>>6R7X:HELIX   38 AE2 LEU B  392  VAL B  422  1                                  31    
LESAYQNHLILKVLVFNFLNCFASLFYIAFV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 38 AE2 LEU B 392 VAL B 422 1 31 ATOM 8137 N LEU B 392 92.807 72.806 108.095 1.00 43.47 N ATOM 8138 CA LEU B 392 91.687 73.627 108.516 1.00 43.47 C ATOM 8139 C LEU B 392 90.468 73.340 107.646 1.00 43.47 C ATOM 8140 O LEU B 392 90.509 72.539 106.710 1.00 43.47 O ATOM 8141 CB LEU B 392 92.064 75.104 108.459 1.00 43.47 C ATOM 8142 CG LEU B 392 93.410 75.476 109.075 1.00 43.47 C ATOM 8143 CD1 LEU B 392 93.834 76.863 108.626 1.00 43.47 C ATOM 8144 CD2 LEU B 392 93.339 75.399 110.585 1.00 43.47 C ATOM 8145 N GLU B 393 89.360 74.003 107.962 1.00 37.30 N ATOM 8146 CA GLU B 393 88.174 73.938 107.123 1.00 37.30 C ATOM 8147 C GLU B 393 88.187 75.001 106.036 1.00 37.30 C ATOM 8148 O GLU B 393 87.606 74.784 104.966 1.00 37.30 O ATOM 8149 CB GLU B 393 86.915 74.079 107.988 1.00 37.30 C ATOM 8150 CG GLU B 393 85.590 73.810 107.281 1.00 37.30 C ATOM 8151 CD GLU B 393 85.360 72.341 106.978 1.00 37.30 C ATOM 8152 OE1 GLU B 393 85.963 71.485 107.657 1.00 37.30 O ATOM 8153 OE2 GLU B 393 84.571 72.040 106.059 1.00 37.30 O ATOM 8154 N SER B 394 88.869 76.124 106.273 1.00 35.44 N ATOM 8155 CA SER B 394 88.942 77.185 105.276 1.00 35.44 C ATOM 8156 C SER B 394 89.748 76.754 104.058 1.00 35.44 C ATOM 8157 O SER B 394 89.376 77.071 102.924 1.00 35.44 O ATOM 8158 CB SER B 394 89.546 78.442 105.896 1.00 35.44 C ATOM 8159 OG SER B 394 90.959 78.418 105.809 1.00 35.44 O ATOM 8160 N ALA B 395 90.837 76.010 104.266 1.00 33.09 N ATOM 8161 CA ALA B 395 91.644 75.544 103.140 1.00 33.09 C ATOM 8162 C ALA B 395 90.907 74.487 102.329 1.00 33.09 C ATOM 8163 O ALA B 395 90.977 74.485 101.091 1.00 33.09 O ATOM 8164 CB ALA B 395 92.979 74.999 103.641 1.00 33.09 C ATOM 8165 N TYR B 396 90.186 73.592 103.011 1.00 31.16 N ATOM 8166 CA TYR B 396 89.372 72.590 102.330 1.00 31.16 C ATOM 8167 C TYR B 396 88.261 73.241 101.521 1.00 31.16 C ATOM 8168 O TYR B 396 88.013 72.852 100.372 1.00 31.16 O ATOM 8169 CB TYR B 396 88.788 71.618 103.353 1.00 31.16 C ATOM 8170 CG TYR B 396 87.600 70.823 102.864 1.00 31.16 C ATOM 8171 CD1 TYR B 396 87.761 69.788 101.959 1.00 31.16 C ATOM 8172 CD2 TYR B 396 86.319 71.095 103.324 1.00 31.16 C ATOM 8173 CE1 TYR B 396 86.681 69.053 101.513 1.00 31.16 C ATOM 8174 CE2 TYR B 396 85.233 70.366 102.882 1.00 31.16 C ATOM 8175 CZ TYR B 396 85.422 69.348 101.978 1.00 31.16 C ATOM 8176 OH TYR B 396 84.349 68.617 101.537 1.00 31.16 O ATOM 8177 N GLN B 397 87.605 74.252 102.097 1.00 28.80 N ATOM 8178 CA GLN B 397 86.567 74.975 101.376 1.00 28.80 C ATOM 8179 C GLN B 397 87.133 75.742 100.192 1.00 28.80 C ATOM 8180 O GLN B 397 86.505 75.769 99.138 1.00 28.80 O ATOM 8181 CB GLN B 397 85.828 75.928 102.315 1.00 28.80 C ATOM 8182 CG GLN B 397 84.805 75.250 103.204 1.00 28.80 C ATOM 8183 CD GLN B 397 83.671 74.633 102.418 1.00 28.80 C ATOM 8184 OE1 GLN B 397 83.221 75.187 101.418 1.00 28.80 O ATOM 8185 NE2 GLN B 397 83.202 73.476 102.865 1.00 28.80 N ATOM 8186 N ASN B 398 88.330 76.320 100.323 1.00 27.78 N ATOM 8187 CA ASN B 398 88.927 77.054 99.209 1.00 27.78 C ATOM 8188 C ASN B 398 89.307 76.125 98.062 1.00 27.78 C ATOM 8189 O ASN B 398 89.078 76.457 96.892 1.00 27.78 O ATOM 8190 CB ASN B 398 90.149 77.832 99.689 1.00 27.78 C ATOM 8191 CG ASN B 398 89.779 79.034 100.521 1.00 27.78 C ATOM 8192 OD1 ASN B 398 88.615 79.231 100.862 1.00 27.78 O ATOM 8193 ND2 ASN B 398 90.770 79.846 100.857 1.00 27.78 N ATOM 8194 N HIS B 399 89.858 74.948 98.376 1.00 26.50 N ATOM 8195 CA HIS B 399 90.215 74.000 97.322 1.00 26.50 C ATOM 8196 C HIS B 399 88.976 73.440 96.632 1.00 26.50 C ATOM 8197 O HIS B 399 88.953 73.306 95.397 1.00 26.50 O ATOM 8198 CB HIS B 399 91.061 72.870 97.898 1.00 26.50 C ATOM 8199 CG HIS B 399 92.471 73.266 98.196 1.00 26.50 C ATOM 8200 ND1 HIS B 399 92.790 74.241 99.114 1.00 26.50 N ATOM 8201 CD2 HIS B 399 93.646 72.821 97.695 1.00 26.50 C ATOM 8202 CE1 HIS B 399 94.102 74.380 99.167 1.00 26.50 C ATOM 8203 NE2 HIS B 399 94.645 73.530 98.316 1.00 26.50 N ATOM 8204 N LEU B 400 87.930 73.133 97.408 1.00 23.59 N ATOM 8205 CA LEU B 400 86.689 72.640 96.820 1.00 23.59 C ATOM 8206 C LEU B 400 86.013 73.706 95.966 1.00 23.59 C ATOM 8207 O LEU B 400 85.492 73.396 94.888 1.00 23.59 O ATOM 8208 CB LEU B 400 85.747 72.162 97.919 1.00 23.59 C ATOM 8209 CG LEU B 400 84.463 71.492 97.448 1.00 23.59 C ATOM 8210 CD1 LEU B 400 84.788 70.228 96.686 1.00 23.59 C ATOM 8211 CD2 LEU B 400 83.566 71.192 98.631 1.00 23.59 C ATOM 8212 N ILE B 401 86.039 74.966 96.416 1.00 20.98 N ATOM 8213 CA ILE B 401 85.469 76.065 95.643 1.00 20.98 C ATOM 8214 C ILE B 401 86.235 76.266 94.345 1.00 20.98 C ATOM 8215 O ILE B 401 85.624 76.467 93.294 1.00 20.98 O ATOM 8216 CB ILE B 401 85.404 77.345 96.502 1.00 20.98 C ATOM 8217 CG1 ILE B 401 84.236 77.247 97.483 1.00 20.98 C ATOM 8218 CG2 ILE B 401 85.263 78.606 95.665 1.00 20.98 C ATOM 8219 CD1 ILE B 401 84.252 78.254 98.584 1.00 20.98 C ATOM 8220 N LEU B 402 87.565 76.123 94.373 1.00 20.71 N ATOM 8221 CA LEU B 402 88.346 76.278 93.145 1.00 20.71 C ATOM 8222 C LEU B 402 88.038 75.178 92.132 1.00 20.71 C ATOM 8223 O LEU B 402 87.801 75.468 90.949 1.00 20.71 O ATOM 8224 CB LEU B 402 89.838 76.300 93.459 1.00 20.71 C ATOM 8225 CG LEU B 402 90.708 76.482 92.219 1.00 20.71 C ATOM 8226 CD1 LEU B 402 90.386 77.793 91.528 1.00 20.71 C ATOM 8227 CD2 LEU B 402 92.163 76.429 92.593 1.00 20.71 C ATOM 8228 N LYS B 403 87.994 73.918 92.588 1.00 20.74 N ATOM 8229 CA LYS B 403 87.708 72.801 91.683 1.00 20.74 C ATOM 8230 C LYS B 403 86.305 72.900 91.088 1.00 20.74 C ATOM 8231 O LYS B 403 86.123 72.794 89.863 1.00 20.74 O ATOM 8232 CB LYS B 403 87.869 71.472 92.420 1.00 20.74 C ATOM 8233 CG LYS B 403 89.290 71.108 92.789 1.00 20.74 C ATOM 8234 CD LYS B 403 89.317 69.808 93.573 1.00 20.74 C ATOM 8235 CE LYS B 403 90.730 69.398 93.935 1.00 20.74 C ATOM 8236 NZ LYS B 403 91.397 70.404 94.800 1.00 20.74 N ATOM 8237 N VAL B 404 85.304 73.142 91.942 1.00 18.37 N ATOM 8238 CA VAL B 404 83.921 73.183 91.483 1.00 18.37 C ATOM 8239 C VAL B 404 83.667 74.415 90.620 1.00 18.37 C ATOM 8240 O VAL B 404 82.948 74.332 89.619 1.00 18.37 O ATOM 8241 CB VAL B 404 82.979 73.099 92.701 1.00 18.37 C ATOM 8242 CG1 VAL B 404 81.541 73.311 92.310 1.00 18.37 C ATOM 8243 CG2 VAL B 404 83.112 71.743 93.358 1.00 18.37 C ATOM 8244 N LEU B 405 84.316 75.546 90.922 1.00 17.72 N ATOM 8245 CA LEU B 405 84.133 76.750 90.121 1.00 17.72 C ATOM 8246 C LEU B 405 84.746 76.602 88.738 1.00 17.72 C ATOM 8247 O LEU B 405 84.125 76.998 87.746 1.00 17.72 O ATOM 8248 CB LEU B 405 84.739 77.956 90.832 1.00 17.72 C ATOM 8249 CG LEU B 405 83.839 78.743 91.778 1.00 17.72 C ATOM 8250 CD1 LEU B 405 84.494 80.055 92.148 1.00 17.72 C ATOM 8251 CD2 LEU B 405 82.497 78.970 91.153 1.00 17.72 C ATOM 8252 N VAL B 406 85.943 76.007 88.650 1.00 20.15 N ATOM 8253 CA VAL B 406 86.591 75.822 87.353 1.00 20.15 C ATOM 8254 C VAL B 406 85.786 74.865 86.479 1.00 20.15 C ATOM 8255 O VAL B 406 85.481 75.176 85.315 1.00 20.15 O ATOM 8256 CB VAL B 406 88.040 75.342 87.545 1.00 20.15 C ATOM 8257 CG1 VAL B 406 88.578 74.699 86.283 1.00 20.15 C ATOM 8258 CG2 VAL B 406 88.917 76.507 87.949 1.00 20.15 C ATOM 8259 N PHE B 407 85.371 73.720 87.040 1.00 20.67 N ATOM 8260 CA PHE B 407 84.615 72.777 86.220 1.00 20.67 C ATOM 8261 C PHE B 407 83.220 73.284 85.885 1.00 20.67 C ATOM 8262 O PHE B 407 82.734 73.024 84.784 1.00 20.67 O ATOM 8263 CB PHE B 407 84.502 71.418 86.893 1.00 20.67 C ATOM 8264 CG PHE B 407 83.746 70.400 86.077 1.00 20.67 C ATOM 8265 CD1 PHE B 407 84.341 69.792 84.988 1.00 20.67 C ATOM 8266 CD2 PHE B 407 82.442 70.057 86.395 1.00 20.67 C ATOM 8267 CE1 PHE B 407 83.655 68.862 84.234 1.00 20.67 C ATOM 8268 CE2 PHE B 407 81.751 69.133 85.640 1.00 20.67 C ATOM 8269 CZ PHE B 407 82.360 68.533 84.563 1.00 20.67 C ATOM 8270 N ASN B 408 82.563 74.015 86.788 1.00 19.93 N ATOM 8271 CA ASN B 408 81.212 74.467 86.485 1.00 19.93 C ATOM 8272 C ASN B 408 81.222 75.614 85.489 1.00 19.93 C ATOM 8273 O ASN B 408 80.343 75.680 84.623 1.00 19.93 O ATOM 8274 CB ASN B 408 80.481 74.860 87.760 1.00 19.93 C ATOM 8275 CG ASN B 408 79.918 73.666 88.479 1.00 19.93 C ATOM 8276 OD1 ASN B 408 79.889 72.565 87.938 1.00 19.93 O ATOM 8277 ND2 ASN B 408 79.447 73.874 89.691 1.00 19.93 N ATOM 8278 N PHE B 409 82.228 76.497 85.567 1.00 21.00 N ATOM 8279 CA PHE B 409 82.404 77.523 84.545 1.00 21.00 C ATOM 8280 C PHE B 409 82.636 76.900 83.177 1.00 21.00 C ATOM 8281 O PHE B 409 81.964 77.271 82.204 1.00 21.00 O ATOM 8282 CB PHE B 409 83.566 78.445 84.921 1.00 21.00 C ATOM 8283 CG PHE B 409 83.767 79.596 83.971 1.00 21.00 C ATOM 8284 CD1 PHE B 409 83.062 80.772 84.133 1.00 21.00 C ATOM 8285 CD2 PHE B 409 84.684 79.513 82.933 1.00 21.00 C ATOM 8286 CE1 PHE B 409 83.248 81.828 83.265 1.00 21.00 C ATOM 8287 CE2 PHE B 409 84.868 80.564 82.064 1.00 21.00 C ATOM 8288 CZ PHE B 409 84.153 81.723 82.233 1.00 21.00 C ATOM 8289 N LEU B 410 83.551 75.924 83.089 1.00 22.35 N ATOM 8290 CA LEU B 410 83.836 75.312 81.793 1.00 22.35 C ATOM 8291 C LEU B 410 82.639 74.530 81.266 1.00 22.35 C ATOM 8292 O LEU B 410 82.235 74.714 80.114 1.00 22.35 O ATOM 8293 CB LEU B 410 85.057 74.405 81.877 1.00 22.35 C ATOM 8294 CG LEU B 410 85.555 74.091 80.468 1.00 22.35 C ATOM 8295 CD1 LEU B 410 86.566 75.133 80.024 1.00 22.35 C ATOM 8296 CD2 LEU B 410 86.123 72.694 80.356 1.00 22.35 C ATOM 8297 N ASN B 411 82.017 73.710 82.113 1.00 22.91 N ATOM 8298 CA ASN B 411 80.916 72.859 81.687 1.00 22.91 C ATOM 8299 C ASN B 411 79.651 73.644 81.373 1.00 22.91 C ATOM 8300 O ASN B 411 78.833 73.180 80.575 1.00 22.91 O ATOM 8301 CB ASN B 411 80.625 71.819 82.763 1.00 22.91 C ATOM 8302 CG ASN B 411 79.871 70.631 82.230 1.00 22.91 C ATOM 8303 OD1 ASN B 411 79.915 70.340 81.037 1.00 22.91 O ATOM 8304 ND2 ASN B 411 79.175 69.930 83.112 1.00 22.91 N ATOM 8305 N CYS B 412 79.465 74.826 81.965 1.00 22.30 N ATOM 8306 CA CYS B 412 78.274 75.594 81.633 1.00 22.30 C ATOM 8307 C CYS B 412 78.491 76.500 80.428 1.00 22.30 C ATOM 8308 O CYS B 412 77.585 76.642 79.601 1.00 22.30 O ATOM 8309 CB CYS B 412 77.811 76.408 82.841 1.00 22.30 C ATOM 8310 SG CYS B 412 77.129 75.419 84.187 1.00 22.30 S ATOM 8311 N PHE B 413 79.664 77.122 80.292 1.00 22.02 N ATOM 8312 CA PHE B 413 79.843 78.124 79.251 1.00 22.02 C ATOM 8313 C PHE B 413 80.703 77.657 78.082 1.00 22.02 C ATOM 8314 O PHE B 413 80.989 78.464 77.191 1.00 22.02 O ATOM 8315 CB PHE B 413 80.429 79.400 79.851 1.00 22.02 C ATOM 8316 CG PHE B 413 79.657 79.921 81.023 1.00 22.02 C ATOM 8317 CD1 PHE B 413 78.378 80.412 80.861 1.00 22.02 C ATOM 8318 CD2 PHE B 413 80.211 79.919 82.287 1.00 22.02 C ATOM 8319 CE1 PHE B 413 77.670 80.889 81.941 1.00 22.02 C ATOM 8320 CE2 PHE B 413 79.506 80.393 83.369 1.00 22.02 C ATOM 8321 CZ PHE B 413 78.236 80.875 83.195 1.00 22.02 C ATOM 8322 N ALA B 414 81.083 76.375 78.029 1.00 23.96 N ATOM 8323 CA ALA B 414 81.927 75.911 76.933 1.00 23.96 C ATOM 8324 C ALA B 414 81.167 75.867 75.616 1.00 23.96 C ATOM 8325 O ALA B 414 81.709 76.252 74.574 1.00 23.96 O ATOM 8326 CB ALA B 414 82.503 74.538 77.263 1.00 23.96 C ATOM 8327 N SER B 415 79.910 75.418 75.642 1.00 25.83 N ATOM 8328 CA SER B 415 79.120 75.370 74.416 1.00 25.83 C ATOM 8329 C SER B 415 78.786 76.764 73.908 1.00 25.83 C ATOM 8330 O SER B 415 78.797 76.999 72.695 1.00 25.83 O ATOM 8331 CB SER B 415 77.838 74.578 74.644 1.00 25.83 C ATOM 8332 OG SER B 415 76.810 75.421 75.127 1.00 25.83 O ATOM 8333 N LEU B 416 78.532 77.707 74.815 1.00 24.65 N ATOM 8334 CA LEU B 416 78.259 79.073 74.392 1.00 24.65 C ATOM 8335 C LEU B 416 79.512 79.764 73.871 1.00 24.65 C ATOM 8336 O LEU B 416 79.426 80.555 72.926 1.00 24.65 O ATOM 8337 CB LEU B 416 77.646 79.860 75.543 1.00 24.65 C ATOM 8338 CG LEU B 416 76.427 79.181 76.160 1.00 24.65 C ATOM 8339 CD1 LEU B 416 75.936 79.962 77.354 1.00 24.65 C ATOM 8340 CD2 LEU B 416 75.331 79.041 75.128 1.00 24.65 C ATOM 8341 N PHE B 417 80.683 79.454 74.436 1.00 26.17 N ATOM 8342 CA PHE B 417 81.920 80.000 73.890 1.00 26.17 C ATOM 8343 C PHE B 417 82.236 79.402 72.526 1.00 26.17 C ATOM 8344 O PHE B 417 82.729 80.105 71.635 1.00 26.17 O ATOM 8345 CB PHE B 417 83.074 79.761 74.859 1.00 26.17 C ATOM 8346 CG PHE B 417 83.121 80.735 75.999 1.00 26.17 C ATOM 8347 CD1 PHE B 417 82.545 81.987 75.882 1.00 26.17 C ATOM 8348 CD2 PHE B 417 83.743 80.396 77.187 1.00 26.17 C ATOM 8349 CE1 PHE B 417 82.589 82.883 76.929 1.00 26.17 C ATOM 8350 CE2 PHE B 417 83.789 81.288 78.237 1.00 26.17 C ATOM 8351 CZ PHE B 417 83.212 82.532 78.107 1.00 26.17 C ATOM 8352 N TYR B 418 81.942 78.111 72.338 1.00 28.66 N ATOM 8353 CA TYR B 418 82.157 77.485 71.038 1.00 28.66 C ATOM 8354 C TYR B 418 81.184 78.007 69.990 1.00 28.66 C ATOM 8355 O TYR B 418 81.530 78.064 68.807 1.00 28.66 O ATOM 8356 CB TYR B 418 82.039 75.967 71.152 1.00 28.66 C ATOM 8357 CG TYR B 418 82.448 75.224 69.899 1.00 28.66 C ATOM 8358 CD1 TYR B 418 83.784 74.952 69.638 1.00 28.66 C ATOM 8359 CD2 TYR B 418 81.500 74.794 68.978 1.00 28.66 C ATOM 8360 CE1 TYR B 418 84.162 74.272 68.494 1.00 28.66 C ATOM 8361 CE2 TYR B 418 81.867 74.118 67.834 1.00 28.66 C ATOM 8362 CZ TYR B 418 83.198 73.860 67.597 1.00 28.66 C ATOM 8363 OH TYR B 418 83.564 73.184 66.457 1.00 28.66 O ATOM 8364 N ILE B 419 79.965 78.372 70.387 1.00 27.25 N ATOM 8365 CA ILE B 419 79.051 78.971 69.420 1.00 27.25 C ATOM 8366 C ILE B 419 79.484 80.394 69.092 1.00 27.25 C ATOM 8367 O ILE B 419 79.525 80.791 67.921 1.00 27.25 O ATOM 8368 CB ILE B 419 77.605 78.920 69.939 1.00 27.25 C ATOM 8369 CG1 ILE B 419 77.090 77.489 69.934 1.00 27.25 C ATOM 8370 CG2 ILE B 419 76.694 79.722 69.055 1.00 27.25 C ATOM 8371 CD1 ILE B 419 75.762 77.319 70.623 1.00 27.25 C ATOM 8372 N ALA B 420 79.862 81.170 70.109 1.00 29.47 N ATOM 8373 CA ALA B 420 80.122 82.589 69.905 1.00 29.47 C ATOM 8374 C ALA B 420 81.443 82.863 69.199 1.00 29.47 C ATOM 8375 O ALA B 420 81.520 83.806 68.405 1.00 29.47 O ATOM 8376 CB ALA B 420 80.099 83.321 71.246 1.00 29.47 C ATOM 8377 N PHE B 421 82.486 82.075 69.456 1.00 31.16 N ATOM 8378 CA PHE B 421 83.814 82.426 68.972 1.00 31.16 C ATOM 8379 C PHE B 421 84.391 81.450 67.958 1.00 31.16 C ATOM 8380 O PHE B 421 85.494 81.686 67.459 1.00 31.16 O ATOM 8381 CB PHE B 421 84.776 82.570 70.153 1.00 31.16 C ATOM 8382 CG PHE B 421 84.323 83.568 71.170 1.00 31.16 C ATOM 8383 CD1 PHE B 421 83.923 84.832 70.780 1.00 31.16 C ATOM 8384 CD2 PHE B 421 84.291 83.244 72.514 1.00 31.16 C ATOM 8385 CE1 PHE B 421 83.499 85.756 71.710 1.00 31.16 C ATOM 8386 CE2 PHE B 421 83.869 84.165 73.450 1.00 31.16 C ATOM 8387 CZ PHE B 421 83.472 85.422 73.046 1.00 31.16 C ATOM 8388 N VAL B 422 83.691 80.366 67.632 1.00 31.46 N ATOM 8389 CA VAL B 422 84.129 79.427 66.607 1.00 31.46 C ATOM 8390 C VAL B 422 83.117 79.331 65.472 1.00 31.46 C ATOM 8391 O VAL B 422 83.456 79.542 64.304 1.00 31.46 O ATOM 8392 CB VAL B 422 84.418 78.034 67.205 1.00 31.46 C ATOM 8393 CG1 VAL B 422 84.623 77.013 66.104 1.00 31.46 C ATOM 8394 CG2 VAL B 422 85.635 78.094 68.106 1.00 31.46 C