>>6T9L:HELIX   32 AD5 SER H   52  ASN H   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 32 AD5 SER H 52 ASN H 81 1 30 ATOM 5422 N SER H 52 291.869 274.855 242.912 1.00205.00 N ATOM 5423 CA SER H 52 290.620 275.408 242.415 1.00205.00 C ATOM 5424 C SER H 52 290.120 276.517 243.340 1.00205.00 C ATOM 5425 O SER H 52 290.670 276.768 244.417 1.00205.00 O ATOM 5426 CB SER H 52 289.565 274.311 242.280 1.00205.00 C ATOM 5427 OG SER H 52 288.258 274.859 242.282 1.00205.00 O ATOM 5428 N SER H 53 289.053 277.189 242.902 1.00205.00 N ATOM 5429 CA SER H 53 288.485 278.272 243.699 1.00205.00 C ATOM 5430 C SER H 53 287.730 277.734 244.908 1.00205.00 C ATOM 5431 O SER H 53 287.730 278.359 245.976 1.00205.00 O ATOM 5432 CB SER H 53 287.568 279.134 242.832 1.00205.00 C ATOM 5433 OG SER H 53 286.726 278.330 242.025 1.00205.00 O ATOM 5434 N LYS H 54 287.077 276.579 244.760 1.00205.00 N ATOM 5435 CA LYS H 54 286.346 275.995 245.880 1.00205.00 C ATOM 5436 C LYS H 54 287.292 275.590 247.004 1.00205.00 C ATOM 5437 O LYS H 54 287.011 275.846 248.181 1.00205.00 O ATOM 5438 CB LYS H 54 285.526 274.797 245.404 1.00205.00 C ATOM 5439 CG LYS H 54 284.463 275.147 244.377 1.00205.00 C ATOM 5440 CD LYS H 54 283.619 273.936 244.015 1.00205.00 C ATOM 5441 CE LYS H 54 282.548 274.297 242.999 1.00205.00 C ATOM 5442 NZ LYS H 54 281.679 273.134 242.669 1.00205.00 N ATOM 5443 N ALA H 55 288.418 274.962 246.660 1.00205.00 N ATOM 5444 CA ALA H 55 289.413 274.628 247.674 1.00205.00 C ATOM 5445 C ALA H 55 289.991 275.879 248.320 1.00205.00 C ATOM 5446 O ALA H 55 290.275 275.880 249.523 1.00205.00 O ATOM 5447 CB ALA H 55 290.528 273.782 247.060 1.00205.00 C ATOM 5448 N MET H 56 290.161 276.953 247.545 1.00205.00 N ATOM 5449 CA MET H 56 290.647 278.205 248.113 1.00205.00 C ATOM 5450 C MET H 56 289.656 278.772 249.123 1.00205.00 C ATOM 5451 O MET H 56 290.050 279.226 250.203 1.00205.00 O ATOM 5452 CB MET H 56 290.919 279.216 246.999 1.00205.00 C ATOM 5453 CG MET H 56 291.617 280.481 247.465 1.00205.00 C ATOM 5454 SD MET H 56 293.257 280.157 248.138 1.00205.00 S ATOM 5455 CE MET H 56 292.982 280.496 249.874 1.00205.00 C ATOM 5456 N SER H 57 288.363 278.748 248.790 1.00205.00 N ATOM 5457 CA SER H 57 287.355 279.229 249.729 1.00205.00 C ATOM 5458 C SER H 57 287.298 278.350 250.973 1.00205.00 C ATOM 5459 O SER H 57 287.113 278.851 252.089 1.00205.00 O ATOM 5460 CB SER H 57 285.988 279.288 249.049 1.00205.00 C ATOM 5461 OG SER H 57 285.741 278.112 248.299 1.00205.00 O ATOM 5462 N ILE H 58 287.464 277.036 250.800 1.00205.00 N ATOM 5463 CA ILE H 58 287.475 276.130 251.945 1.00205.00 C ATOM 5464 C ILE H 58 288.649 276.445 252.863 1.00205.00 C ATOM 5465 O ILE H 58 288.500 276.505 254.091 1.00205.00 O ATOM 5466 CB ILE H 58 287.507 274.666 251.468 1.00205.00 C ATOM 5467 CG1 ILE H 58 286.166 274.280 250.841 1.00205.00 C ATOM 5468 CG2 ILE H 58 287.846 273.731 252.619 1.00205.00 C ATOM 5469 CD1 ILE H 58 286.160 272.906 250.210 1.00205.00 C ATOM 5470 N MET H 59 289.834 276.657 252.284 1.00205.00 N ATOM 5471 CA MET H 59 291.003 276.992 253.091 1.00205.00 C ATOM 5472 C MET H 59 290.828 278.335 253.789 1.00205.00 C ATOM 5473 O MET H 59 291.227 278.494 254.948 1.00205.00 O ATOM 5474 CB MET H 59 292.259 276.999 252.219 1.00205.00 C ATOM 5475 CG MET H 59 292.676 275.625 251.720 1.00205.00 C ATOM 5476 SD MET H 59 293.032 274.479 253.065 1.00205.00 S ATOM 5477 CE MET H 59 294.325 275.366 253.931 1.00205.00 C ATOM 5478 N ASN H 60 290.234 279.312 253.099 1.00205.00 N ATOM 5479 CA ASN H 60 289.982 280.610 253.715 1.00205.00 C ATOM 5480 C ASN H 60 289.041 280.476 254.906 1.00205.00 C ATOM 5481 O ASN H 60 289.283 281.052 255.975 1.00205.00 O ATOM 5482 CB ASN H 60 289.407 281.576 252.679 1.00205.00 C ATOM 5483 CG ASN H 60 290.034 282.953 252.755 1.00205.00 C ATOM 5484 OD1 ASN H 60 291.178 283.103 253.182 1.00205.00 O ATOM 5485 ND2 ASN H 60 289.286 283.968 252.339 1.00205.00 N ATOM 5486 N SER H 61 287.955 279.718 254.736 1.00205.00 N ATOM 5487 CA SER H 61 287.013 279.515 255.832 1.00205.00 C ATOM 5488 C SER H 61 287.669 278.781 256.995 1.00205.00 C ATOM 5489 O SER H 61 287.419 279.105 258.162 1.00205.00 O ATOM 5490 CB SER H 61 285.788 278.749 255.333 1.00205.00 C ATOM 5491 OG SER H 61 286.009 277.351 255.385 1.00205.00 O ATOM 5492 N PHE H 62 288.516 277.793 256.697 1.00205.00 N ATOM 5493 CA PHE H 62 289.211 277.067 257.756 1.00205.00 C ATOM 5494 C PHE H 62 290.143 277.990 258.531 1.00205.00 C ATOM 5495 O PHE H 62 290.195 277.948 259.767 1.00205.00 O ATOM 5496 CB PHE H 62 289.987 275.891 257.162 1.00205.00 C ATOM 5497 CG PHE H 62 290.992 275.289 258.103 1.00205.00 C ATOM 5498 CD1 PHE H 62 290.594 274.398 259.085 1.00205.00 C ATOM 5499 CD2 PHE H 62 292.335 275.614 258.005 1.00205.00 C ATOM 5500 CE1 PHE H 62 291.515 273.843 259.952 1.00205.00 C ATOM 5501 CE2 PHE H 62 293.261 275.065 258.871 1.00205.00 C ATOM 5502 CZ PHE H 62 292.850 274.177 259.844 1.00205.00 C ATOM 5503 N VAL H 63 290.899 278.827 257.815 1.00205.00 N ATOM 5504 CA VAL H 63 291.808 279.761 258.473 1.00205.00 C ATOM 5505 C VAL H 63 291.027 280.740 259.339 1.00205.00 C ATOM 5506 O VAL H 63 291.420 281.040 260.473 1.00205.00 O ATOM 5507 CB VAL H 63 292.674 280.489 257.429 1.00205.00 C ATOM 5508 CG1 VAL H 63 293.397 281.669 258.060 1.00205.00 C ATOM 5509 CG2 VAL H 63 293.669 279.526 256.803 1.00205.00 C ATOM 5510 N ASN H 64 289.902 281.246 258.824 1.00205.00 N ATOM 5511 CA ASN H 64 289.086 282.170 259.605 1.00205.00 C ATOM 5512 C ASN H 64 288.535 281.500 260.857 1.00205.00 C ATOM 5513 O ASN H 64 288.516 282.104 261.936 1.00205.00 O ATOM 5514 CB ASN H 64 287.948 282.721 258.745 1.00205.00 C ATOM 5515 CG ASN H 64 288.432 283.706 257.699 1.00205.00 C ATOM 5516 OD1 ASN H 64 288.076 283.607 256.525 1.00205.00 O ATOM 5517 ND2 ASN H 64 289.249 284.663 258.122 1.00205.00 N ATOM 5518 N ASP H 65 288.092 280.246 260.737 1.00205.00 N ATOM 5519 CA ASP H 65 287.552 279.535 261.891 1.00205.00 C ATOM 5520 C ASP H 65 288.627 279.300 262.945 1.00205.00 C ATOM 5521 O ASP H 65 288.385 279.472 264.146 1.00205.00 O ATOM 5522 CB ASP H 65 286.932 278.211 261.447 1.00205.00 C ATOM 5523 CG ASP H 65 286.588 277.307 262.614 1.00205.00 C ATOM 5524 OD1 ASP H 65 285.632 277.626 263.352 1.00205.00 O ATOM 5525 OD2 ASP H 65 287.273 276.279 262.794 1.00205.00 O ATOM 5526 N VAL H 66 289.826 278.903 262.512 1.00205.00 N ATOM 5527 CA VAL H 66 290.914 278.680 263.461 1.00205.00 C ATOM 5528 C VAL H 66 291.305 279.986 264.141 1.00205.00 C ATOM 5529 O VAL H 66 291.558 280.022 265.353 1.00205.00 O ATOM 5530 CB VAL H 66 292.113 278.022 262.755 1.00205.00 C ATOM 5531 CG1 VAL H 66 293.307 277.942 263.694 1.00205.00 C ATOM 5532 CG2 VAL H 66 291.737 276.636 262.259 1.00205.00 C ATOM 5533 N PHE H 67 291.355 281.081 263.376 1.00205.00 N ATOM 5534 CA PHE H 67 291.666 282.381 263.959 1.00205.00 C ATOM 5535 C PHE H 67 290.625 282.783 264.996 1.00205.00 C ATOM 5536 O PHE H 67 290.974 283.262 266.081 1.00205.00 O ATOM 5537 CB PHE H 67 291.764 283.436 262.856 1.00205.00 C ATOM 5538 CG PHE H 67 291.774 284.849 263.365 1.00205.00 C ATOM 5539 CD1 PHE H 67 292.904 285.375 263.965 1.00205.00 C ATOM 5540 CD2 PHE H 67 290.653 285.653 263.237 1.00205.00 C ATOM 5541 CE1 PHE H 67 292.917 286.675 264.433 1.00205.00 C ATOM 5542 CE2 PHE H 67 290.660 286.954 263.703 1.00205.00 C ATOM 5543 CZ PHE H 67 291.794 287.466 264.302 1.00205.00 C ATOM 5544 N GLU H 68 289.341 282.592 264.680 1.00205.00 N ATOM 5545 CA GLU H 68 288.286 282.928 265.631 1.00205.00 C ATOM 5546 C GLU H 68 288.386 282.078 266.891 1.00205.00 C ATOM 5547 O GLU H 68 288.224 282.588 268.005 1.00205.00 O ATOM 5548 CB GLU H 68 286.914 282.761 264.978 1.00205.00 C ATOM 5549 CG GLU H 68 286.604 283.782 263.894 1.00205.00 C ATOM 5550 CD GLU H 68 286.864 285.209 264.339 1.00205.00 C ATOM 5551 OE1 GLU H 68 287.480 285.971 263.564 1.00205.00 O ATOM 5552 OE2 GLU H 68 286.445 285.572 265.459 1.00205.00 O ATOM 5553 N ARG H 69 288.651 280.778 266.734 1.00205.00 N ATOM 5554 CA ARG H 69 288.782 279.904 267.896 1.00205.00 C ATOM 5555 C ARG H 69 289.940 280.337 268.787 1.00205.00 C ATOM 5556 O ARG H 69 289.794 280.417 270.014 1.00205.00 O ATOM 5557 CB ARG H 69 288.972 278.455 267.446 1.00205.00 C ATOM 5558 CG ARG H 69 287.731 277.811 266.851 1.00205.00 C ATOM 5559 CD ARG H 69 288.002 276.366 266.468 1.00205.00 C ATOM 5560 NE ARG H 69 286.847 275.737 265.834 1.00205.00 N ATOM 5561 CZ ARG H 69 286.808 274.466 265.447 1.00205.00 C ATOM 5562 NH1 ARG H 69 287.863 273.683 265.630 1.00205.00 N ATOM 5563 NH2 ARG H 69 285.715 273.977 264.878 1.00205.00 N ATOM 5564 N ILE H 70 291.098 280.623 268.187 1.00205.00 N ATOM 5565 CA ILE H 70 292.262 281.010 268.977 1.00205.00 C ATOM 5566 C ILE H 70 292.029 282.355 269.655 1.00205.00 C ATOM 5567 O ILE H 70 292.407 282.553 270.817 1.00205.00 O ATOM 5568 CB ILE H 70 293.524 281.020 268.095 1.00205.00 C ATOM 5569 CG1 ILE H 70 293.836 279.603 267.609 1.00205.00 C ATOM 5570 CG2 ILE H 70 294.709 281.594 268.855 1.00205.00 C ATOM 5571 CD1 ILE H 70 295.077 279.505 266.751 1.00205.00 C ATOM 5572 N ALA H 71 291.387 283.295 268.955 1.00205.00 N ATOM 5573 CA ALA H 71 291.100 284.592 269.557 1.00205.00 C ATOM 5574 C ALA H 71 290.126 284.458 270.720 1.00205.00 C ATOM 5575 O ALA H 71 290.295 285.107 271.759 1.00205.00 O ATOM 5576 CB ALA H 71 290.551 285.552 268.502 1.00205.00 C ATOM 5577 N GLY H 72 289.102 283.614 270.569 1.00205.00 N ATOM 5578 CA GLY H 72 288.171 283.397 271.663 1.00205.00 C ATOM 5579 C GLY H 72 288.828 282.743 272.863 1.00205.00 C ATOM 5580 O GLY H 72 288.557 283.111 274.009 1.00205.00 O ATOM 5581 N GLU H 73 289.703 281.764 272.617 1.00205.00 N ATOM 5582 CA GLU H 73 290.423 281.133 273.719 1.00205.00 C ATOM 5583 C GLU H 73 291.323 282.133 274.435 1.00205.00 C ATOM 5584 O GLU H 73 291.377 282.155 275.671 1.00205.00 O ATOM 5585 CB GLU H 73 291.239 279.948 273.205 1.00205.00 C ATOM 5586 CG GLU H 73 291.841 279.090 274.305 1.00205.00 C ATOM 5587 CD GLU H 73 290.787 278.408 275.156 1.00205.00 C ATOM 5588 OE1 GLU H 73 289.710 278.075 274.619 1.00205.00 O ATOM 5589 OE2 GLU H 73 291.036 278.205 276.363 1.00205.00 O ATOM 5590 N ALA H 74 292.031 282.973 273.674 1.00205.00 N ATOM 5591 CA ALA H 74 292.878 283.990 274.289 1.00205.00 C ATOM 5592 C ALA H 74 292.059 284.989 275.093 1.00205.00 C ATOM 5593 O ALA H 74 292.479 285.401 276.180 1.00205.00 O ATOM 5594 CB ALA H 74 293.696 284.711 273.217 1.00205.00 C ATOM 5595 N SER H 75 290.889 285.383 274.585 1.00205.00 N ATOM 5596 CA SER H 75 290.035 286.307 275.325 1.00205.00 C ATOM 5597 C SER H 75 289.526 285.677 276.615 1.00205.00 C ATOM 5598 O SER H 75 289.506 286.331 277.665 1.00205.00 O ATOM 5599 CB SER H 75 288.866 286.757 274.450 1.00205.00 C ATOM 5600 OG SER H 75 289.246 287.831 273.609 1.00205.00 O ATOM 5601 N ARG H 76 289.109 284.409 276.556 1.00205.00 N ATOM 5602 CA ARG H 76 288.655 283.726 277.763 1.00205.00 C ATOM 5603 C ARG H 76 289.777 283.619 278.788 1.00205.00 C ATOM 5604 O ARG H 76 289.554 283.826 279.986 1.00205.00 O ATOM 5605 CB ARG H 76 288.111 282.341 277.416 1.00205.00 C ATOM 5606 CG ARG H 76 286.592 282.262 277.369 1.00205.00 C ATOM 5607 CD ARG H 76 286.059 282.589 275.985 1.00205.00 C ATOM 5608 NE ARG H 76 286.592 281.688 274.968 1.00205.00 N ATOM 5609 CZ ARG H 76 286.093 280.486 274.697 1.00205.00 C ATOM 5610 NH1 ARG H 76 285.044 280.033 275.369 1.00205.00 N ATOM 5611 NH2 ARG H 76 286.645 279.735 273.754 1.00205.00 N ATOM 5612 N LEU H 77 290.995 283.315 278.334 1.00205.00 N ATOM 5613 CA LEU H 77 292.118 283.216 279.262 1.00205.00 C ATOM 5614 C LEU H 77 292.453 284.572 279.875 1.00205.00 C ATOM 5615 O LEU H 77 292.729 284.664 281.078 1.00205.00 O ATOM 5616 CB LEU H 77 293.334 282.629 278.548 1.00205.00 C ATOM 5617 CG LEU H 77 293.232 281.143 278.203 1.00205.00 C ATOM 5618 CD1 LEU H 77 294.178 280.787 277.069 1.00205.00 C ATOM 5619 CD2 LEU H 77 293.515 280.289 279.430 1.00205.00 C ATOM 5620 N ALA H 78 292.428 285.635 279.066 1.00205.00 N ATOM 5621 CA ALA H 78 292.725 286.966 279.585 1.00205.00 C ATOM 5622 C ALA H 78 291.667 287.420 280.582 1.00205.00 C ATOM 5623 O ALA H 78 291.986 288.077 281.580 1.00205.00 O ATOM 5624 CB ALA H 78 292.843 287.964 278.433 1.00205.00 C ATOM 5625 N HIS H 79 290.402 287.080 280.331 1.00205.00 N ATOM 5626 CA HIS H 79 289.341 287.426 281.267 1.00205.00 C ATOM 5627 C HIS H 79 289.369 286.568 282.524 1.00205.00 C ATOM 5628 O HIS H 79 288.926 287.027 283.582 1.00205.00 O ATOM 5629 CB HIS H 79 287.976 287.303 280.587 1.00205.00 C ATOM 5630 CG HIS H 79 287.552 288.540 279.858 1.00205.00 C ATOM 5631 ND1 HIS H 79 288.018 288.859 278.600 1.00205.00 N ATOM 5632 CD2 HIS H 79 286.708 289.538 280.210 1.00205.00 C ATOM 5633 CE1 HIS H 79 287.478 290.000 278.209 1.00205.00 C ATOM 5634 NE2 HIS H 79 286.679 290.432 279.168 1.00205.00 N ATOM 5635 N TYR H 80 289.880 285.337 282.433 1.00205.00 N ATOM 5636 CA TYR H 80 290.014 284.507 283.624 1.00205.00 C ATOM 5637 C TYR H 80 291.190 284.950 284.483 1.00205.00 C ATOM 5638 O TYR H 80 291.124 284.859 285.715 1.00205.00 O ATOM 5639 CB TYR H 80 290.171 283.040 283.228 1.00205.00 C ATOM 5640 CG TYR H 80 288.896 282.398 282.730 1.00205.00 C ATOM 5641 CD1 TYR H 80 287.661 282.987 282.965 1.00205.00 C ATOM 5642 CD2 TYR H 80 288.928 281.203 282.024 1.00205.00 C ATOM 5643 CE1 TYR H 80 286.493 282.404 282.512 1.00205.00 C ATOM 5644 CE2 TYR H 80 287.765 280.612 281.567 1.00205.00 C ATOM 5645 CZ TYR H 80 286.551 281.217 281.813 1.00205.00 C ATOM 5646 OH TYR H 80 285.391 280.633 281.360 1.00205.00 O ATOM 5647 N ASN H 81 292.266 285.429 283.861 1.00205.00 N ATOM 5648 CA ASN H 81 293.432 285.916 284.584 1.00205.00 C ATOM 5649 C ASN H 81 293.329 287.394 284.936 1.00205.00 C ATOM 5650 O ASN H 81 294.260 287.942 285.537 1.00205.00 O ATOM 5651 CB ASN H 81 294.702 285.659 283.772 1.00205.00 C ATOM 5652 CG ASN H 81 295.234 284.252 283.954 1.00205.00 C ATOM 5653 OD1 ASN H 81 295.090 283.654 285.020 1.00205.00 O ATOM 5654 ND2 ASN H 81 295.855 283.715 282.911 1.00205.00 N