>>6R7Z:HELIX   37 AE1 LEU B  392  VAL B  422  1                                  31    
LESAYQNHLILKVLVFNFLNCFASLFYIAFV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 37 AE1 LEU B 392 VAL B 422 1 31 ATOM 5447 N LEU B 392 87.486 62.055 99.827 1.00193.13 N ATOM 5448 CA LEU B 392 86.144 62.364 100.288 1.00193.13 C ATOM 5449 C LEU B 392 85.127 61.634 99.424 1.00193.13 C ATOM 5450 O LEU B 392 85.481 60.962 98.452 1.00193.13 O ATOM 5451 CB LEU B 392 85.881 63.869 100.242 1.00193.13 C ATOM 5452 N GLU B 393 83.851 61.786 99.775 1.00192.37 N ATOM 5453 CA GLU B 393 82.806 61.256 98.912 1.00192.37 C ATOM 5454 C GLU B 393 82.341 62.268 97.880 1.00192.37 C ATOM 5455 O GLU B 393 81.889 61.873 96.803 1.00192.37 O ATOM 5456 CB GLU B 393 81.619 60.786 99.751 1.00192.37 C ATOM 5457 N SER B 394 82.455 63.567 98.181 1.00199.45 N ATOM 5458 CA SER B 394 82.048 64.587 97.219 1.00199.45 C ATOM 5459 C SER B 394 82.957 64.608 96.002 1.00199.45 C ATOM 5460 O SER B 394 82.483 64.765 94.872 1.00199.45 O ATOM 5461 CB SER B 394 82.026 65.957 97.892 1.00199.45 C ATOM 5462 N ALA B 395 84.262 64.439 96.214 1.00205.96 N ATOM 5463 CA ALA B 395 85.195 64.412 95.097 1.00205.96 C ATOM 5464 C ALA B 395 85.009 63.143 94.292 1.00205.96 C ATOM 5465 O ALA B 395 85.087 63.163 93.058 1.00205.96 O ATOM 5466 CB ALA B 395 86.630 64.523 95.604 1.00205.96 C ATOM 5467 N TYR B 396 84.769 62.038 94.996 1.00198.06 N ATOM 5468 CA TYR B 396 84.492 60.762 94.358 1.00198.06 C ATOM 5469 C TYR B 396 83.195 60.831 93.567 1.00198.06 C ATOM 5470 O TYR B 396 83.108 60.319 92.445 1.00198.06 O ATOM 5471 CB TYR B 396 84.439 59.690 95.445 1.00198.06 C ATOM 5472 CG TYR B 396 83.756 58.400 95.086 1.00198.06 C ATOM 5473 CD1 TYR B 396 84.354 57.484 94.231 1.00198.06 C ATOM 5474 CD2 TYR B 396 82.524 58.078 95.640 1.00198.06 C ATOM 5475 CE1 TYR B 396 83.732 56.292 93.918 1.00198.06 C ATOM 5476 CE2 TYR B 396 81.895 56.891 95.336 1.00198.06 C ATOM 5477 CZ TYR B 396 82.503 56.003 94.474 1.00198.06 C ATOM 5478 OH TYR B 396 81.879 54.818 94.167 1.00198.06 O ATOM 5479 N GLN B 397 82.170 61.460 94.147 1.00191.92 N ATOM 5480 CA GLN B 397 80.912 61.643 93.435 1.00191.92 C ATOM 5481 C GLN B 397 81.063 62.583 92.249 1.00191.92 C ATOM 5482 O GLN B 397 80.470 62.337 91.197 1.00191.92 O ATOM 5483 CB GLN B 397 79.827 62.170 94.371 1.00191.92 C ATOM 5484 N ASN B 398 81.890 63.627 92.386 1.00183.18 N ATOM 5485 CA ASN B 398 82.089 64.583 91.298 1.00183.18 C ATOM 5486 C ASN B 398 82.807 63.955 90.116 1.00183.18 C ATOM 5487 O ASN B 398 82.464 64.223 88.959 1.00183.18 O ATOM 5488 CB ASN B 398 82.872 65.795 91.803 1.00183.18 C ATOM 5489 N HIS B 399 83.816 63.129 90.385 1.00189.85 N ATOM 5490 CA HIS B 399 84.522 62.466 89.296 1.00189.85 C ATOM 5491 C HIS B 399 83.620 61.452 88.615 1.00189.85 C ATOM 5492 O HIS B 399 83.645 61.319 87.385 1.00189.85 O ATOM 5493 CB HIS B 399 85.804 61.824 89.812 1.00189.85 C ATOM 5494 CG HIS B 399 86.891 62.815 90.080 1.00189.85 C ATOM 5495 ND1 HIS B 399 86.767 63.816 91.018 1.00189.85 N ATOM 5496 CD2 HIS B 399 88.111 62.975 89.517 1.00189.85 C ATOM 5497 CE1 HIS B 399 87.869 64.545 91.029 1.00189.85 C ATOM 5498 NE2 HIS B 399 88.701 64.055 90.128 1.00189.85 N ATOM 5499 N LEU B 400 82.829 60.723 89.406 1.00174.93 N ATOM 5500 CA LEU B 400 81.883 59.773 88.836 1.00174.93 C ATOM 5501 C LEU B 400 80.812 60.504 88.044 1.00174.93 C ATOM 5502 O LEU B 400 80.380 60.029 86.987 1.00174.93 O ATOM 5503 CB LEU B 400 81.255 58.935 89.946 1.00174.93 C ATOM 5504 N ILE B 401 80.367 61.654 88.554 1.00168.96 N ATOM 5505 CA ILE B 401 79.391 62.466 87.840 1.00168.96 C ATOM 5506 C ILE B 401 79.995 63.005 86.556 1.00168.96 C ATOM 5507 O ILE B 401 79.325 63.059 85.525 1.00168.96 O ATOM 5508 CB ILE B 401 78.861 63.607 88.724 1.00168.96 C ATOM 5509 N LEU B 402 81.283 63.362 86.591 1.00157.19 N ATOM 5510 CA LEU B 402 81.965 63.872 85.405 1.00157.19 C ATOM 5511 C LEU B 402 82.076 62.801 84.332 1.00157.19 C ATOM 5512 O LEU B 402 81.835 63.067 83.148 1.00157.19 O ATOM 5513 CB LEU B 402 83.350 64.393 85.786 1.00157.19 C ATOM 5514 N LYS B 403 82.475 61.594 84.729 1.00157.55 N ATOM 5515 CA LYS B 403 82.605 60.491 83.786 1.00157.55 C ATOM 5516 C LYS B 403 81.256 60.129 83.178 1.00157.55 C ATOM 5517 O LYS B 403 81.136 59.980 81.956 1.00157.55 O ATOM 5518 CB LYS B 403 83.226 59.281 84.482 1.00157.55 C ATOM 5519 N VAL B 404 80.230 60.001 84.020 1.00172.44 N ATOM 5520 CA VAL B 404 78.913 59.577 83.558 1.00172.44 C ATOM 5521 C VAL B 404 78.242 60.658 82.721 1.00172.44 C ATOM 5522 O VAL B 404 77.528 60.349 81.762 1.00172.44 O ATOM 5523 CB VAL B 404 78.040 59.173 84.756 1.00172.44 C ATOM 5524 N LEU B 405 78.477 61.932 83.045 1.00175.66 N ATOM 5525 CA LEU B 405 77.877 63.017 82.268 1.00175.66 C ATOM 5526 C LEU B 405 78.489 63.086 80.884 1.00175.66 C ATOM 5527 O LEU B 405 77.783 63.330 79.900 1.00175.66 O ATOM 5528 CB LEU B 405 78.031 64.365 82.966 1.00175.66 C ATOM 5529 N VAL B 406 79.803 62.889 80.805 1.00172.41 N ATOM 5530 CA VAL B 406 80.509 62.927 79.531 1.00172.41 C ATOM 5531 C VAL B 406 80.026 61.799 78.633 1.00172.41 C ATOM 5532 O VAL B 406 79.753 62.005 77.445 1.00172.41 O ATOM 5533 CB VAL B 406 82.027 62.853 79.761 1.00172.41 C ATOM 5534 N PHE B 407 79.913 60.593 79.185 1.00191.59 N ATOM 5535 CA PHE B 407 79.469 59.465 78.378 1.00191.59 C ATOM 5536 C PHE B 407 77.996 59.588 78.005 1.00191.59 C ATOM 5537 O PHE B 407 77.597 59.212 76.899 1.00191.59 O ATOM 5538 CB PHE B 407 79.717 58.167 79.140 1.00191.59 C ATOM 5539 CG PHE B 407 79.318 56.941 78.386 1.00191.59 C ATOM 5540 CD1 PHE B 407 80.109 56.463 77.357 1.00191.59 C ATOM 5541 CD2 PHE B 407 78.150 56.264 78.703 1.00191.59 C ATOM 5542 CE1 PHE B 407 79.746 55.332 76.655 1.00191.59 C ATOM 5543 CE2 PHE B 407 77.778 55.136 78.002 1.00191.59 C ATOM 5544 CZ PHE B 407 78.578 54.667 76.980 1.00191.59 C ATOM 5545 N ASN B 408 77.174 60.138 78.900 1.00174.57 N ATOM 5546 CA ASN B 408 75.751 60.231 78.589 1.00174.57 C ATOM 5547 C ASN B 408 75.455 61.346 77.598 1.00174.57 C ATOM 5548 O ASN B 408 74.563 61.196 76.760 1.00174.57 O ATOM 5549 CB ASN B 408 74.933 60.439 79.858 1.00174.57 C ATOM 5550 N PHE B 409 76.187 62.460 77.688 1.00157.70 N ATOM 5551 CA PHE B 409 76.100 63.516 76.682 1.00157.70 C ATOM 5552 C PHE B 409 76.494 62.985 75.317 1.00157.70 C ATOM 5553 O PHE B 409 75.805 63.228 74.318 1.00157.70 O ATOM 5554 CB PHE B 409 76.982 64.701 77.070 1.00157.70 C ATOM 5555 N LEU B 410 77.621 62.274 75.265 1.00171.10 N ATOM 5556 CA LEU B 410 78.126 61.746 74.007 1.00171.10 C ATOM 5557 C LEU B 410 77.177 60.701 73.444 1.00171.10 C ATOM 5558 O LEU B 410 76.842 60.737 72.259 1.00171.10 O ATOM 5559 CB LEU B 410 79.518 61.153 74.216 1.00171.10 C ATOM 5560 N ASN B 411 76.711 59.778 74.285 1.00159.64 N ATOM 5561 CA ASN B 411 75.857 58.713 73.780 1.00159.64 C ATOM 5562 C ASN B 411 74.481 59.220 73.378 1.00159.64 C ATOM 5563 O ASN B 411 73.847 58.622 72.505 1.00159.64 O ATOM 5564 CB ASN B 411 75.702 57.607 74.821 1.00159.64 C ATOM 5565 N CYS B 412 74.013 60.312 73.974 1.00148.33 N ATOM 5566 CA CYS B 412 72.712 60.841 73.591 1.00148.33 C ATOM 5567 C CYS B 412 72.753 61.814 72.421 1.00148.33 C ATOM 5568 O CYS B 412 71.883 61.755 71.548 1.00148.33 O ATOM 5569 CB CYS B 412 72.050 61.538 74.778 1.00148.33 C ATOM 5570 N PHE B 413 73.746 62.695 72.356 1.00172.15 N ATOM 5571 CA PHE B 413 73.718 63.759 71.363 1.00172.15 C ATOM 5572 C PHE B 413 74.649 63.574 70.175 1.00172.15 C ATOM 5573 O PHE B 413 74.779 64.508 69.376 1.00172.15 O ATOM 5574 CB PHE B 413 74.036 65.095 72.043 1.00172.15 C ATOM 5575 N ALA B 414 75.300 62.418 70.025 1.00200.83 N ATOM 5576 CA ALA B 414 76.206 62.251 68.890 1.00200.83 C ATOM 5577 C ALA B 414 75.441 62.140 67.583 1.00200.83 C ATOM 5578 O ALA B 414 75.846 62.716 66.566 1.00200.83 O ATOM 5579 CB ALA B 414 77.087 61.018 69.072 1.00200.83 C ATOM 5580 N SER B 415 74.328 61.408 67.599 1.00202.92 N ATOM 5581 CA SER B 415 73.521 61.251 66.398 1.00202.92 C ATOM 5582 C SER B 415 72.849 62.556 66.008 1.00202.92 C ATOM 5583 O SER B 415 72.718 62.862 64.817 1.00202.92 O ATOM 5584 CB SER B 415 72.477 60.158 66.615 1.00202.92 C ATOM 5585 N LEU B 416 72.438 63.350 66.996 1.00211.19 N ATOM 5586 CA LEU B 416 71.826 64.630 66.673 1.00211.19 C ATOM 5587 C LEU B 416 72.854 65.625 66.163 1.00211.19 C ATOM 5588 O LEU B 416 72.548 66.441 65.289 1.00211.19 O ATOM 5589 CB LEU B 416 71.113 65.188 67.903 1.00211.19 C ATOM 5590 N PHE B 417 74.081 65.567 66.680 1.00221.68 N ATOM 5591 CA PHE B 417 75.126 66.418 66.131 1.00221.68 C ATOM 5592 C PHE B 417 75.537 65.965 64.738 1.00221.68 C ATOM 5593 O PHE B 417 75.803 66.802 63.867 1.00221.68 O ATOM 5594 CB PHE B 417 76.333 66.433 67.065 1.00221.68 C ATOM 5595 N TYR B 418 75.572 64.651 64.509 1.00229.64 N ATOM 5596 CA TYR B 418 75.892 64.121 63.189 1.00229.64 C ATOM 5597 C TYR B 418 74.792 64.392 62.176 1.00229.64 C ATOM 5598 O TYR B 418 75.078 64.570 60.989 1.00229.64 O ATOM 5599 CB TYR B 418 76.165 62.622 63.276 1.00229.64 C ATOM 5600 N ILE B 419 73.535 64.419 62.613 1.00243.18 N ATOM 5601 CA ILE B 419 72.459 64.758 61.690 1.00243.18 C ATOM 5602 C ILE B 419 72.488 66.243 61.366 1.00243.18 C ATOM 5603 O ILE B 419 72.345 66.645 60.205 1.00243.18 O ATOM 5604 CB ILE B 419 71.100 64.337 62.274 1.00243.18 C ATOM 5605 N ALA B 420 72.683 67.078 62.385 1.00256.33 N ATOM 5606 CA ALA B 420 72.551 68.514 62.192 1.00256.33 C ATOM 5607 C ALA B 420 73.733 69.123 61.460 1.00256.33 C ATOM 5608 O ALA B 420 73.542 70.042 60.659 1.00256.33 O ATOM 5609 CB ALA B 420 72.379 69.216 63.536 1.00256.33 C ATOM 5610 N PHE B 421 74.945 68.629 61.699 1.00272.83 N ATOM 5611 CA PHE B 421 76.122 69.310 61.190 1.00272.83 C ATOM 5612 C PHE B 421 76.910 68.524 60.157 1.00272.83 C ATOM 5613 O PHE B 421 77.892 69.056 59.632 1.00272.83 O ATOM 5614 CB PHE B 421 77.062 69.675 62.347 1.00272.83 C ATOM 5615 N VAL B 422 76.520 67.293 59.841 1.00281.62 N ATOM 5616 CA VAL B 422 77.187 66.525 58.805 1.00281.62 C ATOM 5617 C VAL B 422 76.240 66.158 57.671 1.00281.62 C ATOM 5618 O VAL B 422 76.517 66.468 56.511 1.00281.62 O ATOM 5619 CB VAL B 422 77.856 65.264 59.392 1.00281.62 C