>>6RZ5:HELIX   17 AB8 THR B   17  LYS B   50  1                                  34    
TIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 17 AB8 THR B 17 LYS B 50 1 34 ATOM 2745 N THR B 17 -3.069 -23.177 -32.774 1.00137.35 N ANISOU 2745 N THR B 17 16763 17200 18222 678 -1051 -2015 N ATOM 2746 CA THR B 17 -2.377 -24.372 -32.287 1.00135.89 C ANISOU 2746 CA THR B 17 16550 16996 18087 780 -1034 -2057 C ATOM 2747 C THR B 17 -2.658 -24.476 -30.770 1.00137.19 C ANISOU 2747 C THR B 17 16676 17064 18386 753 -1013 -1968 C ATOM 2748 O THR B 17 -2.200 -25.418 -30.113 1.00137.03 O ANISOU 2748 O THR B 17 16626 17007 18431 822 -1001 -1981 O ATOM 2749 CB THR B 17 -0.854 -24.378 -32.677 1.00140.85 C ANISOU 2749 CB THR B 17 17140 17811 18566 843 -965 -2090 C ATOM 2750 OG1 THR B 17 -0.029 -24.627 -31.534 1.00138.03 O ANISOU 2750 OG1 THR B 17 16721 17485 18239 861 -902 -2030 O ATOM 2751 CG2 THR B 17 -0.390 -23.099 -33.369 1.00138.41 C ANISOU 2751 CG2 THR B 17 16828 17669 18093 779 -932 -2063 C ATOM 2752 N ILE B 18 -3.442 -23.511 -30.232 1.00131.30 N ANISOU 2752 N ILE B 18 15933 16276 17679 655 -1012 -1878 N ATOM 2753 CA ILE B 18 -3.752 -23.424 -28.807 1.00130.09 C ANISOU 2753 CA ILE B 18 15747 16046 17635 619 -987 -1784 C ATOM 2754 C ILE B 18 -4.928 -24.302 -28.380 1.00131.70 C ANISOU 2754 C ILE B 18 15964 16065 18011 632 -1051 -1783 C ATOM 2755 O ILE B 18 -4.897 -24.814 -27.263 1.00131.48 O ANISOU 2755 O ILE B 18 15901 15976 18080 646 -1033 -1733 O ATOM 2756 CB ILE B 18 -3.946 -21.955 -28.356 1.00133.08 C ANISOU 2756 CB ILE B 18 16123 16477 17964 517 -953 -1688 C ATOM 2757 N ASP B 19 -5.953 -24.471 -29.250 1.00126.20 N ANISOU 2757 N ASP B 19 15316 15282 17352 623 -1129 -1830 N ATOM 2758 CA ASP B 19 -7.193 -25.227 -28.989 1.00124.97 C ANISOU 2758 CA ASP B 19 15174 14949 17359 625 -1204 -1820 C ATOM 2759 C ASP B 19 -6.995 -26.608 -28.321 1.00125.01 C ANISOU 2759 C ASP B 19 15153 14868 17479 700 -1224 -1834 C ATOM 2760 O ASP B 19 -7.703 -26.908 -27.357 1.00124.60 O ANISOU 2760 O ASP B 19 15075 14711 17558 678 -1237 -1762 O ATOM 2761 CB ASP B 19 -8.037 -25.356 -30.269 1.00127.19 C ANISOU 2761 CB ASP B 19 15517 15168 17641 621 -1292 -1889 C ATOM 2762 CG ASP B 19 -8.693 -24.056 -30.728 1.00141.64 C ANISOU 2762 CG ASP B 19 17374 17029 19415 530 -1296 -1852 C ATOM 2763 OD1 ASP B 19 -8.161 -22.968 -30.403 1.00142.73 O ANISOU 2763 OD1 ASP B 19 17487 17268 19474 477 -1227 -1791 O ATOM 2764 OD2 ASP B 19 -9.734 -24.128 -31.419 1.00149.42 O ANISOU 2764 OD2 ASP B 19 18405 17933 20435 509 -1373 -1884 O ATOM 2765 N ASP B 20 -6.032 -27.421 -28.794 1.00118.47 N ANISOU 2765 N ASP B 20 14328 14087 16600 788 -1226 -1923 N ATOM 2766 CA ASP B 20 -5.771 -28.728 -28.180 1.00117.16 C ANISOU 2766 CA ASP B 20 14136 13839 16540 861 -1250 -1940 C ATOM 2767 C ASP B 20 -4.992 -28.604 -26.866 1.00115.70 C ANISOU 2767 C ASP B 20 13887 13712 16362 856 -1165 -1864 C ATOM 2768 O ASP B 20 -5.224 -29.389 -25.946 1.00114.48 O ANISOU 2768 O ASP B 20 13701 13461 16333 873 -1183 -1826 O ATOM 2769 CB ASP B 20 -5.109 -29.711 -29.161 1.00120.01 C ANISOU 2769 CB ASP B 20 14530 14210 16857 967 -1296 -2067 C ATOM 2770 CG ASP B 20 -3.828 -29.206 -29.787 1.00138.44 C ANISOU 2770 CG ASP B 20 16856 16728 19019 1009 -1221 -2121 C ATOM 2771 OD1 ASP B 20 -3.911 -28.393 -30.736 1.00140.15 O ANISOU 2771 OD1 ASP B 20 17102 17033 19115 976 -1210 -2145 O ATOM 2772 OD2 ASP B 20 -2.739 -29.635 -29.338 1.00147.33 O ANISOU 2772 OD2 ASP B 20 17941 17908 20129 1073 -1178 -2136 O ATOM 2773 N PHE B 21 -4.089 -27.606 -26.774 1.00109.31 N ANISOU 2773 N PHE B 21 13057 13056 15420 828 -1078 -1837 N ATOM 2774 CA PHE B 21 -3.298 -27.309 -25.573 1.00107.54 C ANISOU 2774 CA PHE B 21 12778 12898 15185 813 -996 -1759 C ATOM 2775 C PHE B 21 -4.228 -26.846 -24.423 1.00106.85 C ANISOU 2775 C PHE B 21 12674 12725 15199 739 -988 -1647 C ATOM 2776 O PHE B 21 -4.080 -27.342 -23.301 1.00106.89 O ANISOU 2776 O PHE B 21 12640 12689 15286 751 -967 -1595 O ATOM 2777 CB PHE B 21 -2.205 -26.256 -25.882 1.00109.22 C ANISOU 2777 CB PHE B 21 12981 13291 15228 790 -921 -1749 C ATOM 2778 CG PHE B 21 -1.634 -25.529 -24.685 1.00110.60 C ANISOU 2778 CG PHE B 21 13113 13527 15382 741 -846 -1646 C ATOM 2779 CD1 PHE B 21 -0.551 -26.047 -23.989 1.00113.25 C ANISOU 2779 CD1 PHE B 21 13403 13909 15718 787 -801 -1634 C ATOM 2780 CD2 PHE B 21 -2.179 -24.321 -24.256 1.00112.71 C ANISOU 2780 CD2 PHE B 21 13391 13801 15632 650 -826 -1562 C ATOM 2781 CE1 PHE B 21 -0.022 -25.373 -22.885 1.00114.10 C ANISOU 2781 CE1 PHE B 21 13479 14068 15808 739 -738 -1537 C ATOM 2782 CE2 PHE B 21 -1.667 -23.663 -23.132 1.00115.26 C ANISOU 2782 CE2 PHE B 21 13686 14171 15937 609 -766 -1469 C ATOM 2783 CZ PHE B 21 -0.587 -24.189 -22.460 1.00113.16 C ANISOU 2783 CZ PHE B 21 13376 13949 15669 652 -723 -1456 C ATOM 2784 N ARG B 22 -5.148 -25.868 -24.709 1.00 98.42 N ANISOU 2784 N ARG B 22 11636 11640 14121 666 -1002 -1611 N ATOM 2785 CA ARG B 22 -6.155 -25.316 -23.788 1.00 96.21 C ANISOU 2785 CA ARG B 22 11346 11285 13925 600 -995 -1511 C ATOM 2786 C ARG B 22 -6.939 -26.473 -23.166 1.00 96.87 C ANISOU 2786 C ARG B 22 11409 11221 14177 628 -1047 -1490 C ATOM 2787 O ARG B 22 -6.968 -26.603 -21.947 1.00 95.16 O ANISOU 2787 O ARG B 22 11152 10975 14028 619 -1014 -1413 O ATOM 2788 CB ARG B 22 -7.157 -24.409 -24.542 1.00 95.32 C ANISOU 2788 CB ARG B 22 11274 11155 13789 537 -1028 -1504 C ATOM 2789 CG ARG B 22 -6.644 -23.036 -24.948 1.00103.61 C ANISOU 2789 CG ARG B 22 12341 12337 14689 485 -982 -1492 C ATOM 2790 CD ARG B 22 -7.571 -22.342 -25.929 1.00109.98 C ANISOU 2790 CD ARG B 22 13192 13122 15473 433 -1030 -1507 C ATOM 2791 NE ARG B 22 -8.790 -21.850 -25.286 1.00123.02 N ANISOU 2791 NE ARG B 22 14843 14678 17220 381 -1043 -1427 N ATOM 2792 CZ ARG B 22 -9.563 -20.882 -25.773 1.00140.51 C ANISOU 2792 CZ ARG B 22 17089 16881 19417 321 -1069 -1409 C ATOM 2793 NH1 ARG B 22 -10.647 -20.495 -25.114 1.00124.95 N ANISOU 2793 NH1 ARG B 22 15111 14826 17539 285 -1076 -1334 N ATOM 2794 NH2 ARG B 22 -9.252 -20.286 -26.919 1.00131.53 N ANISOU 2794 NH2 ARG B 22 15987 15820 18169 297 -1089 -1463 N ATOM 2795 N ASN B 23 -7.520 -27.347 -24.029 1.00 92.53 N ANISOU 2795 N ASN B 23 10886 10580 13690 663 -1135 -1559 N ATOM 2796 CA ASN B 23 -8.326 -28.515 -23.663 1.00 91.64 C ANISOU 2796 CA ASN B 23 10760 10318 13740 688 -1209 -1544 C ATOM 2797 C ASN B 23 -7.557 -29.583 -22.853 1.00 93.60 C ANISOU 2797 C ASN B 23 10967 10550 14048 747 -1200 -1545 C ATOM 2798 O ASN B 23 -8.184 -30.260 -22.029 1.00 92.14 O ANISOU 2798 O ASN B 23 10749 10260 13999 742 -1232 -1482 O ATOM 2799 CB ASN B 23 -8.982 -29.129 -24.908 1.00 92.81 C ANISOU 2799 CB ASN B 23 10959 10382 13921 713 -1313 -1627 C ATOM 2800 CG ASN B 23 -10.063 -28.286 -25.562 1.00122.89 C ANISOU 2800 CG ASN B 23 14805 14166 17723 647 -1343 -1607 C ATOM 2801 OD1 ASN B 23 -10.890 -27.656 -24.904 1.00119.13 O ANISOU 2801 OD1 ASN B 23 14306 13657 17299 586 -1324 -1513 O ATOM 2802 ND2 ASN B 23 -10.106 -28.282 -26.887 1.00118.30 N ANISOU 2802 ND2 ASN B 23 14279 13594 17074 662 -1395 -1697 N ATOM 2803 N GLN B 24 -6.208 -29.716 -23.073 1.00 88.96 N ANISOU 2803 N GLN B 24 10375 10068 13359 800 -1155 -1608 N ATOM 2804 CA GLN B 24 -5.355 -30.693 -22.379 1.00 88.27 C ANISOU 2804 CA GLN B 24 10249 9976 13316 860 -1144 -1617 C ATOM 2805 C GLN B 24 -4.909 -30.226 -20.986 1.00 90.93 C ANISOU 2805 C GLN B 24 10534 10360 13656 822 -1059 -1515 C ATOM 2806 O GLN B 24 -5.048 -30.974 -20.008 1.00 90.63 O ANISOU 2806 O GLN B 24 10458 10246 13731 831 -1073 -1465 O ATOM 2807 CB GLN B 24 -4.143 -31.089 -23.243 1.00 89.55 C ANISOU 2807 CB GLN B 24 10425 10229 13372 940 -1136 -1728 C ATOM 2808 N VAL B 25 -4.371 -28.990 -20.906 1.00 85.80 N ANISOU 2808 N VAL B 25 9886 9834 12880 778 -978 -1482 N ATOM 2809 CA VAL B 25 -3.881 -28.367 -19.670 1.00 84.27 C ANISOU 2809 CA VAL B 25 9658 9697 12665 739 -898 -1388 C ATOM 2810 C VAL B 25 -5.062 -28.054 -18.743 1.00 84.38 C ANISOU 2810 C VAL B 25 9661 9623 12778 682 -901 -1288 C ATOM 2811 O VAL B 25 -5.004 -28.391 -17.557 1.00 84.30 O ANISOU 2811 O VAL B 25 9613 9582 12836 678 -876 -1218 O ATOM 2812 CB VAL B 25 -2.970 -27.133 -19.960 1.00 87.98 C ANISOU 2812 CB VAL B 25 10140 10320 12969 708 -827 -1383 C ATOM 2813 CG1 VAL B 25 -2.562 -26.406 -18.678 1.00 87.74 C ANISOU 2813 CG1 VAL B 25 10084 10335 12917 661 -755 -1281 C ATOM 2814 CG2 VAL B 25 -1.730 -27.546 -20.746 1.00 87.60 C ANISOU 2814 CG2 VAL B 25 10087 10370 12828 772 -815 -1469 C ATOM 2815 N TYR B 26 -6.142 -27.467 -19.301 1.00 77.91 N ANISOU 2815 N TYR B 26 8873 8764 11966 641 -933 -1281 N ATOM 2816 CA TYR B 26 -7.348 -27.140 -18.547 1.00 77.31 C ANISOU 2816 CA TYR B 26 8786 8610 11979 592 -936 -1189 C ATOM 2817 C TYR B 26 -7.979 -28.351 -17.876 1.00 80.10 C ANISOU 2817 C TYR B 26 9101 8841 12494 614 -988 -1152 C ATOM 2818 O TYR B 26 -8.227 -28.286 -16.678 1.00 79.88 O ANISOU 2818 O TYR B 26 9038 8790 12523 592 -953 -1059 O ATOM 2819 CB TYR B 26 -8.378 -26.367 -19.386 1.00 78.85 C ANISOU 2819 CB TYR B 26 9020 8785 12155 550 -968 -1195 C ATOM 2820 CG TYR B 26 -8.210 -24.854 -19.404 1.00 80.70 C ANISOU 2820 CG TYR B 26 9279 9117 12265 497 -909 -1166 C ATOM 2821 CD1 TYR B 26 -7.929 -24.147 -18.237 1.00 82.40 C ANISOU 2821 CD1 TYR B 26 9479 9378 12451 470 -839 -1084 C ATOM 2822 CD2 TYR B 26 -8.402 -24.126 -20.574 1.00 81.75 C ANISOU 2822 CD2 TYR B 26 9457 9289 12315 472 -932 -1217 C ATOM 2823 CE1 TYR B 26 -7.814 -22.756 -18.242 1.00 83.33 C ANISOU 2823 CE1 TYR B 26 9627 9575 12458 422 -798 -1056 C ATOM 2824 CE2 TYR B 26 -8.296 -22.735 -20.589 1.00 82.70 C ANISOU 2824 CE2 TYR B 26 9602 9492 12329 420 -890 -1186 C ATOM 2825 CZ TYR B 26 -8.009 -22.055 -19.419 1.00 89.26 C ANISOU 2825 CZ TYR B 26 10419 10362 13134 396 -826 -1106 C ATOM 2826 OH TYR B 26 -7.946 -20.687 -19.427 1.00 90.18 O ANISOU 2826 OH TYR B 26 10566 10549 13149 345 -797 -1075 O ATOM 2827 N SER B 27 -8.161 -29.471 -18.608 1.00 76.50 N ANISOU 2827 N SER B 27 8652 8308 12106 660 -1072 -1223 N ATOM 2828 CA SER B 27 -8.712 -30.726 -18.077 1.00 75.81 C ANISOU 2828 CA SER B 27 8530 8098 12177 682 -1141 -1191 C ATOM 2829 C SER B 27 -7.883 -31.312 -16.920 1.00 76.41 C ANISOU 2829 C SER B 27 8557 8187 12287 704 -1102 -1151 C ATOM 2830 O SER B 27 -8.457 -31.717 -15.903 1.00 75.85 O ANISOU 2830 O SER B 27 8443 8049 12327 684 -1110 -1061 O ATOM 2831 CB SER B 27 -8.860 -31.763 -19.188 1.00 81.18 C ANISOU 2831 CB SER B 27 9241 8700 12904 732 -1247 -1289 C ATOM 2832 OG SER B 27 -9.959 -31.456 -20.030 1.00 95.28 O ANISOU 2832 OG SER B 27 11062 10430 14709 702 -1304 -1298 O ATOM 2833 N THR B 28 -6.543 -31.334 -17.067 1.00 70.25 N ANISOU 2833 N THR B 28 7781 7498 11412 743 -1059 -1212 N ATOM 2834 CA THR B 28 -5.632 -31.873 -16.060 1.00 69.58 C ANISOU 2834 CA THR B 28 7652 7433 11350 765 -1022 -1182 C ATOM 2835 C THR B 28 -5.661 -31.054 -14.755 1.00 72.08 C ANISOU 2835 C THR B 28 7942 7792 11651 710 -938 -1067 C ATOM 2836 O THR B 28 -6.017 -31.584 -13.693 1.00 69.80 O ANISOU 2836 O THR B 28 7612 7442 11466 699 -944 -988 O ATOM 2837 CB THR B 28 -4.221 -32.032 -16.654 1.00 77.10 C ANISOU 2837 CB THR B 28 8616 8480 12199 822 -997 -1275 C ATOM 2838 OG1 THR B 28 -4.311 -32.914 -17.771 1.00 77.30 O ANISOU 2838 OG1 THR B 28 8669 8453 12247 882 -1081 -1381 O ATOM 2839 CG2 THR B 28 -3.204 -32.582 -15.645 1.00 71.73 C ANISOU 2839 CG2 THR B 28 7889 7823 11541 846 -961 -1245 C ATOM 2840 N LEU B 29 -5.307 -29.758 -14.854 1.00 69.19 N ANISOU 2840 N LEU B 29 7603 7531 11154 676 -866 -1057 N ATOM 2841 CA LEU B 29 -5.219 -28.852 -13.714 1.00 68.79 C ANISOU 2841 CA LEU B 29 7542 7529 11064 629 -789 -960 C ATOM 2842 C LEU B 29 -6.545 -28.668 -12.964 1.00 69.68 C ANISOU 2842 C LEU B 29 7640 7566 11268 591 -794 -866 C ATOM 2843 O LEU B 29 -6.534 -28.773 -11.733 1.00 68.45 O ANISOU 2843 O LEU B 29 7452 7400 11156 579 -758 -783 O ATOM 2844 CB LEU B 29 -4.603 -27.506 -14.114 1.00 69.50 C ANISOU 2844 CB LEU B 29 7672 7739 10997 601 -730 -974 C ATOM 2845 CG LEU B 29 -3.192 -27.547 -14.723 1.00 75.08 C ANISOU 2845 CG LEU B 29 8383 8546 11600 634 -708 -1044 C ATOM 2846 CD1 LEU B 29 -2.718 -26.155 -15.049 1.00 76.07 C ANISOU 2846 CD1 LEU B 29 8543 8785 11577 594 -658 -1036 C ATOM 2847 CD2 LEU B 29 -2.186 -28.219 -13.799 1.00 76.45 C ANISOU 2847 CD2 LEU B 29 8515 8733 11799 659 -679 -1016 C ATOM 2848 N TYR B 30 -7.680 -28.456 -13.677 1.00 64.67 N ANISOU 2848 N TYR B 30 7025 6880 10668 575 -839 -874 N ATOM 2849 CA TYR B 30 -8.977 -28.334 -13.008 1.00 65.18 C ANISOU 2849 CA TYR B 30 7067 6876 10824 544 -845 -780 C ATOM 2850 C TYR B 30 -9.353 -29.622 -12.280 1.00 73.87 C ANISOU 2850 C TYR B 30 8111 7883 12073 560 -891 -730 C ATOM 2851 O TYR B 30 -9.839 -29.545 -11.151 1.00 75.07 O ANISOU 2851 O TYR B 30 8227 8019 12276 540 -858 -629 O ATOM 2852 CB TYR B 30 -10.106 -27.896 -13.955 1.00 66.02 C ANISOU 2852 CB TYR B 30 7200 6941 10942 523 -890 -796 C ATOM 2853 CG TYR B 30 -10.049 -26.457 -14.428 1.00 66.54 C ANISOU 2853 CG TYR B 30 7315 7090 10877 491 -843 -812 C ATOM 2854 CD1 TYR B 30 -9.731 -25.424 -13.549 1.00 68.24 C ANISOU 2854 CD1 TYR B 30 7538 7376 11014 467 -763 -751 C ATOM 2855 CD2 TYR B 30 -10.392 -26.118 -15.733 1.00 66.74 C ANISOU 2855 CD2 TYR B 30 7381 7116 10861 483 -886 -883 C ATOM 2856 CE1 TYR B 30 -9.689 -24.097 -13.975 1.00 66.96 C ANISOU 2856 CE1 TYR B 30 7424 7283 10735 436 -732 -763 C ATOM 2857 CE2 TYR B 30 -10.373 -24.793 -16.163 1.00 67.28 C ANISOU 2857 CE2 TYR B 30 7493 7257 10814 448 -852 -892 C ATOM 2858 CZ TYR B 30 -10.012 -23.787 -15.283 1.00 67.80 C ANISOU 2858 CZ TYR B 30 7565 7391 10805 425 -777 -832 C ATOM 2859 OH TYR B 30 -9.990 -22.484 -15.703 1.00 62.46 O ANISOU 2859 OH TYR B 30 6934 6781 10019 389 -754 -839 O ATOM 2860 N SER B 31 -9.074 -30.806 -12.891 1.00 71.87 N ANISOU 2860 N SER B 31 7852 7573 11885 600 -969 -800 N ATOM 2861 CA SER B 31 -9.316 -32.114 -12.267 1.00 71.55 C ANISOU 2861 CA SER B 31 7759 7439 11988 616 -1029 -759 C ATOM 2862 C SER B 31 -8.523 -32.251 -10.964 1.00 73.75 C ANISOU 2862 C SER B 31 8000 7758 12262 615 -966 -698 C ATOM 2863 O SER B 31 -9.092 -32.608 -9.939 1.00 72.99 O ANISOU 2863 O SER B 31 7857 7618 12259 595 -966 -598 O ATOM 2864 CB SER B 31 -8.971 -33.250 -13.224 1.00 75.56 C ANISOU 2864 CB SER B 31 8281 7887 12540 667 -1123 -861 C ATOM 2865 OG SER B 31 -9.988 -33.417 -14.199 1.00 83.81 O ANISOU 2865 OG SER B 31 9352 8858 13635 663 -1206 -892 O ATOM 2866 N MET B 32 -7.235 -31.898 -10.997 1.00 70.80 N ANISOU 2866 N MET B 32 7647 7474 11778 632 -909 -749 N ATOM 2867 CA MET B 32 -6.359 -31.915 -9.820 1.00 71.34 C ANISOU 2867 CA MET B 32 7689 7591 11827 628 -846 -696 C ATOM 2868 C MET B 32 -6.832 -30.961 -8.708 1.00 73.35 C ANISOU 2868 C MET B 32 7937 7880 12052 582 -771 -586 C ATOM 2869 O MET B 32 -6.920 -31.394 -7.554 1.00 72.76 O ANISOU 2869 O MET B 32 7820 7779 12046 571 -757 -503 O ATOM 2870 CB MET B 32 -4.928 -31.549 -10.209 1.00 74.16 C ANISOU 2870 CB MET B 32 8073 8048 12058 651 -801 -770 C ATOM 2871 CG MET B 32 -4.180 -32.661 -10.848 1.00 78.41 C ANISOU 2871 CG MET B 32 8602 8563 12628 709 -858 -860 C ATOM 2872 SD MET B 32 -2.522 -32.066 -11.181 1.00 83.77 S ANISOU 2872 SD MET B 32 9298 9377 13152 731 -787 -918 S ATOM 2873 CE MET B 32 -1.998 -33.280 -12.173 1.00 80.88 C ANISOU 2873 CE MET B 32 8933 8980 12818 807 -861 -1038 C ATOM 2874 N ILE B 33 -7.129 -29.668 -9.063 1.00 67.47 N ANISOU 2874 N ILE B 33 7238 7194 11206 557 -725 -588 N ATOM 2875 CA ILE B 33 -7.603 -28.635 -8.130 1.00 66.25 C ANISOU 2875 CA ILE B 33 7091 7073 11007 522 -656 -497 C ATOM 2876 C ILE B 33 -8.947 -29.071 -7.473 1.00 72.00 C ANISOU 2876 C ILE B 33 7772 7722 11861 511 -679 -404 C ATOM 2877 O ILE B 33 -9.101 -28.926 -6.253 1.00 73.13 O ANISOU 2877 O ILE B 33 7892 7877 12017 498 -630 -312 O ATOM 2878 CB ILE B 33 -7.645 -27.206 -8.776 1.00 67.96 C ANISOU 2878 CB ILE B 33 7369 7361 11093 502 -619 -528 C ATOM 2879 CG1 ILE B 33 -6.257 -26.751 -9.255 1.00 66.69 C ANISOU 2879 CG1 ILE B 33 7244 7291 10806 507 -592 -597 C ATOM 2880 CG2 ILE B 33 -8.214 -26.163 -7.808 1.00 67.45 C ANISOU 2880 CG2 ILE B 33 7317 7322 10987 475 -556 -437 C ATOM 2881 CD1 ILE B 33 -6.292 -25.726 -10.415 1.00 60.03 C ANISOU 2881 CD1 ILE B 33 6452 6500 9857 492 -595 -658 C ATOM 2882 N SER B 34 -9.881 -29.647 -8.263 1.00 67.14 N ANISOU 2882 N SER B 34 7142 7029 11338 515 -755 -423 N ATOM 2883 CA SER B 34 -11.167 -30.125 -7.746 1.00 66.88 C ANISOU 2883 CA SER B 34 7057 6921 11433 503 -788 -329 C ATOM 2884 C SER B 34 -11.002 -31.223 -6.679 1.00 71.94 C ANISOU 2884 C SER B 34 7635 7522 12177 506 -804 -259 C ATOM 2885 O SER B 34 -11.679 -31.156 -5.649 1.00 72.56 O ANISOU 2885 O SER B 34 7673 7596 12301 490 -772 -149 O ATOM 2886 CB SER B 34 -12.039 -30.666 -8.875 1.00 69.81 C ANISOU 2886 CB SER B 34 7426 7209 11889 506 -884 -368 C ATOM 2887 OG SER B 34 -12.251 -29.699 -9.885 1.00 79.13 O ANISOU 2887 OG SER B 34 8662 8421 12981 499 -878 -433 O ATOM 2888 N VAL B 35 -10.106 -32.225 -6.920 1.00 66.28 N ANISOU 2888 N VAL B 35 6911 6780 11494 530 -853 -321 N ATOM 2889 CA VAL B 35 -9.922 -33.338 -5.988 1.00 65.59 C ANISOU 2889 CA VAL B 35 6764 6646 11513 532 -882 -260 C ATOM 2890 C VAL B 35 -9.189 -32.866 -4.715 1.00 66.04 C ANISOU 2890 C VAL B 35 6814 6776 11502 519 -789 -199 C ATOM 2891 O VAL B 35 -9.726 -33.050 -3.623 1.00 64.01 O ANISOU 2891 O VAL B 35 6510 6505 11305 500 -770 -89 O ATOM 2892 CB VAL B 35 -9.302 -34.621 -6.635 1.00 70.33 C ANISOU 2892 CB VAL B 35 7356 7181 12183 566 -977 -344 C ATOM 2893 CG1 VAL B 35 -9.213 -35.766 -5.624 1.00 70.17 C ANISOU 2893 CG1 VAL B 35 7272 7106 12282 561 -1016 -271 C ATOM 2894 CG2 VAL B 35 -10.110 -35.079 -7.857 1.00 69.75 C ANISOU 2894 CG2 VAL B 35 7298 7027 12178 578 -1078 -399 C ATOM 2895 N VAL B 36 -8.019 -32.215 -4.853 1.00 62.34 N ANISOU 2895 N VAL B 36 6393 6386 10906 528 -732 -262 N ATOM 2896 CA VAL B 36 -7.226 -31.679 -3.723 1.00 62.24 C ANISOU 2896 CA VAL B 36 6388 6443 10818 515 -649 -210 C ATOM 2897 C VAL B 36 -8.008 -30.601 -2.903 1.00 68.47 C ANISOU 2897 C VAL B 36 7188 7270 11557 490 -577 -118 C ATOM 2898 O VAL B 36 -7.949 -30.594 -1.658 1.00 68.37 O ANISOU 2898 O VAL B 36 7153 7272 11553 477 -533 -30 O ATOM 2899 CB VAL B 36 -5.831 -31.171 -4.192 1.00 65.57 C ANISOU 2899 CB VAL B 36 6858 6942 11115 527 -614 -296 C ATOM 2900 CG1 VAL B 36 -5.056 -30.515 -3.052 1.00 65.15 C ANISOU 2900 CG1 VAL B 36 6819 6955 10979 507 -535 -236 C ATOM 2901 CG2 VAL B 36 -5.012 -32.303 -4.811 1.00 65.37 C ANISOU 2901 CG2 VAL B 36 6813 6883 11139 562 -678 -379 C ATOM 2902 N GLY B 37 -8.722 -29.724 -3.619 1.00 64.79 N ANISOU 2902 N GLY B 37 6759 6819 11040 487 -568 -143 N ATOM 2903 CA GLY B 37 -9.519 -28.652 -3.038 1.00 65.41 C ANISOU 2903 CA GLY B 37 6855 6930 11066 474 -506 -72 C ATOM 2904 C GLY B 37 -10.728 -29.128 -2.259 1.00 71.37 C ANISOU 2904 C GLY B 37 7547 7639 11932 469 -513 38 C ATOM 2905 O GLY B 37 -10.948 -28.680 -1.129 1.00 71.00 O ANISOU 2905 O GLY B 37 7494 7627 11857 465 -449 123 O ATOM 2906 N PHE B 38 -11.524 -30.038 -2.854 1.00 69.47 N ANISOU 2906 N PHE B 38 7260 7321 11816 470 -593 39 N ATOM 2907 CA PHE B 38 -12.707 -30.596 -2.203 1.00 69.76 C ANISOU 2907 CA PHE B 38 7223 7309 11972 461 -614 151 C ATOM 2908 C PHE B 38 -12.361 -31.369 -0.920 1.00 73.02 C ANISOU 2908 C PHE B 38 7582 7721 12442 454 -601 236 C ATOM 2909 O PHE B 38 -12.933 -31.054 0.127 1.00 72.80 O ANISOU 2909 O PHE B 38 7525 7723 12412 449 -544 341 O ATOM 2910 CB PHE B 38 -13.547 -31.440 -3.179 1.00 72.44 C ANISOU 2910 CB PHE B 38 7529 7560 12436 459 -719 134 C ATOM 2911 CG PHE B 38 -14.743 -32.115 -2.544 1.00 74.89 C ANISOU 2911 CG PHE B 38 7755 7819 12879 444 -752 261 C ATOM 2912 CD1 PHE B 38 -15.919 -31.409 -2.310 1.00 77.74 C ANISOU 2912 CD1 PHE B 38 8097 8202 13240 440 -711 342 C ATOM 2913 CD2 PHE B 38 -14.680 -33.443 -2.149 1.00 77.68 C ANISOU 2913 CD2 PHE B 38 8046 8109 13361 435 -826 305 C ATOM 2914 CE1 PHE B 38 -17.006 -32.019 -1.682 1.00 78.61 C ANISOU 2914 CE1 PHE B 38 8120 8278 13470 427 -737 472 C ATOM 2915 CE2 PHE B 38 -15.771 -34.053 -1.523 1.00 80.81 C ANISOU 2915 CE2 PHE B 38 8358 8467 13879 417 -859 437 C ATOM 2916 CZ PHE B 38 -16.928 -33.339 -1.303 1.00 78.50 C ANISOU 2916 CZ PHE B 38 8042 8204 13580 413 -812 522 C ATOM 2917 N PHE B 39 -11.414 -32.346 -0.988 1.00 68.17 N ANISOU 2917 N PHE B 39 6955 7075 11871 456 -651 191 N ATOM 2918 CA PHE B 39 -11.017 -33.137 0.179 1.00 67.46 C ANISOU 2918 CA PHE B 39 6815 6978 11841 445 -649 267 C ATOM 2919 C PHE B 39 -10.230 -32.365 1.245 1.00 70.17 C ANISOU 2919 C PHE B 39 7190 7401 12069 441 -550 298 C ATOM 2920 O PHE B 39 -10.484 -32.575 2.435 1.00 69.05 O ANISOU 2920 O PHE B 39 7006 7271 11957 428 -518 405 O ATOM 2921 CB PHE B 39 -10.260 -34.414 -0.220 1.00 69.59 C ANISOU 2921 CB PHE B 39 7062 7183 12196 451 -738 206 C ATOM 2922 CG PHE B 39 -11.133 -35.441 -0.904 1.00 71.00 C ANISOU 2922 CG PHE B 39 7194 7263 12519 451 -853 212 C ATOM 2923 CD1 PHE B 39 -12.062 -36.185 -0.179 1.00 73.90 C ANISOU 2923 CD1 PHE B 39 7483 7584 13013 427 -894 335 C ATOM 2924 CD2 PHE B 39 -11.040 -35.650 -2.276 1.00 72.96 C ANISOU 2924 CD2 PHE B 39 7480 7468 12775 472 -923 98 C ATOM 2925 CE1 PHE B 39 -12.899 -37.106 -0.821 1.00 74.79 C ANISOU 2925 CE1 PHE B 39 7554 7600 13262 421 -1011 349 C ATOM 2926 CE2 PHE B 39 -11.877 -36.561 -2.919 1.00 75.98 C ANISOU 2926 CE2 PHE B 39 7829 7753 13289 471 -1037 104 C ATOM 2927 CZ PHE B 39 -12.796 -37.294 -2.187 1.00 74.15 C ANISOU 2927 CZ PHE B 39 7518 7468 13187 443 -1085 231 C ATOM 2928 N GLY B 40 -9.257 -31.538 0.831 1.00 66.33 N ANISOU 2928 N GLY B 40 6778 6970 11455 450 -508 212 N ATOM 2929 CA GLY B 40 -8.446 -30.738 1.744 1.00 65.68 C ANISOU 2929 CA GLY B 40 6740 6960 11257 444 -425 236 C ATOM 2930 C GLY B 40 -9.261 -29.705 2.510 1.00 70.33 C ANISOU 2930 C GLY B 40 7348 7595 11780 445 -350 315 C ATOM 2931 O GLY B 40 -9.105 -29.552 3.724 1.00 69.80 O ANISOU 2931 O GLY B 40 7280 7560 11681 439 -297 392 O ATOM 2932 N ASN B 41 -10.162 -28.998 1.807 1.00 67.30 N ANISOU 2932 N ASN B 41 6984 7213 11374 455 -347 297 N ATOM 2933 CA ASN B 41 -10.994 -27.995 2.450 1.00 67.03 C ANISOU 2933 CA ASN B 41 6969 7221 11278 465 -279 366 C ATOM 2934 C ASN B 41 -12.119 -28.634 3.225 1.00 73.99 C ANISOU 2934 C ASN B 41 7768 8078 12267 466 -280 484 C ATOM 2935 O ASN B 41 -12.310 -28.263 4.377 1.00 74.04 O ANISOU 2935 O ASN B 41 7773 8127 12232 474 -215 566 O ATOM 2936 CB ASN B 41 -11.452 -26.930 1.472 1.00 61.17 C ANISOU 2936 CB ASN B 41 6283 6495 10465 475 -273 305 C ATOM 2937 CG ASN B 41 -10.307 -26.017 1.115 1.00 66.40 C ANISOU 2937 CG ASN B 41 7033 7209 10988 471 -247 224 C ATOM 2938 OD1 ASN B 41 -9.675 -25.401 1.983 1.00 63.79 O ANISOU 2938 OD1 ASN B 41 6746 6926 10566 471 -192 252 O ATOM 2939 ND2 ASN B 41 -9.992 -25.926 -0.161 1.00 51.64 N ANISOU 2939 ND2 ASN B 41 5189 5331 9099 466 -291 126 N ATOM 2940 N GLY B 42 -12.761 -29.656 2.638 1.00 72.76 N ANISOU 2940 N GLY B 42 7543 7854 12248 457 -358 493 N ATOM 2941 CA GLY B 42 -13.813 -30.463 3.257 1.00 73.31 C ANISOU 2941 CA GLY B 42 7519 7893 12442 450 -381 612 C ATOM 2942 C GLY B 42 -13.372 -31.017 4.600 1.00 79.61 C ANISOU 2942 C GLY B 42 8280 8712 13256 439 -351 697 C ATOM 2943 O GLY B 42 -14.116 -30.960 5.581 1.00 79.82 O ANISOU 2943 O GLY B 42 8264 8771 13291 444 -303 810 O ATOM 2944 N PHE B 43 -12.115 -31.471 4.672 1.00 78.32 N ANISOU 2944 N PHE B 43 8138 8538 13082 427 -373 641 N ATOM 2945 CA PHE B 43 -11.501 -31.966 5.901 1.00 78.85 C ANISOU 2945 CA PHE B 43 8180 8622 13156 411 -349 709 C ATOM 2946 C PHE B 43 -11.327 -30.842 6.931 1.00 84.66 C ANISOU 2946 C PHE B 43 8971 9440 13756 424 -243 753 C ATOM 2947 O PHE B 43 -11.666 -31.042 8.101 1.00 84.11 O ANISOU 2947 O PHE B 43 8861 9396 13702 420 -206 861 O ATOM 2948 CB PHE B 43 -10.155 -32.659 5.613 1.00 80.26 C ANISOU 2948 CB PHE B 43 8373 8770 13352 399 -398 629 C ATOM 2949 CG PHE B 43 -9.451 -33.131 6.863 1.00 81.79 C ANISOU 2949 CG PHE B 43 8547 8981 13551 379 -376 696 C ATOM 2950 CD1 PHE B 43 -9.903 -34.251 7.556 1.00 84.94 C ANISOU 2950 CD1 PHE B 43 8856 9340 14076 357 -421 796 C ATOM 2951 CD2 PHE B 43 -8.358 -32.440 7.365 1.00 83.81 C ANISOU 2951 CD2 PHE B 43 8872 9289 13683 379 -314 669 C ATOM 2952 CE1 PHE B 43 -9.259 -34.680 8.720 1.00 85.85 C ANISOU 2952 CE1 PHE B 43 8952 9472 14196 334 -401 861 C ATOM 2953 CE2 PHE B 43 -7.722 -32.864 8.532 1.00 86.92 C ANISOU 2953 CE2 PHE B 43 9249 9696 14081 357 -295 736 C ATOM 2954 CZ PHE B 43 -8.168 -33.990 9.195 1.00 85.09 C ANISOU 2954 CZ PHE B 43 8928 9425 13976 335 -338 829 C ATOM 2955 N VAL B 44 -10.788 -29.674 6.490 1.00 82.35 N ANISOU 2955 N VAL B 44 8773 9189 13329 440 -199 670 N ATOM 2956 CA VAL B 44 -10.553 -28.483 7.328 1.00 82.07 C ANISOU 2956 CA VAL B 44 8811 9223 13150 456 -111 694 C ATOM 2957 C VAL B 44 -11.887 -27.966 7.896 1.00 84.05 C ANISOU 2957 C VAL B 44 9039 9505 13391 484 -58 784 C ATOM 2958 O VAL B 44 -11.967 -27.638 9.084 1.00 82.93 O ANISOU 2958 O VAL B 44 8909 9410 13192 497 6 860 O ATOM 2959 CB VAL B 44 -9.716 -27.405 6.583 1.00 86.25 C ANISOU 2959 CB VAL B 44 9442 9779 13549 461 -98 585 C ATOM 2960 CG1 VAL B 44 -9.734 -26.056 7.307 1.00 86.23 C ANISOU 2960 CG1 VAL B 44 9523 9838 13403 483 -21 607 C ATOM 2961 CG2 VAL B 44 -8.278 -27.883 6.386 1.00 85.83 C ANISOU 2961 CG2 VAL B 44 9407 9716 13489 438 -130 523 C ATOM 2962 N LEU B 45 -12.939 -27.980 7.071 1.00 80.76 N ANISOU 2962 N LEU B 45 8585 9063 13037 495 -87 779 N ATOM 2963 CA LEU B 45 -14.274 -27.574 7.484 1.00 81.07 C ANISOU 2963 CA LEU B 45 8589 9131 13084 524 -43 867 C ATOM 2964 C LEU B 45 -14.826 -28.539 8.534 1.00 88.53 C ANISOU 2964 C LEU B 45 9434 10079 14124 515 -38 1000 C ATOM 2965 O LEU B 45 -15.350 -28.075 9.546 1.00 88.84 O ANISOU 2965 O LEU B 45 9469 10178 14108 544 36 1085 O ATOM 2966 CB LEU B 45 -15.194 -27.464 6.268 1.00 80.81 C ANISOU 2966 CB LEU B 45 8535 9060 13108 529 -88 831 C ATOM 2967 CG LEU B 45 -16.358 -26.490 6.362 1.00 85.18 C ANISOU 2967 CG LEU B 45 9095 9653 13615 568 -32 874 C ATOM 2968 CD1 LEU B 45 -15.959 -25.181 7.016 1.00 84.90 C ANISOU 2968 CD1 LEU B 45 9158 9686 13416 604 53 857 C ATOM 2969 CD2 LEU B 45 -16.927 -26.225 5.001 1.00 87.13 C ANISOU 2969 CD2 LEU B 45 9351 9860 13895 565 -82 805 C ATOM 2970 N TYR B 46 -14.636 -29.874 8.327 1.00 86.56 N ANISOU 2970 N TYR B 46 9109 9769 14011 478 -120 1016 N ATOM 2971 CA TYR B 46 -15.054 -30.936 9.247 1.00 86.62 C ANISOU 2971 CA TYR B 46 9017 9770 14126 457 -138 1142 C ATOM 2972 C TYR B 46 -14.393 -30.732 10.614 1.00 91.26 C ANISOU 2972 C TYR B 46 9630 10416 14630 459 -67 1195 C ATOM 2973 O TYR B 46 -15.108 -30.623 11.607 1.00 91.10 O ANISOU 2973 O TYR B 46 9567 10449 14600 475 -11 1309 O ATOM 2974 CB TYR B 46 -14.750 -32.334 8.664 1.00 88.18 C ANISOU 2974 CB TYR B 46 9152 9880 14472 415 -253 1122 C ATOM 2975 CG TYR B 46 -14.925 -33.469 9.654 1.00 90.07 C ANISOU 2975 CG TYR B 46 9294 10109 14819 384 -284 1246 C ATOM 2976 CD1 TYR B 46 -16.189 -33.960 9.966 1.00 92.46 C ANISOU 2976 CD1 TYR B 46 9495 10411 15224 378 -304 1374 C ATOM 2977 CD2 TYR B 46 -13.830 -34.037 10.295 1.00 90.92 C ANISOU 2977 CD2 TYR B 46 9408 10211 14927 359 -294 1244 C ATOM 2978 CE1 TYR B 46 -16.359 -34.974 10.908 1.00 93.93 C ANISOU 2978 CE1 TYR B 46 9588 10595 15506 345 -333 1499 C ATOM 2979 CE2 TYR B 46 -13.986 -35.050 11.236 1.00 92.13 C ANISOU 2979 CE2 TYR B 46 9472 10356 15176 327 -323 1363 C ATOM 2980 CZ TYR B 46 -15.252 -35.519 11.538 1.00103.23 C ANISOU 2980 CZ TYR B 46 10778 11766 16681 318 -344 1491 C ATOM 2981 OH TYR B 46 -15.398 -36.532 12.458 1.00109.68 O ANISOU 2981 OH TYR B 46 11503 12578 17594 281 -379 1617 O ATOM 2982 N VAL B 47 -13.045 -30.631 10.649 1.00 88.37 N ANISOU 2982 N VAL B 47 9335 10044 14196 444 -69 1114 N ATOM 2983 CA VAL B 47 -12.229 -30.409 11.853 1.00 88.82 C ANISOU 2983 CA VAL B 47 9433 10146 14168 440 -13 1149 C ATOM 2984 C VAL B 47 -12.629 -29.112 12.603 1.00 97.55 C ANISOU 2984 C VAL B 47 10606 11330 15128 486 89 1183 C ATOM 2985 O VAL B 47 -12.683 -29.141 13.832 1.00 97.92 O ANISOU 2985 O VAL B 47 10643 11422 15141 491 140 1274 O ATOM 2986 CB VAL B 47 -10.717 -30.478 11.526 1.00 91.63 C ANISOU 2986 CB VAL B 47 9854 10475 14486 415 -44 1048 C ATOM 2987 CG1 VAL B 47 -9.853 -29.993 12.685 1.00 91.14 C ANISOU 2987 CG1 VAL B 47 9854 10460 14314 412 16 1076 C ATOM 2988 CG2 VAL B 47 -10.327 -31.893 11.139 1.00 91.43 C ANISOU 2988 CG2 VAL B 47 9753 10378 14607 378 -139 1037 C ATOM 2989 N LEU B 48 -12.944 -28.010 11.876 1.00 96.31 N ANISOU 2989 N LEU B 48 10517 11189 14888 521 115 1113 N ATOM 2990 CA LEU B 48 -13.352 -26.727 12.480 1.00 97.02 C ANISOU 2990 CA LEU B 48 10679 11345 14838 572 202 1132 C ATOM 2991 C LEU B 48 -14.790 -26.715 13.028 1.00105.53 C ANISOU 2991 C LEU B 48 11685 12465 15947 612 249 1244 C ATOM 2992 O LEU B 48 -15.051 -26.049 14.036 1.00105.21 O ANISOU 2992 O LEU B 48 11680 12489 15807 655 327 1299 O ATOM 2993 CB LEU B 48 -13.147 -25.548 11.513 1.00 96.39 C ANISOU 2993 CB LEU B 48 10699 11264 14660 593 204 1018 C ATOM 2994 CG LEU B 48 -11.734 -25.046 11.343 1.00 99.11 C ANISOU 2994 CG LEU B 48 11145 11604 14909 571 192 927 C ATOM 2995 CD1 LEU B 48 -11.608 -24.313 10.058 1.00 98.50 C ANISOU 2995 CD1 LEU B 48 11126 11510 14790 573 162 819 C ATOM 2996 CD2 LEU B 48 -11.332 -24.142 12.488 1.00 99.92 C ANISOU 2996 CD2 LEU B 48 11337 11758 14870 597 257 957 C ATOM 2997 N ILE B 49 -15.718 -27.417 12.349 1.00105.46 N ANISOU 2997 N ILE B 49 11576 12422 16072 600 201 1278 N ATOM 2998 CA ILE B 49 -17.122 -27.516 12.756 1.00106.83 C ANISOU 2998 CA ILE B 49 11661 12634 16296 631 236 1396 C ATOM 2999 C ILE B 49 -17.227 -28.337 14.053 1.00115.53 C ANISOU 2999 C ILE B 49 12685 13774 17439 618 259 1528 C ATOM 3000 O ILE B 49 -17.907 -27.909 14.986 1.00115.47 O ANISOU 3000 O ILE B 49 12663 13841 17369 665 339 1617 O ATOM 3001 CB ILE B 49 -18.000 -28.049 11.576 1.00109.67 C ANISOU 3001 CB ILE B 49 11941 12936 16792 613 162 1393 C ATOM 3002 CG1 ILE B 49 -18.320 -26.931 10.534 1.00109.95 C ANISOU 3002 CG1 ILE B 49 12050 12965 16762 645 169 1296 C ATOM 3003 CG2 ILE B 49 -19.262 -28.787 12.027 1.00110.58 C ANISOU 3003 CG2 ILE B 49 11921 13071 17021 614 160 1544 C ATOM 3004 CD1 ILE B 49 -19.051 -25.630 11.027 1.00116.61 C ANISOU 3004 CD1 ILE B 49 12941 13882 17482 716 265 1321 C ATOM 3005 N LYS B 50 -16.498 -29.475 14.124 1.00115.54 N ATOM 3006 CA LYS B 50 -16.463 -30.390 15.274 1.00116.96 C ATOM 3007 C LYS B 50 -15.464 -29.972 16.386 1.00124.84 C ATOM 3008 O LYS B 50 -15.051 -30.810 17.190 1.00123.84 O ATOM 3009 CB LYS B 50 -16.213 -31.829 14.808 1.00119.24 C