162.527 1.00 63.06 O ATOM 5795 CB ILE H 70 173.747 155.725 165.380 1.00 63.06 C ATOM 5796 CG1 ILE H 70 173.481 154.506 166.234 1.00 63.06 C ATOM 5797 CG2 ILE H 70 173.342 156.932 166.145 1.00 63.06 C ATOM 5798 CD1 ILE H 70 174.212 153.296 165.852 1.00 63.06 C ATOM 5799 N ALA H 71 173.782 153.813 162.557 1.00 63.59 N ATOM 5800 CA ALA H 71 174.566 153.321 161.435 1.00 63.59 C ATOM 5801 C ALA H 71 174.160 154.019 160.143 1.00 63.59 C ATOM 5802 O ALA H 71 175.022 154.419 159.354 1.00 63.59 O ATOM 5803 CB ALA H 71 174.419 151.809 161.307 1.00 63.59 C ATOM 5804 N GLY H 72 172.855 154.199 159.925 1.00 64.26 N ATOM 5805 CA GLY H 72 172.413 154.904 158.733 1.00 64.26 C ATOM 5806 C GLY H 72 172.750 156.382 158.766 1.00 64.26 C ATOM 5807 O GLY H 72 173.124 156.971 157.742 1.00 64.26 O ATOM 5808 N GLU H 73 172.622 157.002 159.941 1.00 66.53 N ATOM 5809 CA GLU H 73 173.040 158.388 160.097 1.00 66.53 C ATOM 5810 C GLU H 73 174.531 158.555 159.864 1.00 66.53 C ATOM 5811 O GLU H 73 174.964 159.570 159.308 1.00 66.53 O ATOM 5812 CB GLU H 73 172.676 158.893 161.485 1.00 66.53 C ATOM 5813 CG GLU H 73 171.216 159.118 161.698 1.00 66.53 C ATOM 5814 CD GLU H 73 170.707 160.293 160.914 1.00 66.53 C ATOM 5815 OE1 GLU H 73 171.498 161.221 160.647 1.00 66.53 O ATOM 5816 OE2 GLU H 73 169.506 160.300 160.578 1.00 66.53 O ATOM 5817 N ALA H 74 175.326 157.566 160.265 1.00 69.31 N ATOM 5818 CA ALA H 74 176.733 157.587 159.907 1.00 69.31 C ATOM 5819 C ALA H 74 176.923 157.404 158.414 1.00 69.31 C ATOM 5820 O ALA H 74 177.886 157.930 157.849 1.00 69.31 O ATOM 5821 CB ALA H 74 177.481 156.507 160.671 1.00 69.31 C ATOM 5822 N SER H 75 176.006 156.681 157.759 1.00 70.54 N ATOM 5823 CA SER H 75 176.151 156.433 156.328 1.00 70.54 C ATOM 5824 C SER H 75 175.941 157.702 155.526 1.00 70.54 C ATOM 5825 O SER H 75 176.803 158.093 154.729 1.00 70.54 O ATOM 5826 CB SER H 75 175.178 155.355 155.861 1.00 70.54 C ATOM 5827 OG SER H 75 175.223 155.229 154.452 1.00 70.54 O ATOM 5828 N ARG H 76 174.806 158.365 155.719 1.00 72.19 N ATOM 5829 CA ARG H 76 174.574 159.537 154.888 1.00 72.19 C ATOM 5830 C ARG H 76 175.312 160.752 155.424 1.00 72.19 C ATOM 5831 O ARG H 76 175.708 161.625 154.640 1.00 72.19 O ATOM 5832 CB ARG H 76 173.075 159.792 154.735 1.00 72.19 C ATOM 5833 CG ARG H 76 172.340 160.210 155.953 1.00 72.19 C ATOM 5834 CD ARG H 76 170.874 160.200 155.628 1.00 72.19 C ATOM 5835 NE ARG H 76 170.428 158.832 155.398 1.00 72.19 N ATOM 5836 CZ ARG H 76 169.953 158.043 156.355 1.00 72.19 C ATOM 5837 NH1 ARG H 76 169.849 158.501 157.590 1.00 72.19 N ATOM 5838 NH2 ARG H 76 169.578 156.805 156.086 1.00 72.19 N ATOM 5839 N LEU H 77 175.567 160.788 156.738 1.00 70.09 N ATOM 5840 CA LEU H 77 176.378 161.855 157.306 1.00 70.09 C ATOM 5841 C LEU H 77 177.823 161.748 156.858 1.00 70.09 C ATOM 5842 O LEU H 77 178.521 162.762 156.786 1.00 70.09 O ATOM 5843 CB LEU H 77 176.272 161.829 158.826 1.00 70.09 C ATOM 5844 CG LEU H 77 176.811 162.968 159.701 1.00 70.09 C ATOM 5845 CD1 LEU H 77 178.260 162.802 160.096 1.00 70.09 C ATOM 5846 CD2 LEU H 77 176.628 164.304 159.011 1.00 70.09 C ATOM 5847 N ALA H 78 178.298 160.543 156.579 1.00 71.54 N ATOM 5848 CA ALA H 78 179.600 160.424 155.951 1.00 71.54 C ATOM 5849 C ALA H 78 179.517 160.588 154.447 1.00 71.54 C ATOM 5850 O ALA H 78 180.536 160.843 153.800 1.00 71.54 O ATOM 5851 CB ALA H 78 180.233 159.080 156.290 1.00 71.54 C ATOM 5852 N HIS H 79 178.329 160.441 153.876 1.00 72.62 N ATOM 5853 CA HIS H 79 178.220 160.590 152.439 1.00 72.62 C ATOM 5854 C HIS H 79 178.196 162.052 152.035 1.00 72.62 C ATOM 5855 O HIS H 79 178.576 162.386 150.910 1.00 72.62 O ATOM 5856 CB HIS H 79 176.969 159.885 151.924 1.00 72.62 C ATOM 5857 CG HIS H 79 176.911 159.800 150.435 1.00 72.62 C ATOM 5858 ND1 HIS H 79 177.710 158.943 149.711 1.00 72.62 N ATOM 5859 CD2 HIS H 79 176.176 160.483 149.529 1.00 72.62 C ATOM 5860 CE1 HIS H 79 177.462 159.094 148.425 1.00 72.62 C ATOM 5861 NE2 HIS H 79 176.531 160.021 148.288 1.00 72.62 N ATOM 5862 N TYR H 80 177.767 162.932 152.935 1.00 77.16 N ATOM 5863 CA TYR H 80 177.615 164.336 152.575 1.00 77.16 C ATOM 5864 C TYR H 80 178.961 165.015 152.381 1.00 77.16 C ATOM 5865 O TYR H 80 179.115 165.855 151.491 1.00 77.16 O ATOM 5866 CB TYR H 80 176.813 165.070 153.644 1.00 77.16 C ATOM 5867 CG TYR H 80 175.367 164.644 153.750 1.00 77.16 C ATOM 5868 CD1 TYR H 80 174.732 163.972 152.707 1.00 77.16 C ATOM 5869 CD2 TYR H 80 174.641 164.887 154.912 1.00 77.16 C ATOM 5870 CE1 TYR H 80 173.421 163.578 152.816 1.00 77.16 C ATOM 5871 CE2 TYR H 80 173.324 164.496 155.024 1.00 77.16 C ATOM 5872 CZ TYR H 80 172.722 163.852 153.971 1.00 77.16 C ATOM 5873 OH TYR H 80 171.414 163.457 154.071 1.00 77.16 O ATOM 5874 N ASN H 81 179.951 164.656 153.189 1.00 77.97 N ATOM 5875 CA ASN H 81 181.228 165.349 153.200 1.00 77.97 C ATOM 5876 C ASN H 81 182.229 164.780 152.215 1.00 77.97 C ATOM 5877 O ASN H 81 183.425 165.054 152.363 1.00 77.97 O ATOM 5878 CB ASN H 81 181.839 165.308 154.594 1.00 77.97 C ATOM 5879 CG ASN H 81 181.046 166.080 155.579 1.00 77.97 C ATOM 5880 OD1 ASN H 81 180.561 167.166 155.287 1.00 77.97 O ATOM 5881 ND2 ASN H 81 180.898 165.526 156.759 1.00 77.97 N