>>6UXW:HELIX   21 AC3 GLN V   85  ALA V  114  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 21 AC3 GLN V 85 ALA V 114 1 30 ATOM 3382 N GLN V 85 223.856 244.828 128.792 1.00 45.71 N ATOM 3383 CA GLN V 85 224.142 243.459 129.187 1.00 43.02 C ATOM 3384 C GLN V 85 223.363 243.117 130.450 1.00 51.14 C ATOM 3385 O GLN V 85 223.042 243.990 131.261 1.00 52.76 O ATOM 3386 CB GLN V 85 225.639 243.259 129.419 1.00 52.37 C ATOM 3387 CG GLN V 85 226.485 243.406 128.166 1.00 54.97 C ATOM 3388 CD GLN V 85 227.961 243.216 128.439 1.00 67.89 C ATOM 3389 OE1 GLN V 85 228.424 243.386 129.567 1.00 57.01 O ATOM 3390 NE2 GLN V 85 228.713 242.859 127.404 1.00 69.23 N ATOM 3391 N SER V 86 223.055 241.829 130.611 1.00 73.63 N ATOM 3392 CA SER V 86 222.288 241.396 131.775 1.00 66.82 C ATOM 3393 C SER V 86 223.027 241.704 133.070 1.00 71.13 C ATOM 3394 O SER V 86 222.414 242.123 134.061 1.00 79.10 O ATOM 3395 CB SER V 86 221.981 239.902 131.674 1.00 75.87 C ATOM 3396 OG SER V 86 223.174 239.139 131.700 1.00 91.64 O ATOM 3397 N SER V 87 224.348 241.516 133.079 1.00 53.49 N ATOM 3398 CA SER V 87 225.129 241.791 134.279 1.00 58.31 C ATOM 3399 C SER V 87 225.118 243.271 134.639 1.00 58.26 C ATOM 3400 O SER V 87 225.296 243.623 135.812 1.00 51.15 O ATOM 3401 CB SER V 87 226.563 241.295 134.092 1.00 37.47 C ATOM 3402 OG SER V 87 227.193 241.965 133.014 1.00 56.88 O ATOM 3403 N ALA V 88 224.910 244.149 133.658 1.00 47.26 N ATOM 3404 CA ALA V 88 224.817 245.577 133.955 1.00 44.39 C ATOM 3405 C ALA V 88 223.520 245.897 134.685 1.00 49.97 C ATOM 3406 O ALA V 88 223.525 246.602 135.705 1.00 54.83 O ATOM 3407 CB ALA V 88 224.925 246.389 132.665 1.00 35.78 C ATOM 3408 N VAL V 89 222.395 245.386 134.179 1.00 38.10 N ATOM 3409 CA VAL V 89 221.117 245.582 134.856 1.00 39.75 C ATOM 3410 C VAL V 89 221.156 244.967 136.247 1.00 46.69 C ATOM 3411 O VAL V 89 220.648 245.547 137.216 1.00 58.23 O ATOM 3412 CB VAL V 89 219.970 245.002 134.007 1.00 45.96 C ATOM 3413 CG1 VAL V 89 218.650 245.117 134.746 1.00 48.94 C ATOM 3414 CG2 VAL V 89 219.899 245.707 132.665 1.00 53.87 C ATOM 3415 N MET V 90 221.771 243.789 136.374 1.00 41.06 N ATOM 3416 CA MET V 90 221.941 243.187 137.691 1.00 49.53 C ATOM 3417 C MET V 90 222.791 244.070 138.595 1.00 54.44 C ATOM 3418 O MET V 90 222.550 244.150 139.804 1.00 65.20 O ATOM 3419 CB MET V 90 222.561 241.797 137.559 1.00 62.60 C ATOM 3420 CG MET V 90 221.668 240.787 136.863 1.00 71.58 C ATOM 3421 SD MET V 90 220.109 240.534 137.728 1.00 83.91 S ATOM 3422 CE MET V 90 220.690 239.781 139.244 1.00316.06 C ATOM 3423 N ALA V 91 223.789 244.749 138.024 1.00 40.83 N ATOM 3424 CA ALA V 91 224.616 245.654 138.818 1.00 39.51 C ATOM 3425 C ALA V 91 223.798 246.826 139.340 1.00 49.88 C ATOM 3426 O ALA V 91 223.853 247.158 140.533 1.00 44.71 O ATOM 3427 CB ALA V 91 225.800 246.147 137.988 1.00 41.32 C ATOM 3428 N LEU V 92 223.024 247.467 138.457 1.00 36.03 N ATOM 3429 CA LEU V 92 222.163 248.559 138.897 1.00 29.61 C ATOM 3430 C LEU V 92 221.147 248.094 139.929 1.00 35.89 C ATOM 3431 O LEU V 92 220.774 248.863 140.823 1.00 45.46 O ATOM 3432 CB LEU V 92 221.456 249.183 137.696 1.00 31.81 C ATOM 3433 CG LEU V 92 222.381 249.880 136.703 1.00 27.99 C ATOM 3434 CD1 LEU V 92 221.610 250.357 135.491 1.00 20.79 C ATOM 3435 CD2 LEU V 92 223.080 251.038 137.380 1.00 12.18 C ATOM 3436 N GLN V 93 220.692 246.844 139.833 1.00 39.62 N ATOM 3437 CA GLN V 93 219.756 246.335 140.829 1.00 31.30 C ATOM 3438 C GLN V 93 220.443 246.127 142.175 1.00 35.54 C ATOM 3439 O GLN V 93 219.872 246.453 143.222 1.00 35.81 O ATOM 3440 CB GLN V 93 219.117 245.038 140.339 1.00 34.00 C ATOM 3441 CG GLN V 93 218.024 244.510 141.250 1.00 40.75 C ATOM 3442 CD GLN V 93 217.286 243.334 140.650 1.00 51.02 C ATOM 3443 OE1 GLN V 93 217.518 242.964 139.499 1.00 51.99 O ATOM 3444 NE2 GLN V 93 216.391 242.737 141.426 1.00 56.77 N ATOM 3445 N GLU V 94 221.666 245.592 142.167 1.00 34.89 N ATOM 3446 CA GLU V 94 222.411 245.434 143.412 1.00 31.73 C ATOM 3447 C GLU V 94 222.645 246.781 144.086 1.00 35.01 C ATOM 3448 O GLU V 94 222.301 246.972 145.259 1.00 38.62 O ATOM 3449 CB GLU V 94 223.745 244.738 143.146 1.00 49.02 C ATOM 3450 CG GLU V 94 223.637 243.307 142.655 1.00 59.67 C ATOM 3451 CD GLU V 94 222.904 242.408 143.627 1.00 69.45 C ATOM 3452 OE1 GLU V 94 223.083 242.578 144.850 1.00 68.80 O ATOM 3453 OE2 GLU V 94 222.157 241.522 143.163 1.00 59.80 O ATOM 3454 N ALA V 95 223.224 247.731 143.347 1.00 23.90 N ATOM 3455 CA ALA V 95 223.537 249.032 143.932 1.00 28.95 C ATOM 3456 C ALA V 95 222.277 249.758 144.378 1.00 34.87 C ATOM 3457 O ALA V 95 222.254 250.376 145.450 1.00 35.60 O ATOM 3458 CB ALA V 95 224.318 249.880 142.930 1.00 27.31 C ATOM 3459 N SER V 96 221.215 249.696 143.572 1.00 29.25 N ATOM 3460 CA SER V 96 219.981 250.391 143.922 1.00 37.34 C ATOM 3461 C SER V 96 219.351 249.801 145.177 1.00 43.52 C ATOM 3462 O SER V 96 218.983 250.533 146.104 1.00 40.18 O ATOM 3463 CB SER V 96 219.000 250.339 142.752 1.00 25.97 C ATOM 3464 OG SER V 96 219.509 251.049 141.639 1.00 38.14 O ATOM 3465 N GLU V 97 219.223 248.472 145.229 1.00 33.97 N ATOM 3466 CA GLU V 97 218.599 247.850 146.390 1.00 36.42 C ATOM 3467 C GLU V 97 219.420 248.077 147.651 1.00 34.00 C ATOM 3468 O GLU V 97 218.864 248.395 148.707 1.00 39.26 O ATOM 3469 CB GLU V 97 218.386 246.359 146.147 1.00 38.45 C ATOM 3470 CG GLU V 97 217.343 246.055 145.086 1.00 51.50 C ATOM 3471 CD GLU V 97 217.177 244.571 144.850 1.00 64.70 C ATOM 3472 OE1 GLU V 97 217.982 243.793 145.400 1.00 69.62 O ATOM 3473 OE2 GLU V 97 216.244 244.180 144.119 1.00 55.49 O ATOM 3474 N ALA V 98 220.744 247.933 147.564 1.00 37.00 N ATOM 3475 CA ALA V 98 221.576 248.180 148.739 1.00 31.73 C ATOM 3476 C ALA V 98 221.468 249.630 149.198 1.00 37.76 C ATOM 3477 O ALA V 98 221.376 249.908 150.402 1.00 37.75 O ATOM 3478 CB ALA V 98 223.029 247.817 148.442 1.00 20.51 C ATOM 3479 N TYR V 99 221.464 250.569 148.245 1.00 40.58 N ATOM 3480 CA TYR V 99 221.331 251.979 148.593 1.00 36.81 C ATOM 3481 C TYR V 99 220.008 252.256 149.295 1.00 45.22 C ATOM 3482 O TYR V 99 219.969 252.985 150.294 1.00 41.03 O ATOM 3483 CB TYR V 99 221.465 252.838 147.336 1.00 37.36 C ATOM 3484 CG TYR V 99 221.209 254.308 147.564 1.00 44.28 C ATOM 3485 CD1 TYR V 99 222.154 255.108 148.189 1.00 33.01 C ATOM 3486 CD2 TYR V 99 220.028 254.900 147.138 1.00 42.75 C ATOM 3487 CE1 TYR V 99 221.926 256.453 148.394 1.00 40.83 C ATOM 3488 CE2 TYR V 99 219.792 256.243 147.337 1.00 43.90 C ATOM 3489 CZ TYR V 99 220.745 257.015 147.966 1.00 58.11 C ATOM 3490 OH TYR V 99 220.513 258.357 148.169 1.00 69.71 O ATOM 3491 N LEU V 100 218.912 251.680 148.796 1.00 28.27 N ATOM 3492 CA LEU V 100 217.622 251.896 149.444 1.00 34.99 C ATOM 3493 C LEU V 100 217.555 251.227 150.809 1.00 30.41 C ATOM 3494 O LEU V 100 216.900 251.748 151.719 1.00 21.69 O ATOM 3495 CB LEU V 100 216.490 251.399 148.548 1.00 32.25 C ATOM 3496 CG LEU V 100 216.315 252.169 147.239 1.00 29.89 C ATOM 3497 CD1 LEU V 100 215.237 251.536 146.379 1.00 23.10 C ATOM 3498 CD2 LEU V 100 215.995 253.625 147.522 1.00 27.08 C ATOM 3499 N VAL V 101 218.222 250.084 150.978 1.00 26.78 N ATOM 3500 CA VAL V 101 218.252 249.432 152.285 1.00 23.78 C ATOM 3501 C VAL V 101 218.973 250.312 153.299 1.00 34.59 C ATOM 3502 O VAL V 101 218.486 250.528 154.416 1.00 45.57 O ATOM 3503 CB VAL V 101 218.897 248.039 152.186 1.00 27.29 C ATOM 3504 CG1 VAL V 101 219.121 247.469 153.572 1.00 23.57 C ATOM 3505 CG2 VAL V 101 218.008 247.108 151.389 1.00 23.91 C ATOM 3506 N ALA V 102 220.144 250.838 152.925 1.00 26.80 N ATOM 3507 CA ALA V 102 220.855 251.738 153.829 1.00 18.74 C ATOM 3508 C ALA V 102 220.032 252.989 154.119 1.00 28.61 C ATOM 3509 O ALA V 102 219.975 253.455 155.266 1.00 23.21 O ATOM 3510 CB ALA V 102 222.213 252.113 153.236 1.00 31.23 C ATOM 3511 N LEU V 103 219.379 253.535 153.091 1.00 33.95 N ATOM 3512 CA LEU V 103 218.549 254.723 153.278 1.00 21.01 C ATOM 3513 C LEU V 103 217.420 254.458 154.266 1.00 28.23 C ATOM 3514 O LEU V 103 217.083 255.325 155.079 1.00 33.64 O ATOM 3515 CB LEU V 103 217.992 255.187 151.934 1.00 23.81 C ATOM 3516 CG LEU V 103 217.062 256.398 151.964 1.00 19.93 C ATOM 3517 CD1 LEU V 103 217.807 257.618 152.470 1.00 18.42 C ATOM 3518 CD2 LEU V 103 216.475 256.655 150.588 1.00 24.86 C ATOM 3519 N PHE V 104 216.821 253.266 154.210 1.00 21.12 N ATOM 3520 CA PHE V 104 215.784 252.923 155.177 1.00 23.40 C ATOM 3521 C PHE V 104 216.351 252.611 156.553 1.00 27.69 C ATOM 3522 O PHE V 104 215.635 252.760 157.549 1.00 29.53 O ATOM 3523 CB PHE V 104 214.954 251.747 154.663 1.00 23.10 C ATOM 3524 CG PHE V 104 214.081 252.090 153.492 1.00 34.19 C ATOM 3525 CD1 PHE V 104 213.712 253.402 153.251 1.00 31.32 C ATOM 3526 CD2 PHE V 104 213.639 251.108 152.626 1.00 32.92 C ATOM 3527 CE1 PHE V 104 212.910 253.725 152.175 1.00 27.82 C ATOM 3528 CE2 PHE V 104 212.837 251.426 151.548 1.00 24.31 C ATOM 3529 CZ PHE V 104 212.473 252.737 151.323 1.00 20.66 C ATOM 3530 N GLU V 105 217.613 252.187 156.640 1.00 24.59 N ATOM 3531 CA GLU V 105 218.247 252.049 157.947 1.00 26.10 C ATOM 3532 C GLU V 105 218.400 253.408 158.617 1.00 39.46 C ATOM 3533 O GLU V 105 217.976 253.600 159.766 1.00 39.03 O ATOM 3534 CB GLU V 105 219.606 251.364 157.809 1.00 24.01 C ATOM 3535 CG GLU V 105 219.539 249.906 157.390 1.00 42.40 C ATOM 3536 CD GLU V 105 220.913 249.290 157.210 1.00 58.46 C ATOM 3537 OE1 GLU V 105 221.909 250.043 157.224 1.00 63.33 O ATOM 3538 OE2 GLU V 105 220.997 248.054 157.054 1.00 60.02 O ATOM 3539 N ASP V 106 219.000 254.370 157.912 1.00 37.96 N ATOM 3540 CA ASP V 106 219.183 255.695 158.495 1.00 30.73 C ATOM 3541 C ASP V 106 217.843 256.378 158.748 1.00 36.40 C ATOM 3542 O ASP V 106 217.664 257.054 159.770 1.00 44.70 O ATOM 3543 CB ASP V 106 220.065 256.548 157.584 1.00 52.30 C ATOM 3544 CG ASP V 106 221.500 256.059 157.543 1.00 75.45 C ATOM 3545 OD1 ASP V 106 221.881 255.261 158.424 1.00 84.95 O ATOM 3546 OD2 ASP V 106 222.245 256.469 156.630 1.00 74.96 O ATOM 3547 N THR V 107 216.886 256.202 157.835 1.00 37.22 N ATOM 3548 CA THR V 107 215.547 256.737 158.052 1.00 33.57 C ATOM 3549 C THR V 107 214.916 256.136 159.301 1.00 41.17 C ATOM 3550 O THR V 107 214.267 256.844 160.082 1.00 33.36 O ATOM 3551 CB THR V 107 214.671 256.474 156.828 1.00 25.50 C ATOM 3552 OG1 THR V 107 215.232 257.134 155.688 1.00 33.77 O ATOM 3553 CG2 THR V 107 213.263 256.991 157.058 1.00 30.45 C ATOM 3554 N ASN V 108 215.106 254.832 159.517 1.00 42.94 N ATOM 3555 CA ASN V 108 214.618 254.212 160.743 1.00 33.70 C ATOM 3556 C ASN V 108 215.292 254.815 161.965 1.00 41.51 C ATOM 3557 O ASN V 108 214.649 255.007 163.006 1.00 41.01 O ATOM 3558 CB ASN V 108 214.845 252.702 160.697 1.00 33.30 C ATOM 3559 CG ASN V 108 214.160 251.981 161.838 1.00 45.44 C ATOM 3560 OD1 ASN V 108 213.120 252.419 162.329 1.00 43.52 O ATOM 3561 ND2 ASN V 108 214.745 250.871 162.272 1.00 56.22 N ATOM 3562 N LEU V 109 216.589 255.121 161.866 1.00 29.06 N ATOM 3563 CA LEU V 109 217.271 255.778 162.975 1.00 31.91 C ATOM 3564 C LEU V 109 216.662 257.143 163.267 1.00 46.18 C ATOM 3565 O LEU V 109 216.527 257.535 164.432 1.00 47.62 O ATOM 3566 CB LEU V 109 218.764 255.908 162.677 1.00 45.16 C ATOM 3567 CG LEU V 109 219.550 254.598 162.586 1.00 50.82 C ATOM 3568 CD1 LEU V 109 220.985 254.864 162.160 1.00 39.51 C ATOM 3569 CD2 LEU V 109 219.509 253.864 163.915 1.00 27.87 C ATOM 3570 N CYS V 110 216.283 257.882 162.221 1.00 39.29 N ATOM 3571 CA CYS V 110 215.650 259.181 162.429 1.00 30.85 C ATOM 3572 C CYS V 110 214.286 259.029 163.093 1.00 34.64 C ATOM 3573 O CYS V 110 213.984 259.714 164.080 1.00 34.25 O ATOM 3574 CB CYS V 110 215.521 259.921 161.100 1.00 58.67 C ATOM 3575 SG CYS V 110 217.092 260.360 160.330 1.00 66.63 S ATOM 3576 N ALA V 111 213.449 258.132 162.565 1.00 31.28 N ATOM 3577 CA ALA V 111 212.120 257.931 163.132 1.00 30.71 C ATOM 3578 C ALA V 111 212.201 257.507 164.592 1.00 35.40 C ATOM 3579 O ALA V 111 211.448 258.008 165.434 1.00 37.71 O ATOM 3580 CB ALA V 111 211.352 256.893 162.316 1.00 36.30 C ATOM 3581 N ILE V 112 213.113 256.588 164.912 1.00 32.79 N ATOM 3582 CA ILE V 112 213.272 256.165 166.299 1.00 34.04 C ATOM 3583 C ILE V 112 213.807 257.305 167.153 1.00 37.15 C ATOM 3584 O ILE V 112 213.445 257.432 168.330 1.00 43.81 O ATOM 3585 CB ILE V 112 214.173 254.918 166.365 1.00 55.71 C ATOM 3586 CG1 ILE V 112 213.468 253.738 165.698 1.00 48.41 C ATOM 3587 CG2 ILE V 112 214.531 254.581 167.804 1.00 41.56 C ATOM 3588 CD1 ILE V 112 214.352 252.539 165.491 1.00 48.99 C ATOM 3589 N HIS V 113 214.656 258.167 166.584 1.00 38.34 N ATOM 3590 CA HIS V 113 215.110 259.333 167.333 1.00 36.30 C ATOM 3591 C HIS V 113 213.964 260.290 167.631 1.00 41.05 C ATOM 3592 O HIS V 113 214.011 261.028 168.622 1.00 48.99 O ATOM 3593 CB HIS V 113 216.209 260.069 166.571 1.00 17.17 C ATOM 3594 CG HIS V 113 216.747 261.258 167.305 1.00 26.62 C ATOM 3595 ND1 HIS V 113 217.412 261.150 168.506 1.00 28.21 N ATOM 3596 CD2 HIS V 113 216.694 262.580 167.022 1.00 33.04 C ATOM 3597 CE1 HIS V 113 217.760 262.354 168.924 1.00 34.61 C ATOM 3598 NE2 HIS V 113 217.338 263.240 168.040 1.00 35.64 N ATOM 3599 N ALA V 114 212.928 260.288 166.798 1.00 58.10 N ATOM 3600 CA ALA V 114 211.765 261.137 167.022 1.00 51.64 C ATOM 3601 C ALA V 114 210.765 260.521 167.989 1.00 63.78 C ATOM 3602 O ALA V 114 209.691 261.098 168.189 1.00 54.40 O ATOM 3603 CB ALA V 114 211.076 261.451 165.693 1.00 40.96 C