>>6R7X:HELIX   15 AB6 LEU A  392  VAL A  422  1                                  31    
LESAYQNHLILKVLVFNFLNCFASLFYIAFV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 AB6 LEU A 392 VAL A 422 1 31 ATOM 3076 N LEU A 392 94.610 114.607 108.094 1.00 42.85 N ATOM 3077 CA LEU A 392 95.730 113.785 108.516 1.00 42.85 C ATOM 3078 C LEU A 392 96.949 114.072 107.645 1.00 42.85 C ATOM 3079 O LEU A 392 96.908 114.873 106.709 1.00 42.85 O ATOM 3080 CB LEU A 392 95.353 112.309 108.458 1.00 42.85 C ATOM 3081 CG LEU A 392 94.007 111.937 109.075 1.00 42.85 C ATOM 3082 CD1 LEU A 392 93.583 110.550 108.627 1.00 42.85 C ATOM 3083 CD2 LEU A 392 94.079 112.014 110.585 1.00 42.85 C ATOM 3084 N GLU A 393 98.057 113.409 107.961 1.00 37.17 N ATOM 3085 CA GLU A 393 99.243 113.473 107.122 1.00 37.17 C ATOM 3086 C GLU A 393 99.230 112.411 106.034 1.00 37.17 C ATOM 3087 O GLU A 393 99.810 112.628 104.964 1.00 37.17 O ATOM 3088 CB GLU A 393 100.502 113.332 107.987 1.00 37.17 C ATOM 3089 CG GLU A 393 101.827 113.602 107.279 1.00 37.17 C ATOM 3090 CD GLU A 393 102.057 115.070 106.976 1.00 37.17 C ATOM 3091 OE1 GLU A 393 101.455 115.926 107.655 1.00 37.17 O ATOM 3092 OE2 GLU A 393 102.846 115.371 106.057 1.00 37.17 O ATOM 3093 N SER A 394 98.547 111.288 106.272 1.00 35.05 N ATOM 3094 CA SER A 394 98.474 110.227 105.275 1.00 35.05 C ATOM 3095 C SER A 394 97.668 110.658 104.057 1.00 35.05 C ATOM 3096 O SER A 394 98.039 110.341 102.924 1.00 35.05 O ATOM 3097 CB SER A 394 97.870 108.970 105.895 1.00 35.05 C ATOM 3098 OG SER A 394 96.457 108.994 105.809 1.00 35.05 O ATOM 3099 N ALA A 395 96.579 111.402 104.266 1.00 32.69 N ATOM 3100 CA ALA A 395 95.772 111.868 103.140 1.00 32.69 C ATOM 3101 C ALA A 395 96.509 112.925 102.328 1.00 32.69 C ATOM 3102 O ALA A 395 96.439 112.927 101.091 1.00 32.69 O ATOM 3103 CB ALA A 395 94.438 112.413 103.641 1.00 32.69 C ATOM 3104 N TYR A 396 97.231 113.820 103.011 1.00 30.79 N ATOM 3105 CA TYR A 396 98.044 114.822 102.329 1.00 30.79 C ATOM 3106 C TYR A 396 99.155 114.171 101.520 1.00 30.79 C ATOM 3107 O TYR A 396 99.403 114.560 100.371 1.00 30.79 O ATOM 3108 CB TYR A 396 98.628 115.794 103.352 1.00 30.79 C ATOM 3109 CG TYR A 396 99.817 116.589 102.863 1.00 30.79 C ATOM 3110 CD1 TYR A 396 99.656 117.623 101.957 1.00 30.79 C ATOM 3111 CD2 TYR A 396 101.098 116.316 103.322 1.00 30.79 C ATOM 3112 CE1 TYR A 396 100.736 118.358 101.511 1.00 30.79 C ATOM 3113 CE2 TYR A 396 102.184 117.044 102.880 1.00 30.79 C ATOM 3114 CZ TYR A 396 101.994 118.063 101.975 1.00 30.79 C ATOM 3115 OH TYR A 396 103.068 118.794 101.535 1.00 30.79 O ATOM 3116 N GLN A 397 99.811 113.160 102.096 1.00 28.60 N ATOM 3117 CA GLN A 397 100.848 112.436 101.375 1.00 28.60 C ATOM 3118 C GLN A 397 100.282 111.669 100.191 1.00 28.60 C ATOM 3119 O GLN A 397 100.910 111.642 99.136 1.00 28.60 O ATOM 3120 CB GLN A 397 101.587 111.483 102.313 1.00 28.60 C ATOM 3121 CG GLN A 397 102.611 112.161 103.202 1.00 28.60 C ATOM 3122 CD GLN A 397 103.745 112.778 102.416 1.00 28.60 C ATOM 3123 OE1 GLN A 397 104.194 112.224 101.416 1.00 28.60 O ATOM 3124 NE2 GLN A 397 104.214 113.935 102.863 1.00 28.60 N ATOM 3125 N ASN A 398 99.085 111.092 100.322 1.00 27.51 N ATOM 3126 CA ASN A 398 98.488 110.358 99.209 1.00 27.51 C ATOM 3127 C ASN A 398 98.107 111.286 98.062 1.00 27.51 C ATOM 3128 O ASN A 398 98.337 110.954 96.892 1.00 27.51 O ATOM 3129 CB ASN A 398 97.266 109.579 99.688 1.00 27.51 C ATOM 3130 CG ASN A 398 97.636 108.377 100.520 1.00 27.51 C ATOM 3131 OD1 ASN A 398 98.800 108.180 100.861 1.00 27.51 O ATOM 3132 ND2 ASN A 398 96.645 107.566 100.857 1.00 27.51 N ATOM 3133 N HIS A 399 97.557 112.464 98.375 1.00 25.94 N ATOM 3134 CA HIS A 399 97.200 113.411 97.322 1.00 25.94 C ATOM 3135 C HIS A 399 98.438 113.971 96.631 1.00 25.94 C ATOM 3136 O HIS A 399 98.461 114.105 95.396 1.00 25.94 O ATOM 3137 CB HIS A 399 96.354 114.542 97.897 1.00 25.94 C ATOM 3138 CG HIS A 399 94.945 114.146 98.195 1.00 25.94 C ATOM 3139 ND1 HIS A 399 94.625 113.171 99.114 1.00 25.94 N ATOM 3140 CD2 HIS A 399 93.769 114.591 97.695 1.00 25.94 C ATOM 3141 CE1 HIS A 399 93.314 113.033 99.168 1.00 25.94 C ATOM 3142 NE2 HIS A 399 92.770 113.883 98.316 1.00 25.94 N ATOM 3143 N LEU A 400 99.485 114.279 97.407 1.00 23.30 N ATOM 3144 CA LEU A 400 100.726 114.770 96.819 1.00 23.30 C ATOM 3145 C LEU A 400 101.401 113.705 95.964 1.00 23.30 C ATOM 3146 O LEU A 400 101.923 114.015 94.886 1.00 23.30 O ATOM 3147 CB LEU A 400 101.668 115.248 97.917 1.00 23.30 C ATOM 3148 CG LEU A 400 102.953 115.918 97.446 1.00 23.30 C ATOM 3149 CD1 LEU A 400 102.627 117.183 96.683 1.00 23.30 C ATOM 3150 CD2 LEU A 400 103.849 116.218 98.628 1.00 23.30 C ATOM 3151 N ILE A 401 101.375 112.445 96.415 1.00 20.76 N ATOM 3152 CA ILE A 401 101.946 111.346 95.641 1.00 20.76 C ATOM 3153 C ILE A 401 101.179 111.144 94.344 1.00 20.76 C ATOM 3154 O ILE A 401 101.790 110.944 93.292 1.00 20.76 O ATOM 3155 CB ILE A 401 102.010 110.065 96.501 1.00 20.76 C ATOM 3156 CG1 ILE A 401 103.178 110.164 97.481 1.00 20.76 C ATOM 3157 CG2 ILE A 401 102.151 108.805 95.664 1.00 20.76 C ATOM 3158 CD1 ILE A 401 103.162 109.156 98.582 1.00 20.76 C ATOM 3159 N LEU A 402 99.849 111.288 94.371 1.00 20.46 N ATOM 3160 CA LEU A 402 99.067 111.133 93.144 1.00 20.46 C ATOM 3161 C LEU A 402 99.376 112.233 92.131 1.00 20.46 C ATOM 3162 O LEU A 402 99.612 111.943 90.948 1.00 20.46 O ATOM 3163 CB LEU A 402 97.576 111.112 93.459 1.00 20.46 C ATOM 3164 CG LEU A 402 96.705 110.930 92.218 1.00 20.46 C ATOM 3165 CD1 LEU A 402 97.027 109.618 91.528 1.00 20.46 C ATOM 3166 CD2 LEU A 402 95.251 110.983 92.593 1.00 20.46 C ATOM 3167 N LYS A 403 99.420 113.493 92.586 1.00 20.23 N ATOM 3168 CA LYS A 403 99.706 114.610 91.682 1.00 20.23 C ATOM 3169 C LYS A 403 101.109 114.510 91.086 1.00 20.23 C ATOM 3170 O LYS A 403 101.290 114.616 89.861 1.00 20.23 O ATOM 3171 CB LYS A 403 99.545 115.938 92.418 1.00 20.23 C ATOM 3172 CG LYS A 403 98.124 116.303 92.788 1.00 20.23 C ATOM 3173 CD LYS A 403 98.098 117.603 93.572 1.00 20.23 C ATOM 3174 CE LYS A 403 96.685 118.013 93.934 1.00 20.23 C ATOM 3175 NZ LYS A 403 96.018 117.008 94.799 1.00 20.23 N ATOM 3176 N VAL A 404 102.110 114.268 91.940 1.00 18.07 N ATOM 3177 CA VAL A 404 103.493 114.227 91.481 1.00 18.07 C ATOM 3178 C VAL A 404 103.746 112.994 90.617 1.00 18.07 C ATOM 3179 O VAL A 404 104.465 113.078 89.616 1.00 18.07 O ATOM 3180 CB VAL A 404 104.435 114.311 92.698 1.00 18.07 C ATOM 3181 CG1 VAL A 404 105.873 114.098 92.307 1.00 18.07 C ATOM 3182 CG2 VAL A 404 104.303 115.667 93.355 1.00 18.07 C ATOM 3183 N LEU A 405 103.097 111.864 90.920 1.00 17.34 N ATOM 3184 CA LEU A 405 103.280 110.660 90.119 1.00 17.34 C ATOM 3185 C LEU A 405 102.666 110.808 88.737 1.00 17.34 C ATOM 3186 O LEU A 405 103.288 110.412 87.744 1.00 17.34 O ATOM 3187 CB LEU A 405 102.674 109.454 90.830 1.00 17.34 C ATOM 3188 CG LEU A 405 103.574 108.667 91.776 1.00 17.34 C ATOM 3189 CD1 LEU A 405 102.919 107.355 92.146 1.00 17.34 C ATOM 3190 CD2 LEU A 405 104.915 108.440 91.151 1.00 17.34 C ATOM 3191 N VAL A 406 101.470 111.403 88.648 1.00 19.75 N ATOM 3192 CA VAL A 406 100.821 111.588 87.351 1.00 19.75 C ATOM 3193 C VAL A 406 101.626 112.545 86.477 1.00 19.75 C ATOM 3194 O VAL A 406 101.931 112.234 85.313 1.00 19.75 O ATOM 3195 CB VAL A 406 99.372 112.068 87.544 1.00 19.75 C ATOM 3196 CG1 VAL A 406 98.835 112.711 86.282 1.00 19.75 C ATOM 3197 CG2 VAL A 406 98.495 110.904 87.948 1.00 19.75 C ATOM 3198 N PHE A 407 102.042 113.689 87.039 1.00 20.37 N ATOM 3199 CA PHE A 407 102.798 114.633 86.218 1.00 20.37 C ATOM 3200 C PHE A 407 104.193 114.125 85.883 1.00 20.37 C ATOM 3201 O PHE A 407 104.678 114.385 84.782 1.00 20.37 O ATOM 3202 CB PHE A 407 102.911 115.992 86.891 1.00 20.37 C ATOM 3203 CG PHE A 407 103.667 117.009 86.075 1.00 20.37 C ATOM 3204 CD1 PHE A 407 103.072 117.617 84.986 1.00 20.37 C ATOM 3205 CD2 PHE A 407 104.971 117.352 86.393 1.00 20.37 C ATOM 3206 CE1 PHE A 407 103.758 118.547 84.231 1.00 20.37 C ATOM 3207 CE2 PHE A 407 105.662 118.276 85.637 1.00 20.37 C ATOM 3208 CZ PHE A 407 105.053 118.876 84.560 1.00 20.37 C ATOM 3209 N ASN A 408 104.850 113.394 86.786 1.00 19.59 N ATOM 3210 CA ASN A 408 106.200 112.942 86.482 1.00 19.59 C ATOM 3211 C ASN A 408 106.190 111.795 85.487 1.00 19.59 C ATOM 3212 O ASN A 408 107.068 111.729 84.620 1.00 19.59 O ATOM 3213 CB ASN A 408 106.932 112.549 87.757 1.00 19.59 C ATOM 3214 CG ASN A 408 107.495 113.743 88.476 1.00 19.59 C ATOM 3215 OD1 ASN A 408 107.524 114.844 87.935 1.00 19.59 O ATOM 3216 ND2 ASN A 408 107.967 113.535 89.688 1.00 19.59 N ATOM 3217 N PHE A 409 105.184 110.912 85.565 1.00 20.59 N ATOM 3218 CA PHE A 409 105.007 109.886 84.543 1.00 20.59 C ATOM 3219 C PHE A 409 104.775 110.509 83.175 1.00 20.59 C ATOM 3220 O PHE A 409 105.447 110.138 82.202 1.00 20.59 O ATOM 3221 CB PHE A 409 103.846 108.964 84.919 1.00 20.59 C ATOM 3222 CG PHE A 409 103.644 107.813 83.969 1.00 20.59 C ATOM 3223 CD1 PHE A 409 104.349 106.638 84.131 1.00 20.59 C ATOM 3224 CD2 PHE A 409 102.727 107.897 82.932 1.00 20.59 C ATOM 3225 CE1 PHE A 409 104.163 105.581 83.263 1.00 20.59 C ATOM 3226 CE2 PHE A 409 102.542 106.845 82.062 1.00 20.59 C ATOM 3227 CZ PHE A 409 103.257 105.686 82.231 1.00 20.59 C ATOM 3228 N LEU A 410 103.860 111.485 83.087 1.00 21.90 N ATOM 3229 CA LEU A 410 103.575 112.097 81.791 1.00 21.90 C ATOM 3230 C LEU A 410 104.772 112.879 81.264 1.00 21.90 C ATOM 3231 O LEU A 410 105.176 112.695 80.111 1.00 21.90 O ATOM 3232 CB LEU A 410 102.354 113.004 81.875 1.00 21.90 C ATOM 3233 CG LEU A 410 101.856 113.318 80.466 1.00 21.90 C ATOM 3234 CD1 LEU A 410 100.845 112.277 80.022 1.00 21.90 C ATOM 3235 CD2 LEU A 410 101.289 114.715 80.355 1.00 21.90 C ATOM 3236 N ASN A 411 105.395 113.699 82.110 1.00 22.43 N ATOM 3237 CA ASN A 411 106.495 114.549 81.684 1.00 22.43 C ATOM 3238 C ASN A 411 107.760 113.764 81.370 1.00 22.43 C ATOM 3239 O ASN A 411 108.578 114.228 80.571 1.00 22.43 O ATOM 3240 CB ASN A 411 106.787 115.590 82.760 1.00 22.43 C ATOM 3241 CG ASN A 411 107.541 116.777 82.226 1.00 22.43 C ATOM 3242 OD1 ASN A 411 107.497 117.068 81.034 1.00 22.43 O ATOM 3243 ND2 ASN A 411 108.237 117.479 83.109 1.00 22.43 N ATOM 3244 N CYS A 412 107.946 112.583 81.962 1.00 21.87 N ATOM 3245 CA CYS A 412 109.137 111.814 81.630 1.00 21.87 C ATOM 3246 C CYS A 412 108.920 110.908 80.425 1.00 21.87 C ATOM 3247 O CYS A 412 109.825 110.766 79.597 1.00 21.87 O ATOM 3248 CB CYS A 412 109.600 111.000 82.837 1.00 21.87 C ATOM 3249 SG CYS A 412 110.282 111.989 84.184 1.00 21.87 S ATOM 3250 N PHE A 413 107.746 110.286 80.289 1.00 21.70 N ATOM 3251 CA PHE A 413 107.567 109.284 79.248 1.00 21.70 C ATOM 3252 C PHE A 413 106.707 109.752 78.079 1.00 21.70 C ATOM 3253 O PHE A 413 106.420 108.945 77.188 1.00 21.70 O ATOM 3254 CB PHE A 413 106.981 108.008 79.848 1.00 21.70 C ATOM 3255 CG PHE A 413 107.753 107.487 81.020 1.00 21.70 C ATOM 3256 CD1 PHE A 413 109.032 106.996 80.858 1.00 21.70 C ATOM 3257 CD2 PHE A 413 107.199 107.489 82.285 1.00 21.70 C ATOM 3258 CE1 PHE A 413 109.740 106.519 81.938 1.00 21.70 C ATOM 3259 CE2 PHE A 413 107.904 107.016 83.367 1.00 21.70 C ATOM 3260 CZ PHE A 413 109.174 106.533 83.192 1.00 21.70 C ATOM 3261 N ALA A 414 106.327 111.034 78.026 1.00 23.54 N ATOM 3262 CA ALA A 414 105.483 111.497 76.930 1.00 23.54 C ATOM 3263 C ALA A 414 106.243 111.541 75.613 1.00 23.54 C ATOM 3264 O ALA A 414 105.701 111.156 74.571 1.00 23.54 O ATOM 3265 CB ALA A 414 104.907 112.871 77.261 1.00 23.54 C ATOM 3266 N SER A 415 107.500 111.990 75.639 1.00 25.41 N ATOM 3267 CA SER A 415 108.289 112.038 74.413 1.00 25.41 C ATOM 3268 C SER A 415 108.623 110.644 73.905 1.00 25.41 C ATOM 3269 O SER A 415 108.611 110.409 72.692 1.00 25.41 O ATOM 3270 CB SER A 415 109.571 112.830 74.640 1.00 25.41 C ATOM 3271 OG SER A 415 110.599 111.987 75.123 1.00 25.41 O ATOM 3272 N LEU A 416 108.877 109.701 74.812 1.00 24.37 N ATOM 3273 CA LEU A 416 109.150 108.334 74.389 1.00 24.37 C ATOM 3274 C LEU A 416 107.897 107.644 73.868 1.00 24.37 C ATOM 3275 O LEU A 416 107.982 106.853 72.923 1.00 24.37 O ATOM 3276 CB LEU A 416 109.763 107.548 75.540 1.00 24.37 C ATOM 3277 CG LEU A 416 110.982 108.226 76.157 1.00 24.37 C ATOM 3278 CD1 LEU A 416 111.473 107.445 77.350 1.00 24.37 C ATOM 3279 CD2 LEU A 416 112.078 108.366 75.124 1.00 24.37 C ATOM 3280 N PHE A 417 106.726 107.955 74.433 1.00 25.91 N ATOM 3281 CA PHE A 417 105.488 107.408 73.888 1.00 25.91 C ATOM 3282 C PHE A 417 105.172 108.007 72.524 1.00 25.91 C ATOM 3283 O PHE A 417 104.679 107.304 71.633 1.00 25.91 O ATOM 3284 CB PHE A 417 104.335 107.648 74.857 1.00 25.91 C ATOM 3285 CG PHE A 417 104.287 106.674 75.997 1.00 25.91 C ATOM 3286 CD1 PHE A 417 104.864 105.422 75.881 1.00 25.91 C ATOM 3287 CD2 PHE A 417 103.666 107.013 77.186 1.00 25.91 C ATOM 3288 CE1 PHE A 417 104.820 104.526 76.927 1.00 25.91 C ATOM 3289 CE2 PHE A 417 103.620 106.121 78.236 1.00 25.91 C ATOM 3290 CZ PHE A 417 104.197 104.877 78.105 1.00 25.91 C ATOM 3291 N TYR A 418 105.467 109.297 72.336 1.00 28.30 N ATOM 3292 CA TYR A 418 105.251 109.923 71.036 1.00 28.30 C ATOM 3293 C TYR A 418 106.224 109.401 69.988 1.00 28.30 C ATOM 3294 O TYR A 418 105.877 109.344 68.805 1.00 28.30 O ATOM 3295 CB TYR A 418 105.370 111.442 71.149 1.00 28.30 C ATOM 3296 CG TYR A 418 104.960 112.184 69.896 1.00 28.30 C ATOM 3297 CD1 TYR A 418 103.625 112.457 69.635 1.00 28.30 C ATOM 3298 CD2 TYR A 418 105.909 112.614 68.975 1.00 28.30 C ATOM 3299 CE1 TYR A 418 103.246 113.136 68.492 1.00 28.30 C ATOM 3300 CE2 TYR A 418 105.541 113.290 67.831 1.00 28.30 C ATOM 3301 CZ TYR A 418 104.210 113.548 67.594 1.00 28.30 C ATOM 3302 OH TYR A 418 103.844 114.224 66.455 1.00 28.30 O ATOM 3303 N ILE A 419 107.443 109.035 70.384 1.00 27.12 N ATOM 3304 CA ILE A 419 108.356 108.437 69.417 1.00 27.12 C ATOM 3305 C ILE A 419 107.923 107.013 69.089 1.00 27.12 C ATOM 3306 O ILE A 419 107.882 106.616 67.918 1.00 27.12 O ATOM 3307 CB ILE A 419 109.803 108.487 69.936 1.00 27.12 C ATOM 3308 CG1 ILE A 419 110.318 109.918 69.931 1.00 27.12 C ATOM 3309 CG2 ILE A 419 110.714 107.685 69.051 1.00 27.12 C ATOM 3310 CD1 ILE A 419 111.646 110.088 70.619 1.00 27.12 C ATOM 3311 N ALA A 420 107.545 106.237 70.107 1.00 29.47 N ATOM 3312 CA ALA A 420 107.285 104.819 69.903 1.00 29.47 C ATOM 3313 C ALA A 420 105.964 104.545 69.196 1.00 29.47 C ATOM 3314 O ALA A 420 105.887 103.602 68.403 1.00 29.47 O ATOM 3315 CB ALA A 420 107.308 104.087 71.243 1.00 29.47 C ATOM 3316 N PHE A 421 104.921 105.333 69.454 1.00 31.29 N ATOM 3317 CA PHE A 421 103.593 104.982 68.971 1.00 31.29 C ATOM 3318 C PHE A 421 103.016 105.959 67.956 1.00 31.29 C ATOM 3319 O PHE A 421 101.913 105.722 67.458 1.00 31.29 O ATOM 3320 CB PHE A 421 102.631 104.838 70.152 1.00 31.29 C ATOM 3321 CG PHE A 421 103.084 103.840 71.169 1.00 31.29 C ATOM 3322 CD1 PHE A 421 103.484 102.576 70.779 1.00 31.29 C ATOM 3323 CD2 PHE A 421 103.117 104.165 72.513 1.00 31.29 C ATOM 3324 CE1 PHE A 421 103.908 101.652 71.709 1.00 31.29 C ATOM 3325 CE2 PHE A 421 103.539 103.243 73.448 1.00 31.29 C ATOM 3326 CZ PHE A 421 103.935 101.987 73.045 1.00 31.29 C ATOM 3327 N VAL A 422 103.716 107.042 67.630 1.00 31.47 N ATOM 3328 CA VAL A 422 103.278 107.981 66.605 1.00 31.47 C ATOM 3329 C VAL A 422 104.290 108.077 65.470 1.00 31.47 C ATOM 3330 O VAL A 422 103.950 107.866 64.302 1.00 31.47 O ATOM 3331 CB VAL A 422 102.989 109.374 67.203 1.00 31.47 C ATOM 3332 CG1 VAL A 422 102.784 110.395 66.102 1.00 31.47 C ATOM 3333 CG2 VAL A 422 101.773 109.314 68.104 1.00 31.47 C