>>6R7X:HELIX   13 AB4 VAL A  317  SER A  350  1                                  34    
VSLPFVCLCLYFSLYVMMIYFDMEVWALGLHENS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 13 AB4 VAL A 317 SER A 350 1 34 ATOM 2454 N VAL A 317 89.832 123.364 91.704 1.00 37.88 N ATOM 2455 CA VAL A 317 91.051 124.153 91.634 1.00 37.88 C ATOM 2456 C VAL A 317 92.270 123.288 91.339 1.00 37.88 C ATOM 2457 O VAL A 317 93.078 123.629 90.468 1.00 37.88 O ATOM 2458 CB VAL A 317 91.261 124.967 92.929 1.00 37.88 C ATOM 2459 CG1 VAL A 317 92.556 125.765 92.871 1.00 37.88 C ATOM 2460 CG2 VAL A 317 90.083 125.894 93.169 1.00 37.88 C ATOM 2461 N SER A 318 92.415 122.153 92.031 1.00 37.36 N ATOM 2462 CA SER A 318 93.625 121.356 91.878 1.00 37.36 C ATOM 2463 C SER A 318 93.642 120.599 90.557 1.00 37.36 C ATOM 2464 O SER A 318 94.637 120.653 89.829 1.00 37.36 O ATOM 2465 CB SER A 318 93.759 120.381 93.043 1.00 37.36 C ATOM 2466 OG SER A 318 92.948 119.241 92.833 1.00 37.36 O ATOM 2467 N LEU A 319 92.554 119.909 90.229 1.00 37.11 N ATOM 2468 CA LEU A 319 92.435 119.134 88.996 1.00 37.11 C ATOM 2469 C LEU A 319 92.514 119.980 87.715 1.00 37.11 C ATOM 2470 O LEU A 319 93.153 119.521 86.754 1.00 37.11 O ATOM 2471 CB LEU A 319 91.148 118.298 89.037 1.00 37.11 C ATOM 2472 CG LEU A 319 90.725 117.520 87.793 1.00 37.11 C ATOM 2473 CD1 LEU A 319 91.759 116.470 87.444 1.00 37.11 C ATOM 2474 CD2 LEU A 319 89.366 116.883 88.005 1.00 37.11 C ATOM 2475 N PRO A 320 91.929 121.193 87.625 1.00 36.43 N ATOM 2476 CA PRO A 320 92.264 122.039 86.466 1.00 36.43 C ATOM 2477 C PRO A 320 93.716 122.475 86.415 1.00 36.43 C ATOM 2478 O PRO A 320 94.264 122.605 85.315 1.00 36.43 O ATOM 2479 CB PRO A 320 91.326 123.241 86.628 1.00 36.43 C ATOM 2480 CG PRO A 320 90.165 122.684 87.290 1.00 36.43 C ATOM 2481 CD PRO A 320 90.744 121.757 88.309 1.00 36.43 C ATOM 2482 N PHE A 321 94.370 122.670 87.563 1.00 34.00 N ATOM 2483 CA PHE A 321 95.787 123.020 87.540 1.00 34.00 C ATOM 2484 C PHE A 321 96.641 121.840 87.093 1.00 34.00 C ATOM 2485 O PHE A 321 97.630 122.024 86.373 1.00 34.00 O ATOM 2486 CB PHE A 321 96.241 123.511 88.911 1.00 34.00 C ATOM 2487 CG PHE A 321 97.664 123.983 88.937 1.00 34.00 C ATOM 2488 CD1 PHE A 321 98.002 125.220 88.417 1.00 34.00 C ATOM 2489 CD2 PHE A 321 98.665 123.188 89.473 1.00 34.00 C ATOM 2490 CE1 PHE A 321 99.312 125.660 88.434 1.00 34.00 C ATOM 2491 CE2 PHE A 321 99.976 123.620 89.494 1.00 34.00 C ATOM 2492 CZ PHE A 321 100.300 124.858 88.973 1.00 34.00 C ATOM 2493 N VAL A 322 96.265 120.623 87.494 1.00 33.49 N ATOM 2494 CA VAL A 322 96.985 119.434 87.047 1.00 33.49 C ATOM 2495 C VAL A 322 96.792 119.226 85.549 1.00 33.49 C ATOM 2496 O VAL A 322 97.746 118.903 84.832 1.00 33.49 O ATOM 2497 CB VAL A 322 96.543 118.206 87.866 1.00 33.49 C ATOM 2498 CG1 VAL A 322 97.164 116.928 87.329 1.00 33.49 C ATOM 2499 CG2 VAL A 322 96.930 118.386 89.314 1.00 33.49 C ATOM 2500 N CYS A 323 95.573 119.462 85.044 1.00 34.11 N ATOM 2501 CA CYS A 323 95.329 119.330 83.608 1.00 34.11 C ATOM 2502 C CYS A 323 96.071 120.399 82.809 1.00 34.11 C ATOM 2503 O CYS A 323 96.599 120.115 81.724 1.00 34.11 O ATOM 2504 CB CYS A 323 93.830 119.391 83.326 1.00 34.11 C ATOM 2505 SG CYS A 323 92.929 117.899 83.799 1.00 34.11 S ATOM 2506 N LEU A 324 96.151 121.620 83.347 1.00 31.81 N ATOM 2507 CA LEU A 324 96.921 122.678 82.700 1.00 31.81 C ATOM 2508 C LEU A 324 98.411 122.352 82.688 1.00 31.81 C ATOM 2509 O LEU A 324 99.101 122.608 81.694 1.00 31.81 O ATOM 2510 CB LEU A 324 96.664 124.008 83.406 1.00 31.81 C ATOM 2511 CG LEU A 324 97.633 125.161 83.149 1.00 31.81 C ATOM 2512 CD1 LEU A 324 97.396 125.754 81.774 1.00 31.81 C ATOM 2513 CD2 LEU A 324 97.499 126.221 84.225 1.00 31.81 C ATOM 2514 N CYS A 325 98.917 121.752 83.768 1.00 29.03 N ATOM 2515 CA CYS A 325 100.328 121.383 83.806 1.00 29.03 C ATOM 2516 C CYS A 325 100.641 120.221 82.869 1.00 29.03 C ATOM 2517 O CYS A 325 101.723 120.191 82.270 1.00 29.03 O ATOM 2518 CB CYS A 325 100.739 121.050 85.237 1.00 29.03 C ATOM 2519 SG CYS A 325 101.089 122.510 86.235 1.00 29.03 S ATOM 2520 N LEU A 326 99.707 119.278 82.703 1.00 27.55 N ATOM 2521 CA LEU A 326 99.906 118.213 81.720 1.00 27.55 C ATOM 2522 C LEU A 326 99.888 118.763 80.298 1.00 27.55 C ATOM 2523 O LEU A 326 100.683 118.329 79.449 1.00 27.55 O ATOM 2524 CB LEU A 326 98.845 117.123 81.875 1.00 27.55 C ATOM 2525 CG LEU A 326 98.774 116.303 83.167 1.00 27.55 C ATOM 2526 CD1 LEU A 326 97.901 115.074 82.981 1.00 27.55 C ATOM 2527 CD2 LEU A 326 100.146 115.921 83.677 1.00 27.55 C ATOM 2528 N TYR A 327 99.007 119.733 80.025 1.00 30.68 N ATOM 2529 CA TYR A 327 98.991 120.365 78.708 1.00 30.68 C ATOM 2530 C TYR A 327 100.273 121.152 78.452 1.00 30.68 C ATOM 2531 O TYR A 327 100.797 121.152 77.331 1.00 30.68 O ATOM 2532 CB TYR A 327 97.772 121.274 78.568 1.00 30.68 C ATOM 2533 CG TYR A 327 97.859 122.213 77.389 1.00 30.68 C ATOM 2534 CD1 TYR A 327 97.759 121.734 76.091 1.00 30.68 C ATOM 2535 CD2 TYR A 327 98.051 123.577 77.574 1.00 30.68 C ATOM 2536 CE1 TYR A 327 97.845 122.586 75.008 1.00 30.68 C ATOM 2537 CE2 TYR A 327 98.140 124.436 76.497 1.00 30.68 C ATOM 2538 CZ TYR A 327 98.035 123.935 75.218 1.00 30.68 C ATOM 2539 OH TYR A 327 98.120 124.790 74.144 1.00 30.68 O ATOM 2540 N PHE A 328 100.805 121.810 79.485 1.00 29.68 N ATOM 2541 CA PHE A 328 102.061 122.535 79.325 1.00 29.68 C ATOM 2542 C PHE A 328 103.236 121.587 79.123 1.00 29.68 C ATOM 2543 O PHE A 328 104.167 121.912 78.376 1.00 29.68 O ATOM 2544 CB PHE A 328 102.311 123.436 80.529 1.00 29.68 C ATOM 2545 CG PHE A 328 103.498 124.334 80.372 1.00 29.68 C ATOM 2546 CD1 PHE A 328 103.479 125.369 79.453 1.00 29.68 C ATOM 2547 CD2 PHE A 328 104.634 124.145 81.141 1.00 29.68 C ATOM 2548 CE1 PHE A 328 104.572 126.203 79.302 1.00 29.68 C ATOM 2549 CE2 PHE A 328 105.732 124.975 80.997 1.00 29.68 C ATOM 2550 CZ PHE A 328 105.701 126.004 80.076 1.00 29.68 C ATOM 2551 N SER A 329 103.200 120.411 79.757 1.00 27.23 N ATOM 2552 CA SER A 329 104.231 119.405 79.519 1.00 27.23 C ATOM 2553 C SER A 329 104.176 118.883 78.089 1.00 27.23 C ATOM 2554 O SER A 329 105.221 118.683 77.454 1.00 27.23 O ATOM 2555 CB SER A 329 104.079 118.257 80.512 1.00 27.23 C ATOM 2556 OG SER A 329 105.039 117.250 80.265 1.00 27.23 O ATOM 2557 N LEU A 330 102.965 118.689 77.553 1.00 28.71 N ATOM 2558 CA LEU A 330 102.838 118.304 76.148 1.00 28.71 C ATOM 2559 C LEU A 330 103.301 119.414 75.207 1.00 28.71 C ATOM 2560 O LEU A 330 103.869 119.129 74.144 1.00 28.71 O ATOM 2561 CB LEU A 330 101.395 117.916 75.832 1.00 28.71 C ATOM 2562 CG LEU A 330 100.813 116.691 76.537 1.00 28.71 C ATOM 2563 CD1 LEU A 330 99.546 116.237 75.836 1.00 28.71 C ATOM 2564 CD2 LEU A 330 101.821 115.557 76.611 1.00 28.71 C ATOM 2565 N TYR A 331 103.096 120.677 75.588 1.00 29.52 N ATOM 2566 CA TYR A 331 103.545 121.786 74.750 1.00 29.52 C ATOM 2567 C TYR A 331 105.068 121.896 74.729 1.00 29.52 C ATOM 2568 O TYR A 331 105.663 122.155 73.674 1.00 29.52 O ATOM 2569 CB TYR A 331 102.910 123.087 75.235 1.00 29.52 C ATOM 2570 CG TYR A 331 103.288 124.293 74.417 1.00 29.52 C ATOM 2571 CD1 TYR A 331 102.896 124.403 73.090 1.00 29.52 C ATOM 2572 CD2 TYR A 331 104.019 125.331 74.976 1.00 29.52 C ATOM 2573 CE1 TYR A 331 103.238 125.508 72.336 1.00 29.52 C ATOM 2574 CE2 TYR A 331 104.363 126.440 74.232 1.00 29.52 C ATOM 2575 CZ TYR A 331 103.970 126.523 72.913 1.00 29.52 C ATOM 2576 OH TYR A 331 104.311 127.627 72.167 1.00 29.52 O ATOM 2577 N VAL A 332 105.716 121.681 75.878 1.00 28.15 N ATOM 2578 CA VAL A 332 107.176 121.618 75.910 1.00 28.15 C ATOM 2579 C VAL A 332 107.701 120.407 75.136 1.00 28.15 C ATOM 2580 O VAL A 332 108.750 120.500 74.481 1.00 28.15 O ATOM 2581 CB VAL A 332 107.660 121.641 77.374 1.00 28.15 C ATOM 2582 CG1 VAL A 332 109.165 121.521 77.473 1.00 28.15 C ATOM 2583 CG2 VAL A 332 107.243 122.939 78.031 1.00 28.15 C ATOM 2584 N MET A 333 106.962 119.291 75.143 1.00 30.48 N ATOM 2585 CA MET A 333 107.328 118.140 74.316 1.00 30.48 C ATOM 2586 C MET A 333 107.281 118.480 72.828 1.00 30.48 C ATOM 2587 O MET A 333 108.181 118.103 72.065 1.00 30.48 O ATOM 2588 CB MET A 333 106.404 116.964 74.621 1.00 30.48 C ATOM 2589 CG MET A 333 106.694 115.727 73.801 1.00 30.48 C ATOM 2590 SD MET A 333 105.398 114.487 73.916 1.00 30.48 S ATOM 2591 CE MET A 333 104.154 115.195 72.847 1.00 30.48 C ATOM 2592 N MET A 334 106.250 119.215 72.402 1.00 32.19 N ATOM 2593 CA MET A 334 106.164 119.612 70.998 1.00 32.19 C ATOM 2594 C MET A 334 107.250 120.616 70.619 1.00 32.19 C ATOM 2595 O MET A 334 107.752 120.580 69.486 1.00 32.19 O ATOM 2596 CB MET A 334 104.782 120.182 70.690 1.00 32.19 C ATOM 2597 CG MET A 334 103.652 119.176 70.821 1.00 32.19 C ATOM 2598 SD MET A 334 103.989 117.611 69.994 1.00 32.19 S ATOM 2599 CE MET A 334 103.962 118.110 68.276 1.00 32.19 C ATOM 2600 N ILE A 335 107.634 121.498 71.550 1.00 33.10 N ATOM 2601 CA ILE A 335 108.775 122.388 71.320 1.00 33.10 C ATOM 2602 C ILE A 335 110.060 121.583 71.142 1.00 33.10 C ATOM 2603 O ILE A 335 110.875 121.875 70.254 1.00 33.10 O ATOM 2604 CB ILE A 335 108.896 123.415 72.464 1.00 33.10 C ATOM 2605 CG1 ILE A 335 107.749 124.418 72.406 1.00 33.10 C ATOM 2606 CG2 ILE A 335 110.223 124.156 72.433 1.00 33.10 C ATOM 2607 CD1 ILE A 335 107.725 125.355 73.586 1.00 33.10 C ATOM 2608 N TYR A 336 110.238 120.534 71.955 1.00 34.54 N ATOM 2609 CA TYR A 336 111.417 119.678 71.824 1.00 34.54 C ATOM 2610 C TYR A 336 111.425 118.935 70.494 1.00 34.54 C ATOM 2611 O TYR A 336 112.485 118.759 69.887 1.00 34.54 O ATOM 2612 CB TYR A 336 111.490 118.686 72.986 1.00 34.54 C ATOM 2613 CG TYR A 336 112.289 117.431 72.688 1.00 34.54 C ATOM 2614 CD1 TYR A 336 113.672 117.477 72.539 1.00 34.54 C ATOM 2615 CD2 TYR A 336 111.659 116.201 72.562 1.00 34.54 C ATOM 2616 CE1 TYR A 336 114.398 116.335 72.266 1.00 34.54 C ATOM 2617 CE2 TYR A 336 112.379 115.055 72.292 1.00 34.54 C ATOM 2618 CZ TYR A 336 113.745 115.129 72.146 1.00 34.54 C ATOM 2619 OH TYR A 336 114.462 113.988 71.877 1.00 34.54 O ATOM 2620 N PHE A 337 110.259 118.513 70.011 1.00 35.57 N ATOM 2621 CA PHE A 337 110.243 117.808 68.732 1.00 35.57 C ATOM 2622 C PHE A 337 110.479 118.744 67.552 1.00 35.57 C ATOM 2623 O PHE A 337 111.117 118.341 66.568 1.00 35.57 O ATOM 2624 CB PHE A 337 108.937 117.042 68.567 1.00 35.57 C ATOM 2625 CG PHE A 337 108.970 115.694 69.204 1.00 35.57 C ATOM 2626 CD1 PHE A 337 109.755 114.689 68.670 1.00 35.57 C ATOM 2627 CD2 PHE A 337 108.250 115.439 70.353 1.00 35.57 C ATOM 2628 CE1 PHE A 337 109.803 113.452 69.262 1.00 35.57 C ATOM 2629 CE2 PHE A 337 108.298 114.206 70.950 1.00 35.57 C ATOM 2630 CZ PHE A 337 109.072 113.213 70.404 1.00 35.57 C ATOM 2631 N ASP A 338 110.010 119.993 67.643 1.00 42.19 N ATOM 2632 CA ASP A 338 110.365 120.984 66.629 1.00 42.19 C ATOM 2633 C ASP A 338 111.860 121.285 66.651 1.00 42.19 C ATOM 2634 O ASP A 338 112.483 121.454 65.595 1.00 42.19 O ATOM 2635 CB ASP A 338 109.554 122.261 66.835 1.00 42.19 C ATOM 2636 CG ASP A 338 108.082 122.067 66.539 1.00 42.19 C ATOM 2637 OD1 ASP A 338 107.726 121.023 65.954 1.00 42.19 O ATOM 2638 OD2 ASP A 338 107.281 122.958 66.891 1.00 42.19 O ATOM 2639 N MET A 339 112.458 121.319 67.847 1.00 49.87 N ATOM 2640 CA MET A 339 113.904 121.488 67.961 1.00 49.87 C ATOM 2641 C MET A 339 114.660 120.287 67.400 1.00 49.87 C ATOM 2642 O MET A 339 115.727 120.453 66.802 1.00 49.87 O ATOM 2643 CB MET A 339 114.278 121.726 69.426 1.00 49.87 C ATOM 2644 CG MET A 339 115.760 121.934 69.692 1.00 49.87 C ATOM 2645 SD MET A 339 116.066 122.983 71.123 1.00 49.87 S ATOM 2646 CE MET A 339 115.190 124.467 70.639 1.00 49.87 C ATOM 2647 N GLU A 340 114.109 119.083 67.559 1.00 49.66 N ATOM 2648 CA GLU A 340 114.733 117.883 67.008 1.00 49.66 C ATOM 2649 C GLU A 340 114.704 117.890 65.484 1.00 49.66 C ATOM 2650 O GLU A 340 115.696 117.531 64.837 1.00 49.66 O ATOM 2651 CB GLU A 340 114.031 116.639 67.552 1.00 49.66 C ATOM 2652 CG GLU A 340 114.597 115.325 67.052 1.00 49.66 C ATOM 2653 CD GLU A 340 115.732 114.820 67.913 1.00 49.66 C ATOM 2654 OE1 GLU A 340 115.767 115.170 69.110 1.00 49.66 O ATOM 2655 OE2 GLU A 340 116.589 114.075 67.395 1.00 49.66 O ATOM 2656 N VAL A 341 113.577 118.307 64.897 1.00 54.79 N ATOM 2657 CA VAL A 341 113.483 118.420 63.442 1.00 54.79 C ATOM 2658 C VAL A 341 114.414 119.515 62.919 1.00 54.79 C ATOM 2659 O VAL A 341 115.068 119.344 61.878 1.00 54.79 O ATOM 2660 CB VAL A 341 112.012 118.655 63.041 1.00 54.79 C ATOM 2661 CG1 VAL A 341 111.876 119.021 61.569 1.00 54.79 C ATOM 2662 CG2 VAL A 341 111.188 117.417 63.349 1.00 54.79 C ATOM 2663 N TRP A 342 114.534 120.626 63.656 1.00 61.06 N ATOM 2664 CA TRP A 342 115.467 121.688 63.285 1.00 61.06 C ATOM 2665 C TRP A 342 116.920 121.228 63.360 1.00 61.06 C ATOM 2666 O TRP A 342 117.722 121.569 62.482 1.00 61.06 O ATOM 2667 CB TRP A 342 115.232 122.902 64.186 1.00 61.06 C ATOM 2668 CG TRP A 342 116.278 123.970 64.110 1.00 61.06 C ATOM 2669 CD1 TRP A 342 116.301 125.032 63.257 1.00 61.06 C ATOM 2670 CD2 TRP A 342 117.433 124.101 64.947 1.00 61.06 C ATOM 2671 NE1 TRP A 342 117.409 125.808 63.496 1.00 61.06 N ATOM 2672 CE2 TRP A 342 118.121 125.257 64.529 1.00 61.06 C ATOM 2673 CE3 TRP A 342 117.960 123.345 65.998 1.00 61.06 C ATOM 2674 CZ2 TRP A 342 119.305 125.678 65.129 1.00 61.06 C ATOM 2675 CZ3 TRP A 342 119.134 123.764 66.593 1.00 61.06 C ATOM 2676 CH2 TRP A 342 119.795 124.919 66.156 1.00 61.06 C ATOM 2677 N ALA A 343 117.271 120.434 64.373 1.00 62.30 N ATOM 2678 CA ALA A 343 118.628 119.910 64.476 1.00 62.30 C ATOM 2679 C ALA A 343 118.919 118.855 63.418 1.00 62.30 C ATOM 2680 O ALA A 343 120.055 118.762 62.942 1.00 62.30 O ATOM 2681 CB ALA A 343 118.868 119.330 65.869 1.00 62.30 C ATOM 2682 N LEU A 344 117.914 118.071 63.021 1.00 66.51 N ATOM 2683 CA LEU A 344 118.099 117.135 61.917 1.00 66.51 C ATOM 2684 C LEU A 344 118.294 117.857 60.589 1.00 66.51 C ATOM 2685 O LEU A 344 119.119 117.433 59.771 1.00 66.51 O ATOM 2686 CB LEU A 344 116.909 116.180 61.827 1.00 66.51 C ATOM 2687 CG LEU A 344 117.110 114.949 60.945 1.00 66.51 C ATOM 2688 CD1 LEU A 344 118.210 114.067 61.511 1.00 66.51 C ATOM 2689 CD2 LEU A 344 115.812 114.172 60.806 1.00 66.51 C ATOM 2690 N GLY A 345 117.567 118.956 60.369 1.00 71.15 N ATOM 2691 CA GLY A 345 117.811 119.772 59.190 1.00 71.15 C ATOM 2692 C GLY A 345 119.166 120.452 59.204 1.00 71.15 C ATOM 2693 O GLY A 345 119.809 120.586 58.157 1.00 71.15 O ATOM 2694 N LEU A 346 119.626 120.877 60.386 1.00 72.14 N ATOM 2695 CA LEU A 346 120.967 121.442 60.509 1.00 72.14 C ATOM 2696 C LEU A 346 122.046 120.394 60.269 1.00 72.14 C ATOM 2697 O LEU A 346 123.115 120.717 59.739 1.00 72.14 O ATOM 2698 CB LEU A 346 121.143 122.073 61.889 1.00 72.14 C ATOM 2699 CG LEU A 346 122.029 123.314 61.967 1.00 72.14 C ATOM 2700 CD1 LEU A 346 121.549 124.372 60.988 1.00 72.14 C ATOM 2701 CD2 LEU A 346 122.058 123.861 63.385 1.00 72.14 C ATOM 2702 N HIS A 347 121.789 119.142 60.656 1.00 77.99 N ATOM 2703 CA HIS A 347 122.712 118.058 60.337 1.00 77.99 C ATOM 2704 C HIS A 347 122.710 117.749 58.846 1.00 77.99 C ATOM 2705 O HIS A 347 123.759 117.426 58.278 1.00 77.99 O ATOM 2706 CB HIS A 347 122.351 116.815 61.153 1.00 77.99 C ATOM 2707 CG HIS A 347 122.787 115.524 60.531 1.00 77.99 C ATOM 2708 ND1 HIS A 347 124.066 115.028 60.664 1.00 77.99 N ATOM 2709 CD2 HIS A 347 122.107 114.616 59.790 1.00 77.99 C ATOM 2710 CE1 HIS A 347 124.159 113.877 60.022 1.00 77.99 C ATOM 2711 NE2 HIS A 347 122.984 113.605 59.482 1.00 77.99 N ATOM 2712 N GLU A 348 121.546 117.850 58.201 1.00 80.18 N ATOM 2713 CA GLU A 348 121.469 117.700 56.752 1.00 80.18 C ATOM 2714 C GLU A 348 122.161 118.842 56.016 1.00 80.18 C ATOM 2715 O GLU A 348 122.610 118.659 54.880 1.00 80.18 O ATOM 2716 CB GLU A 348 120.007 117.611 56.312 1.00 80.18 C ATOM 2717 CG GLU A 348 119.783 116.833 55.029 1.00 80.18 C ATOM 2718 CD GLU A 348 118.332 116.444 54.832 1.00 80.18 C ATOM 2719 OE1 GLU A 348 117.738 115.866 55.765 1.00 80.18 O ATOM 2720 OE2 GLU A 348 117.783 116.719 53.744 1.00 80.18 O ATOM 2721 N ASN A 349 122.255 120.016 56.641 1.00 83.70 N ATOM 2722 CA ASN A 349 122.821 121.191 55.989 1.00 83.70 C ATOM 2723 C ASN A 349 124.347 121.217 56.048 1.00 83.70 C ATOM 2724 O ASN A 349 125.009 121.254 55.005 1.00 83.70 O ATOM 2725 CB ASN A 349 122.253 122.462 56.630 1.00 83.70 C ATOM 2726 CG ASN A 349 122.611 123.729 55.863 1.00 83.70 C ATOM 2727 OD1 ASN A 349 123.102 123.681 54.734 1.00 83.70 O ATOM 2728 ND2 ASN A 349 122.366 124.877 56.485 1.00 83.70 N ATOM 2729 N SER A 350 124.916 121.199 57.255 1.00 85.46 N ATOM 2730 CA SER A 350 126.282 121.675 57.452 1.00 85.46 C ATOM 2731 C SER A 350 127.369 120.692 57.027 1.00 85.46 C ATOM 2732 O SER A 350 128.133 120.977 56.100 1.00 85.46 O ATOM 2733 CB SER A 350 126.489 122.051 58.921 1.00 85.46 C