>>6W4E:HELIX    8 AA8 HIS D  517  LEU D  595  1                                  79    
HLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 8 AA8 HIS D 517 LEU D 595 1 79 ATOM 3229 N HIS D 517 33.613 -9.573 38.289 1.00 10.00 N ATOM 3230 CA HIS D 517 32.740 -10.398 37.465 1.00 10.00 C ATOM 3231 C HIS D 517 33.263 -10.475 36.042 1.00 10.00 C ATOM 3232 O HIS D 517 33.700 -11.532 35.585 1.00 10.00 O ATOM 3233 CB HIS D 517 31.312 -9.834 37.439 1.00 10.00 C ATOM 3234 CG HIS D 517 30.494 -10.110 38.666 1.00 10.00 C ATOM 3235 ND1 HIS D 517 29.133 -9.928 38.664 1.00 10.00 N ATOM 3236 CD2 HIS D 517 30.886 -10.524 39.896 1.00 10.00 C ATOM 3237 CE1 HIS D 517 28.724 -10.232 39.882 1.00 10.00 C ATOM 3238 NE2 HIS D 517 29.747 -10.596 40.660 1.00 10.00 N ATOM 3239 H HIS D 517 33.741 -8.629 38.054 1.00 10.00 H ATOM 3240 HE2 HIS D 517 29.698 -10.856 41.602 1.00 10.00 H ATOM 3241 N LEU D 518 33.229 -9.340 35.355 1.00 10.00 N ATOM 3242 CA LEU D 518 33.679 -9.249 33.974 1.00 10.00 C ATOM 3243 C LEU D 518 35.181 -9.445 33.856 1.00 10.00 C ATOM 3244 O LEU D 518 35.627 -10.308 33.108 1.00 10.00 O ATOM 3245 CB LEU D 518 33.275 -7.911 33.356 1.00 10.00 C ATOM 3246 CG LEU D 518 31.782 -7.704 33.099 1.00 10.00 C ATOM 3247 CD1 LEU D 518 31.540 -6.318 32.519 1.00 10.00 C ATOM 3248 CD2 LEU D 518 31.241 -8.780 32.163 1.00 10.00 C ATOM 3249 H LEU D 518 32.902 -8.532 35.796 1.00 10.00 H ATOM 3250 N ALA D 519 35.954 -8.651 34.602 1.00 10.00 N ATOM 3251 CA ALA D 519 37.416 -8.733 34.565 1.00 10.00 C ATOM 3252 C ALA D 519 37.940 -10.167 34.725 1.00 10.00 C ATOM 3253 O ALA D 519 38.633 -10.668 33.836 1.00 10.00 O ATOM 3254 CB ALA D 519 38.059 -7.773 35.556 1.00 10.00 C ATOM 3255 H ALA D 519 35.530 -7.987 35.188 1.00 10.00 H ATOM 3256 N PRO D 520 37.623 -10.864 35.839 1.00 10.00 N ATOM 3257 CA PRO D 520 38.080 -12.243 36.043 1.00 10.00 C ATOM 3258 C PRO D 520 37.541 -13.176 34.963 1.00 10.00 C ATOM 3259 O PRO D 520 38.189 -14.154 34.595 1.00 10.00 O ATOM 3260 CB PRO D 520 37.501 -12.621 37.413 1.00 10.00 C ATOM 3261 CG PRO D 520 37.251 -11.317 38.084 1.00 10.00 C ATOM 3262 CD PRO D 520 36.831 -10.382 36.987 1.00 10.00 C ATOM 3263 N TYR D 521 36.358 -12.864 34.438 1.00 10.00 N ATOM 3264 CA TYR D 521 35.765 -13.689 33.399 1.00 10.00 C ATOM 3265 C TYR D 521 36.520 -13.525 32.086 1.00 10.00 C ATOM 3266 O TYR D 521 36.780 -14.508 31.392 1.00 10.00 O ATOM 3267 CB TYR D 521 34.274 -13.411 33.213 1.00 10.00 C ATOM 3268 CG TYR D 521 33.585 -14.490 32.416 1.00 10.00 C ATOM 3269 CD1 TYR D 521 33.661 -15.819 32.814 1.00 10.00 C ATOM 3270 CD2 TYR D 521 32.869 -14.192 31.265 1.00 10.00 C ATOM 3271 CE1 TYR D 521 33.053 -16.822 32.090 1.00 10.00 C ATOM 3272 CE2 TYR D 521 32.254 -15.191 30.533 1.00 10.00 C ATOM 3273 CZ TYR D 521 32.352 -16.505 30.950 1.00 10.00 C ATOM 3274 OH TYR D 521 31.747 -17.506 30.226 1.00 10.00 O ATOM 3275 H TYR D 521 35.883 -12.062 34.745 1.00 10.00 H ATOM 3276 HH TYR D 521 31.594 -17.197 29.326 1.00 10.00 H ATOM 3277 N SER D 522 36.877 -12.288 31.745 1.00 10.00 N ATOM 3278 CA SER D 522 37.630 -12.041 30.523 1.00 10.00 C ATOM 3279 C SER D 522 39.002 -12.692 30.632 1.00 10.00 C ATOM 3280 O SER D 522 39.602 -13.080 29.630 1.00 10.00 O ATOM 3281 CB SER D 522 37.742 -10.544 30.203 1.00 10.00 C ATOM 3282 OG SER D 522 37.789 -9.755 31.381 1.00 10.00 O ATOM 3283 H SER D 522 36.620 -11.529 32.322 1.00 10.00 H ATOM 3284 HG SER D 522 38.293 -10.216 32.062 1.00 10.00 H ATOM 3285 N ASP D 523 39.476 -12.835 31.869 1.00 10.00 N ATOM 3286 CA ASP D 523 40.759 -13.467 32.128 1.00 10.00 C ATOM 3287 C ASP D 523 40.629 -14.960 31.852 1.00 10.00 C ATOM 3288 O ASP D 523 41.519 -15.576 31.269 1.00 10.00 O ATOM 3289 CB ASP D 523 41.205 -13.213 33.567 1.00 10.00 C ATOM 3290 CG ASP D 523 42.699 -13.348 33.738 1.00 10.00 C ATOM 3291 OD1 ASP D 523 43.447 -12.885 32.847 1.00 10.00 O ATOM 3292 OD2 ASP D 523 43.137 -13.902 34.766 1.00 10.00 O1- ATOM 3293 H ASP D 523 38.945 -12.510 32.628 1.00 10.00 H ATOM 3294 N GLU D 524 39.496 -15.523 32.264 1.00 10.00 N ATOM 3295 CA GLU D 524 39.206 -16.931 32.024 1.00 10.00 C ATOM 3296 C GLU D 524 39.035 -17.135 30.524 1.00 10.00 C ATOM 3297 O GLU D 524 39.510 -18.119 29.949 1.00 10.00 O ATOM 3298 CB GLU D 524 37.917 -17.343 32.743 1.00 10.00 C ATOM 3299 CG GLU D 524 38.135 -18.058 34.064 1.00 10.00 C ATOM 3300 CD GLU D 524 37.358 -17.433 35.203 1.00 10.00 C ATOM 3301 OE1 GLU D 524 36.275 -16.863 34.962 1.00 10.00 O ATOM 3302 OE2 GLU D 524 37.827 -17.517 36.358 1.00 10.00 O1- ATOM 3303 H GLU D 524 38.841 -14.976 32.750 1.00 10.00 H ATOM 3304 N LEU D 525 38.366 -16.171 29.900 1.00 10.00 N ATOM 3305 CA LEU D 525 38.120 -16.192 28.468 1.00 10.00 C ATOM 3306 C LEU D 525 39.430 -16.125 27.697 1.00 10.00 C ATOM 3307 O LEU D 525 39.531 -16.676 26.611 1.00 10.00 O ATOM 3308 CB LEU D 525 37.191 -15.048 28.050 1.00 10.00 C ATOM 3309 CG LEU D 525 35.717 -15.208 28.425 1.00 10.00 C ATOM 3310 CD1 LEU D 525 34.965 -13.906 28.209 1.00 10.00 C ATOM 3311 CD2 LEU D 525 35.079 -16.335 27.628 1.00 10.00 C ATOM 3312 H LEU D 525 38.018 -15.421 30.430 1.00 10.00 H ATOM 3313 N ARG D 526 40.432 -15.456 28.266 1.00 10.00 N ATOM 3314 CA ARG D 526 41.741 -15.352 27.624 1.00 10.00 C ATOM 3315 C ARG D 526 42.323 -16.747 27.415 1.00 10.00 C ATOM 3316 O ARG D 526 42.890 -17.049 26.364 1.00 10.00 O ATOM 3317 CB ARG D 526 42.704 -14.504 28.464 1.00 10.00 C ATOM 3318 CG ARG D 526 42.496 -13.000 28.355 1.00 10.00 C ATOM 3319 CD ARG D 526 43.219 -12.261 29.474 1.00 10.00 C ATOM 3320 NE ARG D 526 43.004 -10.818 29.398 1.00 10.00 N ATOM 3321 CZ ARG D 526 42.763 -10.033 30.454 1.00 10.00 C ATOM 3322 NH1 ARG D 526 42.704 -10.547 31.679 1.00 10.00 N1+ ATOM 3323 NH2 ARG D 526 42.576 -8.732 30.279 1.00 10.00 N ATOM 3324 H ARG D 526 40.286 -15.018 29.134 1.00 10.00 H ATOM 3325 HE ARG D 526 43.058 -10.406 28.505 1.00 10.00 H ATOM 3326 HH11 ARG D 526 42.510 -9.953 32.467 1.00 10.00 H ATOM 3327 HH12 ARG D 526 42.870 -11.532 31.829 1.00 10.00 H ATOM 3328 HH21 ARG D 526 42.389 -8.137 31.067 1.00 10.00 H ATOM 3329 HH22 ARG D 526 42.629 -8.338 29.360 1.00 10.00 H ATOM 3330 N GLN D 527 42.147 -17.599 28.418 1.00 10.00 N ATOM 3331 CA GLN D 527 42.638 -18.971 28.363 1.00 10.00 C ATOM 3332 C GLN D 527 41.849 -19.773 27.334 1.00 10.00 C ATOM 3333 O GLN D 527 42.417 -20.563 26.572 1.00 10.00 O ATOM 3334 CB GLN D 527 42.518 -19.619 29.741 1.00 10.00 C ATOM 3335 CG GLN D 527 43.184 -18.815 30.843 1.00 10.00 C ATOM 3336 CD GLN D 527 42.849 -19.319 32.232 1.00 10.00 C ATOM 3337 OE1 GLN D 527 43.667 -19.232 33.144 1.00 10.00 O ATOM 3338 NE2 GLN D 527 41.643 -19.841 32.406 1.00 10.00 N ATOM 3339 H GLN D 527 41.671 -17.296 29.223 1.00 10.00 H ATOM 3340 HE21 GLN D 527 41.031 -19.875 31.638 1.00 10.00 H ATOM 3341 HE22 GLN D 527 41.407 -20.173 33.298 1.00 10.00 H ATOM 3342 N ARG D 528 40.538 -19.550 27.316 1.00 10.00 N ATOM 3343 CA ARG D 528 39.653 -20.235 26.381 1.00 10.00 C ATOM 3344 C ARG D 528 39.935 -19.777 24.955 1.00 10.00 C ATOM 3345 O ARG D 528 39.971 -20.583 24.032 1.00 10.00 O ATOM 3346 CB ARG D 528 38.184 -19.993 26.744 1.00 10.00 C ATOM 3347 CG ARG D 528 37.821 -20.424 28.154 1.00 10.00 C ATOM 3348 CD ARG D 528 36.358 -20.155 28.460 1.00 10.00 C ATOM 3349 NE ARG D 528 36.087 -20.159 29.901 1.00 10.00 N ATOM 3350 CZ ARG D 528 34.994 -19.632 30.458 1.00 10.00 C ATOM 3351 NH1 ARG D 528 34.065 -19.059 29.702 1.00 10.00 N1+ ATOM 3352 NH2 ARG D 528 34.817 -19.717 31.770 1.00 10.00 N ATOM 3353 H ARG D 528 40.155 -18.913 27.960 1.00 10.00 H ATOM 3354 HE ARG D 528 36.757 -20.581 30.486 1.00 10.00 H ATOM 3355 HH11 ARG D 528 33.242 -18.662 30.126 1.00 10.00 H ATOM 3356 HH12 ARG D 528 34.169 -19.027 28.699 1.00 10.00 H ATOM 3357 HH21 ARG D 528 35.509 -20.186 32.347 1.00 10.00 H ATOM 3358 HH22 ARG D 528 34.002 -19.328 32.198 1.00 10.00 H ATOM 3359 N LEU D 529 40.154 -18.474 24.793 1.00 10.00 N ATOM 3360 CA LEU D 529 40.459 -17.903 23.490 1.00 10.00 C ATOM 3361 C LEU D 529 41.777 -18.469 22.980 1.00 10.00 C ATOM 3362 O LEU D 529 41.919 -18.757 21.797 1.00 10.00 O ATOM 3363 CB LEU D 529 40.533 -16.376 23.559 1.00 10.00 C ATOM 3364 CG LEU D 529 39.212 -15.635 23.798 1.00 10.00 C ATOM 3365 CD1 LEU D 529 39.452 -14.135 23.895 1.00 10.00 C ATOM 3366 CD2 LEU D 529 38.204 -15.956 22.706 1.00 10.00 C ATOM 3367 H LEU D 529 40.102 -17.879 25.576 1.00 10.00 H ATOM 3368 N ALA D 530 42.733 -18.640 23.889 1.00 10.00 N ATOM 3369 CA ALA D 530 44.036 -19.196 23.538 1.00 10.00 C ATOM 3370 C ALA D 530 43.875 -20.631 23.045 1.00 10.00 C ATOM 3371 O ALA D 530 44.558 -21.063 22.114 1.00 10.00 O ATOM 3372 CB ALA D 530 44.972 -19.152 24.737 1.00 10.00 C ATOM 3373 H ALA D 530 42.559 -18.378 24.822 1.00 10.00 H ATOM 3374 N ALA D 531 42.959 -21.358 23.672 1.00 10.00 N ATOM 3375 CA ALA D 531 42.685 -22.741 23.291 1.00 10.00 C ATOM 3376 C ALA D 531 41.957 -22.785 21.955 1.00 10.00 C ATOM 3377 O ALA D 531 42.276 -23.597 21.084 1.00 10.00 O ATOM 3378 CB ALA D 531 41.863 -23.438 24.364 1.00 10.00 C ATOM 3379 H ALA D 531 42.457 -20.954 24.414 1.00 10.00 H ATOM 3380 N ARG D 532 40.978 -21.902 21.802 1.00 10.00 N ATOM 3381 CA ARG D 532 40.205 -21.814 20.574 1.00 10.00 C ATOM 3382 C ARG D 532 41.108 -21.394 19.424 1.00 10.00 C ATOM 3383 O ARG D 532 41.078 -21.989 18.348 1.00 10.00 O ATOM 3384 CB ARG D 532 39.047 -20.825 20.732 1.00 10.00 C ATOM 3385 CG ARG D 532 37.813 -21.180 19.911 1.00 10.00 C ATOM 3386 CD ARG D 532 36.612 -20.349 20.328 1.00 10.00 C ATOM 3387 NE ARG D 532 36.347 -20.434 21.766 1.00 10.00 N ATOM 3388 CZ ARG D 532 35.471 -19.670 22.409 1.00 10.00 C ATOM 3389 NH1 ARG D 532 34.762 -18.762 21.749 1.00 10.00 N1+ ATOM 3390 NH2 ARG D 532 35.315 -19.818 23.716 1.00 10.00 N ATOM 3391 H ARG D 532 40.757 -21.300 22.550 1.00 10.00 H ATOM 3392 HE ARG D 532 36.851 -21.118 22.282 1.00 10.00 H ATOM 3393 HH11 ARG D 532 34.097 -18.188 22.241 1.00 10.00 H ATOM 3394 HH12 ARG D 532 34.879 -18.643 20.761 1.00 10.00 H ATOM 3395 HH21 ARG D 532 34.659 -19.254 24.219 1.00 10.00 H ATOM 3396 HH22 ARG D 532 35.866 -20.514 24.210 1.00 10.00 H ATOM 3397 N LEU D 533 41.923 -20.370 19.665 1.00 10.00 N ATOM 3398 CA LEU D 533 42.855 -19.880 18.659 1.00 10.00 C ATOM 3399 C LEU D 533 43.866 -20.960 18.316 1.00 10.00 C ATOM 3400 O LEU D 533 44.334 -21.049 17.185 1.00 10.00 O ATOM 3401 CB LEU D 533 43.573 -18.615 19.146 1.00 10.00 C ATOM 3402 CG LEU D 533 42.789 -17.302 19.031 1.00 10.00 C ATOM 3403 CD1 LEU D 533 43.528 -16.174 19.733 1.00 10.00 C ATOM 3404 CD2 LEU D 533 42.535 -16.949 17.573 1.00 10.00 C ATOM 3405 H LEU D 533 41.888 -19.924 20.545 1.00 10.00 H ATOM 3406 N GLU D 534 44.196 -21.791 19.299 1.00 10.00 N ATOM 3407 CA GLU D 534 45.130 -22.883 19.088 1.00 10.00 C ATOM 3408 C GLU D 534 44.534 -23.867 18.091 1.00 10.00 C ATOM 3409 O GLU D 534 45.221 -24.342 17.192 1.00 10.00 O ATOM 3410 CB GLU D 534 45.443 -23.585 20.406 1.00 10.00 C ATOM 3411 CG GLU D 534 46.735 -24.377 20.392 1.00 10.00 C ATOM 3412 CD GLU D 534 47.372 -24.448 21.761 1.00 10.00 C ATOM 3413 OE1 GLU D 534 48.219 -23.584 22.071 1.00 10.00 O ATOM 3414 OE2 GLU D 534 47.014 -25.356 22.541 1.00 10.00 O1- ATOM 3415 H GLU D 534 43.800 -21.660 20.188 1.00 10.00 H ATOM 3416 N ALA D 535 43.242 -24.143 18.242 1.00 10.00 N ATOM 3417 CA ALA D 535 42.544 -25.045 17.343 1.00 10.00 C ATOM 3418 C ALA D 535 42.475 -24.416 15.959 1.00 10.00 C ATOM 3419 O ALA D 535 42.654 -25.090 14.948 1.00 10.00 O ATOM 3420 CB ALA D 535 41.147 -25.339 17.868 1.00 10.00 C ATOM 3421 H ALA D 535 42.748 -23.731 18.979 1.00 10.00 H ATOM 3422 N LEU D 536 42.234 -23.106 15.927 1.00 10.00 N ATOM 3423 CA LEU D 536 42.159 -22.362 14.674 1.00 10.00 C ATOM 3424 C LEU D 536 43.518 -22.348 13.986 1.00 10.00 C ATOM 3425 O LEU D 536 43.606 -22.320 12.763 1.00 10.00 O ATOM 3426 CB LEU D 536 41.679 -20.928 14.915 1.00 10.00 C ATOM 3427 CG LEU D 536 40.319 -20.775 15.598 1.00 10.00 C ATOM 3428 CD1 LEU D 536 39.980 -19.304 15.798 1.00 10.00 C ATOM 3429 CD2 LEU D 536 39.227 -21.482 14.811 1.00 10.00 C ATOM 3430 H LEU D 536 42.091 -22.630 16.775 1.00 10.00 H ATOM 3431 N LYS D 537 44.577 -22.357 14.781 1.00 10.00 N ATOM 3432 CA LYS D 537 45.930 -22.363 14.249 1.00 10.00 C ATOM 3433 C LYS D 537 46.320 -23.767 13.806 1.00 10.00 C ATOM 3434 O LYS D 537 46.951 -23.943 12.765 1.00 10.00 O ATOM 3435 CB LYS D 537 46.920 -21.843 15.292 1.00 10.00 C ATOM 3436 CG LYS D 537 46.870 -20.335 15.502 1.00 10.00 C ATOM 3437 CD LYS D 537 47.911 -19.867 16.510 1.00 10.00 C ATOM 3438 CE LYS D 537 47.620 -20.394 17.912 1.00 10.00 C ATOM 3439 NZ LYS D 537 48.573 -19.855 18.914 1.00 10.00 N1+ ATOM 3440 H LYS D 537 44.447 -22.346 15.757 1.00 10.00 H ATOM 3441 HZ1 LYS D 537 48.417 -18.836 19.046 1.00 10.00 H ATOM 3442 HZ2 LYS D 537 49.550 -19.999 18.592 1.00 10.00 H ATOM 3443 HZ3 LYS D 537 48.444 -20.336 19.828 1.00 10.00 H ATOM 3444 N GLU D 538 45.939 -24.756 14.606 1.00 10.00 N ATOM 3445 CA GLU D 538 46.238 -26.151 14.307 1.00 10.00 C ATOM 3446 C GLU D 538 45.501 -26.600 13.053 1.00 10.00 C ATOM 3447 O GLU D 538 46.120 -27.025 12.076 1.00 10.00 O ATOM 3448 CB GLU D 538 45.845 -27.047 15.483 1.00 10.00 C ATOM 3449 CG GLU D 538 46.476 -28.431 15.442 1.00 10.00 C ATOM 3450 CD GLU D 538 47.971 -28.392 15.679 1.00 10.00 C ATOM 3451 OE1 GLU D 538 48.411 -28.770 16.784 1.00 10.00 O ATOM 3452 OE2 GLU D 538 48.718 -27.982 14.762 1.00 10.00 O1- ATOM 3453 H GLU D 538 45.450 -24.540 15.435 1.00 10.00 H ATOM 3454 N ASN D 539 44.177 -26.497 13.084 1.00 10.00 N ATOM 3455 CA ASN D 539 43.360 -26.889 11.946 1.00 10.00 C ATOM 3456 C ASN D 539 43.598 -25.934 10.799 1.00 10.00 C ATOM 3457 O ASN D 539 43.601 -26.329 9.642 1.00 10.00 O ATOM 3458 CB ASN D 539 41.878 -26.901 12.302 1.00 10.00 C ATOM 3459 CG ASN D 539 41.567 -27.754 13.510 1.00 10.00 C ATOM 3460 OD1 ASN D 539 42.275 -28.712 13.817 1.00 10.00 O ATOM 3461 ND2 ASN D 539 40.497 -27.407 14.197 1.00 10.00 N ATOM 3462 H ASN D 539 43.738 -26.148 13.895 1.00 10.00 H ATOM 3463 HD21 ASN D 539 39.982 -26.626 13.883 1.00 10.00 H ATOM 3464 HD22 ASN D 539 40.261 -27.932 14.986 1.00 10.00 H ATOM 3465 N GLY D 540 43.807 -24.669 11.137 1.00 10.00 N ATOM 3466 CA GLY D 540 44.063 -23.665 10.126 1.00 10.00 C ATOM 3467 C GLY D 540 45.346 -23.944 9.381 1.00 10.00 C ATOM 3468 O GLY D 540 45.381 -23.869 8.158 1.00 10.00 O ATOM 3469 H GLY D 540 43.785 -24.414 12.085 1.00 10.00 H ATOM 3470 N GLY D 541 46.407 -24.273 10.120 1.00 10.00 N ATOM 3471 CA GLY D 541 47.681 -24.582 9.501 1.00 10.00 C ATOM 3472 C GLY D 541 47.562 -25.794 8.606 1.00 10.00 C ATOM 3473 O GLY D 541 48.092 -25.817 7.494 1.00 10.00 O ATOM 3474 H GLY D 541 46.323 -24.296 11.099 1.00 10.00 H ATOM 3475 N ALA D 542 46.844 -26.800 9.090 1.00 10.00 N ATOM 3476 CA ALA D 542 46.615 -28.013 8.327 1.00 10.00 C ATOM 3477 C ALA D 542 45.797 -27.671 7.090 1.00 10.00 C ATOM 3478 O ALA D 542 46.090 -28.135 5.990 1.00 10.00 O ATOM 3479 CB ALA D 542 45.890 -29.041 9.183 1.00 10.00 C ATOM 3480 H ALA D 542 46.460 -26.723 9.990 1.00 10.00 H ATOM 3481 N ARG D 543 44.785 -26.826 7.284 1.00 10.00 N ATOM 3482 CA ARG D 543 43.922 -26.389 6.197 1.00 10.00 C ATOM 3483 C ARG D 543 44.711 -25.595 5.174 1.00 10.00 C ATOM 3484 O ARG D 543 44.437 -25.671 3.991 1.00 10.00 O ATOM 3485 CB ARG D 543 42.747 -25.562 6.713 1.00 10.00 C ATOM 3486 CG ARG D 543 41.590 -26.398 7.231 1.00 10.00 C ATOM 3487 CD ARG D 543 40.377 -25.538 7.535 1.00 10.00 C ATOM 3488 NE ARG D 543 39.256 -26.331 8.034 1.00 10.00 N ATOM 3489 CZ ARG D 543 38.803 -26.262 9.282 1.00 10.00 C ATOM 3490 NH1 ARG D 543 39.384 -25.446 10.145 1.00 10.00 N1+ ATOM 3491 NH2 ARG D 543 37.772 -27.002 9.666 1.00 10.00 N ATOM 3492 H ARG D 543 44.610 -26.495 8.189 1.00 10.00 H ATOM 3493 HE ARG D 543 38.830 -26.953 7.401 1.00 10.00 H ATOM 3494 HH11 ARG D 543 39.044 -25.392 11.097 1.00 10.00 H ATOM 3495 HH12 ARG D 543 40.157 -24.878 9.864 1.00 10.00 H ATOM 3496 HH21 ARG D 543 37.320 -27.623 9.022 1.00 10.00 H ATOM 3497 HH22 ARG D 543 37.438 -26.940 10.621 1.00 10.00 H ATOM 3498 N LEU D 544 45.684 -24.817 5.638 1.00 10.00 N ATOM 3499 CA LEU D 544 46.522 -24.038 4.735 1.00 10.00 C ATOM 3500 C LEU D 544 47.278 -24.988 3.819 1.00 10.00 C ATOM 3501 O LEU D 544 47.429 -24.731 2.626 1.00 10.00 O ATOM 3502 CB LEU D 544 47.493 -23.138 5.508 1.00 10.00 C ATOM 3503 CG LEU D 544 46.862 -21.993 6.303 1.00 10.00 C ATOM 3504 CD1 LEU D 544 47.927 -21.202 7.043 1.00 10.00 C ATOM 3505 CD2 LEU D 544 46.061 -21.083 5.387 1.00 10.00 C ATOM 3506 H LEU D 544 45.832 -24.755 6.609 1.00 10.00 H ATOM 3507 N ALA D 545 47.726 -26.102 4.390 1.00 10.00 N ATOM 3508 CA ALA D 545 48.431 -27.121 3.629 1.00 10.00 C ATOM 3509 C ALA D 545 47.442 -27.796 2.694 1.00 10.00 C ATOM 3510 O ALA D 545 47.769 -28.110 1.555 1.00 10.00 O ATOM 3511 CB ALA D 545 49.055 -28.144 4.562 1.00 10.00 C ATOM 3512 H ALA D 545 47.574 -26.241 5.351 1.00 10.00 H ATOM 3513 N GLU D 546 46.225 -28.003 3.193 1.00 10.00 N ATOM 3514 CA GLU D 546 45.156 -28.608 2.407 1.00 10.00 C ATOM 3515 C GLU D 546 44.797 -27.698 1.242 1.00 10.00 C ATOM 3516 O GLU D 546 44.626 -28.156 0.115 1.00 10.00 O ATOM 3517 CB GLU D 546 43.920 -28.846 3.271 1.00 10.00 C ATOM 3518 CG GLU D 546 44.095 -29.928 4.319 1.00 10.00 C ATOM 3519 CD GLU D 546 43.174 -29.749 5.504 1.00 10.00 C ATOM 3520 OE1 GLU D 546 42.045 -29.243 5.326 1.00 10.00 O ATOM 3521 OE2 GLU D 546 43.584 -30.118 6.628 1.00 10.00 O1- ATOM 3522 H GLU D 546 46.047 -27.750 4.127 1.00 10.00 H ATOM 3523 N TYR D 547 44.692 -26.400 1.532 1.00 10.00 N ATOM 3524 CA TYR D 547 44.385 -25.393 0.526 1.00 10.00 C ATOM 3525 C TYR D 547 45.454 -25.420 -0.552 1.00 10.00 C ATOM 3526 O TYR D 547 45.145 -25.458 -1.736 1.00 10.00 O ATOM 3527 CB TYR D 547 44.342 -23.996 1.158 1.00 10.00 C ATOM 3528 CG TYR D 547 42.970 -23.536 1.590 1.00 10.00 C ATOM 3529 CD1 TYR D 547 42.564 -23.651 2.909 1.00 10.00 C ATOM 3530 CD2 TYR D 547 42.084 -22.979 0.677 1.00 10.00 C ATOM 3531 CE1 TYR D 547 41.320 -23.222 3.313 1.00 10.00 C ATOM 3532 CE2 TYR D 547 40.832 -22.550 1.069 1.00 10.00 C ATOM 3533 CZ TYR D 547 40.457 -22.673 2.390 1.00 10.00 C ATOM 3534 OH TYR D 547 39.218 -22.236 2.792 1.00 10.00 O ATOM 3535 H TYR D 547 44.820 -26.111 2.469 1.00 10.00 H ATOM 3536 HH TYR D 547 38.571 -22.422 2.097 1.00 10.00 H ATOM 3537 N HIS D 548 46.715 -25.417 -0.123 1.00 10.00 N ATOM 3538 CA HIS D 548 47.840 -25.453 -1.047 1.00 10.00 C ATOM 3539 C HIS D 548 47.830 -26.737 -1.862 1.00 10.00 C ATOM 3540 O HIS D 548 48.053 -26.713 -3.072 1.00 10.00 O ATOM 3541 CB HIS D 548 49.165 -25.309 -0.292 1.00 10.00 C ATOM 3542 CG HIS D 548 49.545 -23.886 -0.004 1.00 10.00 C ATOM 3543 ND1 HIS D 548 50.837 -23.439 -0.157 1.00 10.00 N ATOM 3544 CD2 HIS D 548 48.767 -22.859 0.428 1.00 10.00 C ATOM 3545 CE1 HIS D 548 50.819 -22.159 0.182 1.00 10.00 C ATOM 3546 NE2 HIS D 548 49.590 -21.770 0.540 1.00 10.00 N ATOM 3547 H HIS D 548 46.892 -25.385 0.844 1.00 10.00 H ATOM 3548 HE2 HIS D 548 49.322 -20.869 0.835 1.00 10.00 H ATOM 3549 N ALA D 549 47.570 -27.855 -1.191 1.00 10.00 N ATOM 3550 CA ALA D 549 47.521 -29.151 -1.848 1.00 10.00 C ATOM 3551 C ALA D 549 46.387 -29.193 -2.859 1.00 10.00 C ATOM 3552 O ALA D 549 46.602 -29.501 -4.026 1.00 10.00 O ATOM 3553 CB ALA D 549 47.362 -30.264 -0.824 1.00 10.00 C ATOM 3554 H ALA D 549 47.419 -27.806 -0.223 1.00 10.00 H ATOM 3555 N LYS D 550 45.185 -28.850 -2.416 1.00 10.00 N ATOM 3556 CA LYS D 550 44.025 -28.849 -3.297 1.00 10.00 C ATOM 3557 C LYS D 550 44.192 -27.812 -4.400 1.00 10.00 C ATOM 3558 O LYS D 550 43.684 -27.983 -5.503 1.00 10.00 O ATOM 3559 CB LYS D 550 42.731 -28.603 -2.516 1.00 10.00 C ATOM 3560 CG LYS D 550 42.007 -29.869 -2.071 1.00 10.00 C ATOM 3561 CD LYS D 550 42.377 -30.261 -0.648 1.00 10.00 C ATOM 3562 CE LYS D 550 43.495 -31.290 -0.624 1.00 10.00 C ATOM 3563 NZ LYS D 550 42.974 -32.681 -0.555 1.00 10.00 N1+ ATOM 3564 H LYS D 550 45.075 -28.586 -1.476 1.00 10.00 H ATOM 3565 HZ1 LYS D 550 42.220 -32.821 -1.254 1.00 10.00 H ATOM 3566 HZ2 LYS D 550 42.593 -32.883 0.400 1.00 10.00 H ATOM 3567 HZ3 LYS D 550 43.742 -33.354 -0.754 1.00 10.00 H ATOM 3568 N ALA D 551 44.911 -26.738 -4.095 1.00 10.00 N ATOM 3569 CA ALA D 551 45.165 -25.687 -5.068 1.00 10.00 C ATOM 3570 C ALA D 551 46.047 -26.219 -6.176 1.00 10.00 C ATOM 3571 O ALA D 551 45.780 -25.983 -7.351 1.00 10.00 O ATOM 3572 CB ALA D 551 45.817 -24.473 -4.418 1.00 10.00 C ATOM 3573 H ALA D 551 45.272 -26.648 -3.186 1.00 10.00 H ATOM 3574 N THR D 552 47.100 -26.938 -5.799 1.00 10.00 N ATOM 3575 CA THR D 552 48.006 -27.508 -6.778 1.00 10.00 C ATOM 3576 C THR D 552 47.309 -28.630 -7.539 1.00 10.00 C ATOM 3577 O THR D 552 47.458 -28.756 -8.755 1.00 10.00 O ATOM 3578 CB THR D 552 49.317 -28.009 -6.141 1.00 10.00 C ATOM 3579 OG1 THR D 552 49.065 -28.476 -4.813 1.00 10.00 O ATOM 3580 CG2 THR D 552 50.352 -26.895 -6.090 1.00 10.00 C ATOM 3581 H THR D 552 47.271 -27.086 -4.844 1.00 10.00 H ATOM 3582 HG1 THR D 552 48.904 -27.720 -4.232 1.00 10.00 H ATOM 3583 N GLU D 553 46.524 -29.425 -6.816 1.00 10.00 N ATOM 3584 CA GLU D 553 45.775 -30.513 -7.421 1.00 10.00 C ATOM 3585 C GLU D 553 44.806 -29.955 -8.449 1.00 10.00 C ATOM 3586 O GLU D 553 44.786 -30.383 -9.607 1.00 10.00 O ATOM 3587 CB GLU D 553 44.998 -31.300 -6.363 1.00 10.00 C ATOM 3588 CG GLU D 553 45.860 -32.160 -5.457 1.00 10.00 C ATOM 3589 CD GLU D 553 45.028 -33.085 -4.593 1.00 10.00 C ATOM 3590 OE1 GLU D 553 44.521 -32.642 -3.541 1.00 10.00 O ATOM 3591 OE2 GLU D 553 44.869 -34.264 -4.972 1.00 10.00 O1- ATOM 3592 H GLU D 553 46.461 -29.279 -5.843 1.00 10.00 H ATOM 3593 N HIS D 554 44.008 -28.982 -8.017 1.00 10.00 N ATOM 3594 CA HIS D 554 43.037 -28.343 -8.894 1.00 10.00 C ATOM 3595 C HIS D 554 43.748 -27.636 -10.037 1.00 10.00 C ATOM 3596 O HIS D 554 43.269 -27.641 -11.164 1.00 10.00 O ATOM 3597 CB HIS D 554 42.138 -27.365 -8.126 1.00 10.00 C ATOM 3598 CG HIS D 554 40.801 -27.137 -8.772 1.00 10.00 C ATOM 3599 ND1 HIS D 554 39.962 -26.120 -8.365 1.00 10.00 N ATOM 3600 CD2 HIS D 554 40.199 -27.828 -9.775 1.00 10.00 C ATOM 3601 CE1 HIS D 554 38.882 -26.218 -9.123 1.00 10.00 C ATOM 3602 NE2 HIS D 554 38.982 -27.233 -9.987 1.00 10.00 N ATOM 3603 H HIS D 554 44.068 -28.697 -7.075 1.00 10.00 H ATOM 3604 HE2 HIS D 554 38.307 -27.514 -10.644 1.00 10.00 H ATOM 3605 N LEU D 555 44.898 -27.036 -9.747 1.00 10.00 N ATOM 3606 CA LEU D 555 45.682 -26.353 -10.769 1.00 10.00 C ATOM 3607 C LEU D 555 46.026 -27.323 -11.891 1.00 10.00 C ATOM 3608 O LEU D 555 45.891 -26.995 -13.076 1.00 10.00 O ATOM 3609 CB LEU D 555 46.965 -25.778 -10.166 1.00 10.00 C ATOM 3610 CG LEU D 555 47.897 -25.043 -11.127 1.00 10.00 C ATOM 3611 CD1 LEU D 555 47.269 -23.734 -11.579 1.00 10.00 C ATOM 3612 CD2 LEU D 555 49.245 -24.799 -10.473 1.00 10.00 C ATOM 3613 H LEU D 555 45.219 -27.042 -8.816 1.00 10.00 H ATOM 3614 N SER D 556 46.460 -28.520 -11.509 1.00 10.00 N ATOM 3615 CA SER D 556 46.800 -29.558 -12.469 1.00 10.00 C ATOM 3616 C SER D 556 45.562 -29.949 -13.270 1.00 10.00 C ATOM 3617 O SER D 556 45.635 -30.180 -14.475 1.00 10.00 O ATOM 3618 CB SER D 556 47.367 -30.783 -11.746 1.00 10.00 C ATOM 3619 OG SER D 556 48.378 -30.409 -10.822 1.00 10.00 O ATOM 3620 H SER D 556 46.569 -28.706 -10.549 1.00 10.00 H ATOM 3621 HG SER D 556 48.276 -30.926 -10.011 1.00 10.00 H ATOM 3622 N THR D 557 44.421 -29.999 -12.594 1.00 10.00 N ATOM 3623 CA THR D 557 43.163 -30.348 -13.238 1.00 10.00 C ATOM 3624 C THR D 557 42.696 -29.221 -14.164 1.00 10.00 C ATOM 3625 O THR D 557 42.144 -29.471 -15.241 1.00 10.00 O ATOM 3626 CB THR D 557 42.065 -30.645 -12.198 1.00 10.00 C ATOM 3627 OG1 THR D 557 42.630 -31.386 -11.104 1.00 10.00 O ATOM 3628 CG2 THR D 557 40.958 -31.471 -12.831 1.00 10.00 C ATOM 3629 H THR D 557 44.425 -29.791 -11.632 1.00 10.00 H ATOM 3630 HG1 THR D 557 43.587 -31.448 -11.217 1.00 10.00 H ATOM 3631 N LEU D 558 42.923 -27.985 -13.730 1.00 10.00 N ATOM 3632 CA LEU D 558 42.547 -26.812 -14.504 1.00 10.00 C ATOM 3633 C LEU D 558 43.336 -26.754 -15.801 1.00 10.00 C ATOM 3634 O LEU D 558 42.757 -26.629 -16.873 1.00 10.00 O ATOM 3635 CB LEU D 558 42.761 -25.530 -13.700 1.00 10.00 C ATOM 3636 CG LEU D 558 41.847 -25.314 -12.488 1.00 10.00 C ATOM 3637 CD1 LEU D 558 42.251 -24.054 -11.741 1.00 10.00 C ATOM 3638 CD2 LEU D 558 40.387 -25.241 -12.909 1.00 10.00 C ATOM 3639 H LEU D 558 43.344 -27.855 -12.849 1.00 10.00 H ATOM 3640 N SER D 559 44.657 -26.876 -15.701 1.00 10.00 N ATOM 3641 CA SER D 559 45.517 -26.848 -16.880 1.00 10.00 C ATOM 3642 C SER D 559 45.230 -28.054 -17.767 1.00 10.00 C ATOM 3643 O SER D 559 45.311 -27.971 -18.995 1.00 10.00 O ATOM 3644 CB SER D 559 46.991 -26.802 -16.473 1.00 10.00 C ATOM 3645 OG SER D 559 47.228 -27.582 -15.311 1.00 10.00 O ATOM 3646 H SER D 559 45.064 -26.986 -14.814 1.00 10.00 H ATOM 3647 HG SER D 559 46.912 -27.104 -14.532 1.00 10.00 H ATOM 3648 N GLU D 560 44.861 -29.166 -17.125 1.00 10.00 N ATOM 3649 CA GLU D 560 44.517 -30.407 -17.822 1.00 10.00 C ATOM 3650 C GLU D 560 43.281 -30.184 -18.688 1.00 10.00 C ATOM 3651 O GLU D 560 43.027 -30.922 -19.636 1.00 10.00 O ATOM 3652 CB GLU D 560 44.235 -31.510 -16.796 1.00 10.00 C ATOM 3653 CG GLU D 560 43.752 -32.831 -17.372 1.00 10.00 C ATOM 3654 CD GLU D 560 42.925 -33.621 -16.380 1.00 10.00 C ATOM 3655 OE1 GLU D 560 41.685 -33.474 -16.383 1.00 10.00 O ATOM 3656 OE2 GLU D 560 43.514 -34.383 -15.586 1.00 10.00 O1- ATOM 3657 H GLU D 560 44.831 -29.151 -16.143 1.00 10.00 H ATOM 3658 N LYS D 561 42.510 -29.162 -18.340 1.00 10.00 N ATOM 3659 CA LYS D 561 41.313 -28.825 -19.083 1.00 10.00 C ATOM 3660 C LYS D 561 41.594 -27.647 -20.005 1.00 10.00 C ATOM 3661 O LYS D 561 41.234 -27.671 -21.170 1.00 10.00 O ATOM 3662 CB LYS D 561 40.174 -28.474 -18.126 1.00 10.00 C ATOM 3663 CG LYS D 561 38.809 -28.959 -18.587 1.00 10.00 C ATOM 3664 CD LYS D 561 38.299 -30.109 -17.728 1.00 10.00 C ATOM 3665 CE LYS D 561 39.232 -31.311 -17.765 1.00 10.00 C ATOM 3666 NZ LYS D 561 40.195 -31.309 -16.633 1.00 10.00 N1+ ATOM 3667 H LYS D 561 42.766 -28.612 -17.570 1.00 10.00 H ATOM 3668 HZ1 LYS D 561 40.869 -30.528 -16.733 1.00 10.00 H ATOM 3669 HZ2 LYS D 561 40.727 -32.211 -16.613 1.00 10.00 H ATOM 3670 HZ3 LYS D 561 39.685 -31.202 -15.732 1.00 10.00 H ATOM 3671 N ALA D 562 42.264 -26.633 -19.472 1.00 10.00 N ATOM 3672 CA ALA D 562 42.600 -25.427 -20.224 1.00 10.00 C ATOM 3673 C ALA D 562 43.389 -25.740 -21.493 1.00 10.00 C ATOM 3674 O ALA D 562 43.100 -25.183 -22.551 1.00 10.00 O ATOM 3675 CB ALA D 562 43.362 -24.447 -19.346 1.00 10.00 C ATOM 3676 H ALA D 562 42.544 -26.691 -18.533 1.00 10.00 H ATOM 3677 N LYS D 563 44.368 -26.637 -21.391 1.00 10.00 N ATOM 3678 CA LYS D 563 45.188 -27.003 -22.545 1.00 10.00 C ATOM 3679 C LYS D 563 44.343 -27.506 -23.721 1.00 10.00 C ATOM 3680 O LYS D 563 44.305 -26.851 -24.762 1.00 10.00 O ATOM 3681 CB LYS D 563 46.316 -27.986 -22.192 1.00 10.00 C ATOM 3682 CG LYS D 563 47.500 -27.359 -21.472 1.00 10.00 C ATOM 3683 CD LYS D 563 48.662 -28.338 -21.368 1.00 10.00 C ATOM 3684 CE LYS D 563 49.850 -27.725 -20.635 1.00 10.00 C ATOM 3685 NZ LYS D 563 51.075 -28.559 -20.756 1.00 10.00 N1+ ATOM 3686 H LYS D 563 44.545 -27.062 -20.523 1.00 10.00 H ATOM 3687 HZ1 LYS D 563 51.903 -28.034 -20.412 1.00 10.00 H ATOM 3688 HZ2 LYS D 563 51.235 -28.819 -21.748 1.00 10.00 H ATOM 3689 HZ3 LYS D 563 50.974 -29.429 -20.191 1.00 10.00 H ATOM 3690 N PRO D 564 43.631 -28.648 -23.578 1.00 10.00 N ATOM 3691 CA PRO D 564 42.807 -29.201 -24.660 1.00 10.00 C ATOM 3692 C PRO D 564 41.589 -28.342 -24.987 1.00 10.00 C ATOM 3693 O PRO D 564 41.218 -28.208 -26.149 1.00 10.00 O ATOM 3694 CB PRO D 564 42.365 -30.563 -24.123 1.00 10.00 C ATOM 3695 CG PRO D 564 42.430 -30.426 -22.644 1.00 10.00 C ATOM 3696 CD PRO D 564 43.577 -29.496 -22.368 1.00 10.00 C ATOM 3697 N ALA D 565 40.977 -27.751 -23.962 1.00 10.00 N ATOM 3698 CA ALA D 565 39.796 -26.917 -24.164 1.00 10.00 C ATOM 3699 C ALA D 565 40.111 -25.738 -25.073 1.00 10.00 C ATOM 3700 O ALA D 565 39.400 -25.494 -26.036 1.00 10.00 O ATOM 3701 CB ALA D 565 39.216 -26.433 -22.845 1.00 10.00 C ATOM 3702 H ALA D 565 41.334 -27.870 -23.055 1.00 10.00 H ATOM 3703 N LEU D 566 41.188 -25.020 -24.773 1.00 10.00 N ATOM 3704 CA LEU D 566 41.573 -23.874 -25.586 1.00 10.00 C ATOM 3705 C LEU D 566 41.928 -24.306 -26.999 1.00 10.00 C ATOM 3706 O LEU D 566 41.606 -23.613 -27.960 1.00 10.00 O ATOM 3707 CB LEU D 566 42.717 -23.084 -24.945 1.00 10.00 C ATOM 3708 CG LEU D 566 42.364 -22.301 -23.678 1.00 10.00 C ATOM 3709 CD1 LEU D 566 43.485 -21.345 -23.314 1.00 10.00 C ATOM 3710 CD2 LEU D 566 41.056 -21.550 -23.860 1.00 10.00 C ATOM 3711 H LEU D 566 41.735 -25.264 -23.995 1.00 10.00 H ATOM 3712 N GLU D 567 42.585 -25.457 -27.120 1.00 10.00 N ATOM 3713 CA GLU D 567 42.943 -25.981 -28.434 1.00 10.00 C ATOM 3714 C GLU D 567 41.666 -26.270 -29.217 1.00 10.00 C ATOM 3715 O GLU D 567 41.492 -25.795 -30.337 1.00 10.00 O ATOM 3716 CB GLU D 567 43.771 -27.266 -28.319 1.00 10.00 C ATOM 3717 CG GLU D 567 45.143 -27.092 -27.686 1.00 10.00 C ATOM 3718 CD GLU D 567 46.035 -26.127 -28.442 1.00 10.00 C ATOM 3719 OE1 GLU D 567 45.909 -26.031 -29.679 1.00 10.00 O ATOM 3720 OE2 GLU D 567 46.881 -25.470 -27.802 1.00 10.00 O1- ATOM 3721 H GLU D 567 42.835 -25.958 -26.317 1.00 10.00 H ATOM 3722 N ASP D 568 40.774 -27.036 -28.598 1.00 10.00 N ATOM 3723 CA ASP D 568 39.502 -27.399 -29.210 1.00 10.00 C ATOM 3724 C ASP D 568 38.684 -26.160 -29.530 1.00 10.00 C ATOM 3725 O ASP D 568 38.116 -26.046 -30.615 1.00 10.00 O ATOM 3726 CB ASP D 568 38.706 -28.324 -28.289 1.00 10.00 C ATOM 3727 CG ASP D 568 38.969 -29.790 -28.559 1.00 10.00 C ATOM 3728 OD1 ASP D 568 38.157 -30.423 -29.269 1.00 10.00 O ATOM 3729 OD2 ASP D 568 39.982 -30.324 -28.060 1.00 10.00 O1- ATOM 3730 H ASP D 568 40.982 -27.376 -27.695 1.00 10.00 H ATOM 3731 N LEU D 569 38.633 -25.231 -28.581 1.00 10.00 N ATOM 3732 CA LEU D 569 37.897 -23.993 -28.759 1.00 10.00 C ATOM 3733 C LEU D 569 38.431 -23.223 -29.953 1.00 10.00 C ATOM 3734 O LEU D 569 37.664 -22.772 -30.791 1.00 10.00 O ATOM 3735 CB LEU D 569 37.947 -23.125 -27.501 1.00 10.00 C ATOM 3736 CG LEU D 569 37.033 -23.550 -26.349 1.00 10.00 C ATOM 3737 CD1 LEU D 569 37.213 -22.625 -25.157 1.00 10.00 C ATOM 3738 CD2 LEU D 569 35.581 -23.568 -26.792 1.00 10.00 C ATOM 3739 H LEU D 569 39.097 -25.392 -27.730 1.00 10.00 H ATOM 3740 N ARG D 570 39.748 -23.093 -30.038 1.00 10.00 N ATOM 3741 CA ARG D 570 40.373 -22.387 -31.150 1.00 10.00 C ATOM 3742 C ARG D 570 40.138 -23.133 -32.456 1.00 10.00 C ATOM 3743 O ARG D 570 39.842 -22.526 -33.487 1.00 10.00 O ATOM 3744 CB ARG D 570 41.868 -22.184 -30.906 1.00 10.00 C ATOM 3745 CG ARG D 570 42.195 -21.065 -29.923 1.00 10.00 C ATOM 3746 CD ARG D 570 43.697 -20.902 -29.766 1.00 10.00 C ATOM 3747 NE ARG D 570 44.051 -19.848 -28.815 1.00 10.00 N ATOM 3748 CZ ARG D 570 45.067 -19.932 -27.960 1.00 10.00 C ATOM 3749 NH1 ARG D 570 45.821 -21.018 -27.929 1.00 10.00 N1+ ATOM 3750 NH2 ARG D 570 45.326 -18.928 -27.138 1.00 10.00 N ATOM 3751 H ARG D 570 40.317 -23.480 -29.332 1.00 10.00 H ATOM 3752 HE ARG D 570 43.494 -19.037 -28.813 1.00 10.00 H ATOM 3753 HH11 ARG D 570 46.589 -21.087 -27.286 1.00 10.00 H ATOM 3754 HH12 ARG D 570 45.626 -21.780 -28.551 1.00 10.00 H ATOM 3755 HH21 ARG D 570 44.759 -18.104 -27.160 1.00 10.00 H ATOM 3756 HH22 ARG D 570 46.088 -18.988 -26.485 1.00 10.00 H ATOM 3757 N GLN D 571 40.236 -24.460 -32.393 1.00 10.00 N ATOM 3758 CA GLN D 571 40.025 -25.314 -33.560 1.00 10.00 C ATOM 3759 C GLN D 571 38.578 -25.256 -34.031 1.00 10.00 C ATOM 3760 O GLN D 571 38.266 -25.654 -35.152 1.00 10.00 O ATOM 3761 CB GLN D 571 40.406 -26.762 -33.255 1.00 10.00 C ATOM 3762 CG GLN D 571 41.899 -27.004 -33.122 1.00 10.00 C ATOM 3763 CD GLN D 571 42.227 -28.453 -32.808 1.00 10.00 C ATOM 3764 OE1 GLN D 571 41.431 -29.169 -32.197 1.00 10.00 O ATOM 3765 NE2 GLN D 571 43.406 -28.890 -33.215 1.00 10.00 N ATOM 3766 H GLN D 571 40.468 -24.881 -31.531 1.00 10.00 H ATOM 3767 HE21 GLN D 571 43.992 -28.261 -33.687 1.00 10.00 H ATOM 3768 HE22 GLN D 571 43.651 -29.822 -33.020 1.00 10.00 H ATOM 3769 N GLY D 572 37.697 -24.788 -33.157 1.00 10.00 N ATOM 3770 CA GLY D 572 36.299 -24.673 -33.506 1.00 10.00 C ATOM 3771 C GLY D 572 35.915 -23.243 -33.823 1.00 10.00 C ATOM 3772 O GLY D 572 35.098 -22.990 -34.706 1.00 10.00 O ATOM 3773 H GLY D 572 37.998 -24.535 -32.256 1.00 10.00 H ATOM 3774 N LEU D 573 36.515 -22.302 -33.106 1.00 10.00 N ATOM 3775 CA LEU D 573 36.236 -20.891 -33.305 1.00 10.00 C ATOM 3776 C LEU D 573 36.816 -20.382 -34.615 1.00 10.00 C ATOM 3777 O LEU D 573 36.187 -19.581 -35.290 1.00 10.00 O ATOM 3778 CB LEU D 573 36.730 -20.052 -32.122 1.00 10.00 C ATOM 3779 CG LEU D 573 35.945 -20.205 -30.816 1.00 10.00 C ATOM 3780 CD1 LEU D 573 36.654 -19.494 -29.672 1.00 10.00 C ATOM 3781 CD2 LEU D 573 34.528 -19.681 -30.979 1.00 10.00 C ATOM 3782 H LEU D 573 37.154 -22.567 -32.408 1.00 10.00 H ATOM 3783 N LEU D 574 38.002 -20.858 -34.982 1.00 10.00 N ATOM 3784 CA LEU D 574 38.633 -20.430 -36.229 1.00 10.00 C ATOM 3785 C LEU D 574 37.730 -20.677 -37.446 1.00 10.00 C ATOM 3786 O LEU D 574 37.368 -19.724 -38.143 1.00 10.00 O ATOM 3787 CB LEU D 574 40.021 -21.049 -36.423 1.00 10.00 C ATOM 3788 CG LEU D 574 41.162 -20.442 -35.600 1.00 10.00 C ATOM 3789 CD1 LEU D 574 42.488 -21.058 -36.012 1.00 10.00 C ATOM 3790 CD2 LEU D 574 41.202 -18.927 -35.763 1.00 10.00 C ATOM 3791 H LEU D 574 38.461 -21.505 -34.408 1.00 10.00 H ATOM 3792 N PRO D 575 37.328 -21.940 -37.716 1.00 10.00 N ATOM 3793 CA PRO D 575 36.459 -22.251 -38.857 1.00 10.00 C ATOM 3794 C PRO D 575 35.063 -21.653 -38.692 1.00 10.00 C ATOM 3795 O PRO D 575 34.442 -21.233 -39.671 1.00 10.00 O ATOM 3796 CB PRO D 575 36.388 -23.781 -38.863 1.00 10.00 C ATOM 3797 CG PRO D 575 36.707 -24.177 -37.465 1.00 10.00 C ATOM 3798 CD PRO D 575 37.684 -23.156 -36.958 1.00 10.00 C ATOM 3799 N VAL D 576 34.569 -21.606 -37.454 1.00 10.00 N ATOM 3800 CA VAL D 576 33.252 -21.047 -37.196 1.00 10.00 C ATOM 3801 C VAL D 576 33.246 -19.545 -37.478 1.00 10.00 C ATOM 3802 O VAL D 576 32.263 -19.013 -37.978 1.00 10.00 O ATOM 3803 CB VAL D 576 32.703 -21.378 -35.781 1.00 10.00 C ATOM 3804 CG1 VAL D 576 33.052 -20.305 -34.756 1.00 10.00 C ATOM 3805 CG2 VAL D 576 31.202 -21.621 -35.829 1.00 10.00 C ATOM 3806 H VAL D 576 35.101 -21.957 -36.706 1.00 10.00 H ATOM 3807 N LEU D 577 34.366 -18.880 -37.185 1.00 10.00 N ATOM 3808 CA LEU D 577 34.494 -17.450 -37.436 1.00 10.00 C ATOM 3809 C LEU D 577 34.491 -17.197 -38.931 1.00 10.00 C ATOM 3810 O LEU D 577 33.858 -16.261 -39.407 1.00 10.00 O ATOM 3811 CB LEU D 577 35.765 -16.872 -36.798 1.00 10.00 C ATOM 3812 CG LEU D 577 35.678 -16.541 -35.305 1.00 10.00 C ATOM 3813 CD1 LEU D 577 37.020 -16.061 -34.778 1.00 10.00 C ATOM 3814 CD2 LEU D 577 34.598 -15.501 -35.052 1.00 10.00 C ATOM 3815 H LEU D 577 35.120 -19.364 -36.779 1.00 10.00 H ATOM 3816 N GLU D 578 35.190 -18.051 -39.670 1.00 10.00 N ATOM 3817 CA GLU D 578 35.244 -17.933 -41.118 1.00 10.00 C ATOM 3818 C GLU D 578 33.841 -18.081 -41.682 1.00 10.00 C ATOM 3819 O GLU D 578 33.415 -17.314 -42.541 1.00 10.00 O ATOM 3820 CB GLU D 578 36.168 -18.990 -41.724 1.00 10.00 C ATOM 3821 CG GLU D 578 37.604 -18.900 -41.243 1.00 10.00 C ATOM 3822 CD GLU D 578 38.126 -17.480 -41.213 1.00 10.00 C ATOM 3823 OE1 GLU D 578 38.464 -16.937 -42.287 1.00 10.00 O ATOM 3824 OE2 GLU D 578 38.199 -16.897 -40.114 1.00 10.00 O1- ATOM 3825 H GLU D 578 35.694 -18.769 -39.225 1.00 10.00 H ATOM 3826 N SER D 579 33.121 -19.057 -41.161 1.00 10.00 N ATOM 3827 CA SER D 579 31.758 -19.303 -41.585 1.00 10.00 C ATOM 3828 C SER D 579 30.868 -18.131 -41.174 1.00 10.00 C ATOM 3829 O SER D 579 29.971 -17.725 -41.916 1.00 10.00 O ATOM 3830 CB SER D 579 31.259 -20.609 -40.970 1.00 10.00 C ATOM 3831 OG SER D 579 32.151 -21.680 -41.266 1.00 10.00 O ATOM 3832 H SER D 579 33.519 -19.629 -40.469 1.00 10.00 H ATOM 3833 HG SER D 579 32.925 -21.627 -40.688 1.00 10.00 H ATOM 3834 N PHE D 580 31.129 -17.588 -39.986 1.00 10.00 N ATOM 3835 CA PHE D 580 30.376 -16.445 -39.487 1.00 10.00 C ATOM 3836 C PHE D 580 30.586 -15.249 -40.400 1.00 10.00 C ATOM 3837 O PHE D 580 29.639 -14.525 -40.709 1.00 10.00 O ATOM 3838 CB PHE D 580 30.771 -16.086 -38.054 1.00 10.00 C ATOM 3839 CG PHE D 580 30.114 -16.934 -37.004 1.00 10.00 C ATOM 3840 CD1 PHE D 580 28.971 -17.664 -37.288 1.00 10.00 C ATOM 3841 CD2 PHE D 580 30.645 -16.998 -35.728 1.00 10.00 C ATOM 3842 CE1 PHE D 580 28.370 -18.442 -36.319 1.00 10.00 C ATOM 3843 CE2 PHE D 580 30.051 -17.776 -34.755 1.00 10.00 C ATOM 3844 CZ PHE D 580 28.913 -18.497 -35.052 1.00 10.00 C ATOM 3845 H PHE D 580 31.836 -17.979 -39.425 1.00 10.00 H ATOM 3846 N LYS D 581 31.827 -15.055 -40.840 1.00 10.00 N ATOM 3847 CA LYS D 581 32.154 -13.959 -41.745 1.00 10.00 C ATOM 3848 C LYS D 581 31.325 -14.076 -43.012 1.00 10.00 C ATOM 3849 O LYS D 581 30.833 -13.078 -43.536 1.00 10.00 O ATOM 3850 CB LYS D 581 33.642 -13.975 -42.097 1.00 10.00 C ATOM 3851 CG LYS D 581 34.572 -13.625 -40.945 1.00 10.00 C ATOM 3852 CD LYS D 581 35.997 -14.040 -41.257 1.00 10.00 C ATOM 3853 CE LYS D 581 36.942 -13.723 -40.108 1.00 10.00 C ATOM 3854 NZ LYS D 581 38.301 -14.282 -40.343 1.00 10.00 N1+ ATOM 3855 H LYS D 581 32.544 -15.662 -40.542 1.00 10.00 H ATOM 3856 HZ1 LYS D 581 38.973 -13.894 -39.653 1.00 10.00 H ATOM 3857 HZ2 LYS D 581 38.628 -14.039 -41.298 1.00 10.00 H ATOM 3858 HZ3 LYS D 581 38.286 -15.324 -40.247 1.00 10.00 H ATOM 3859 N VAL D 582 31.158 -15.306 -43.490 1.00 10.00 N ATOM 3860 CA VAL D 582 30.369 -15.568 -44.686 1.00 10.00 C ATOM 3861 C VAL D 582 28.920 -15.137 -44.461 1.00 10.00 C ATOM 3862 O VAL D 582 28.346 -14.406 -45.271 1.00 10.00 O ATOM 3863 CB VAL D 582 30.418 -17.060 -45.076 1.00 10.00 C ATOM 3864 CG1 VAL D 582 29.605 -17.323 -46.336 1.00 10.00 C ATOM 3865 CG2 VAL D 582 31.857 -17.506 -45.267 1.00 10.00 C ATOM 3866 H VAL D 582 31.588 -16.059 -43.025 1.00 10.00 H ATOM 3867 N SER D 583 28.348 -15.571 -43.340 1.00 10.00 N ATOM 3868 CA SER D 583 26.974 -15.225 -42.999 1.00 10.00 C ATOM 3869 C SER D 583 26.826 -13.726 -42.704 1.00 10.00 C ATOM 3870 O SER D 583 25.736 -13.165 -42.820 1.00 10.00 O ATOM 3871 CB SER D 583 26.484 -16.070 -41.816 1.00 10.00 C ATOM 3872 OG SER D 583 27.460 -16.144 -40.785 1.00 10.00 O ATOM 3873 H SER D 583 28.863 -16.148 -42.733 1.00 10.00 H ATOM 3874 HG SER D 583 28.134 -15.462 -40.926 1.00 10.00 H ATOM 3875 N PHE D 584 27.923 -13.079 -42.315 1.00 10.00 N ATOM 3876 CA PHE D 584 27.896 -11.652 -42.026 1.00 10.00 C ATOM 3877 C PHE D 584 27.972 -10.859 -43.319 1.00 10.00 C ATOM 3878 O PHE D 584 27.225 -9.902 -43.513 1.00 10.00 O ATOM 3879 CB PHE D 584 29.040 -11.249 -41.092 1.00 10.00 C ATOM 3880 CG PHE D 584 28.738 -11.447 -39.633 1.00 10.00 C ATOM 3881 CD1 PHE D 584 27.543 -11.001 -39.090 1.00 10.00 C ATOM 3882 CD2 PHE D 584 29.653 -12.070 -38.800 1.00 10.00 C ATOM 3883 CE1 PHE D 584 27.263 -11.173 -37.749 1.00 10.00 C ATOM 3884 CE2 PHE D 584 29.380 -12.246 -37.456 1.00 10.00 C ATOM 3885 CZ PHE D 584 28.184 -11.799 -36.929 1.00 10.00 C ATOM 3886 H PHE D 584 28.770 -13.573 -42.215 1.00 10.00 H ATOM 3887 N LEU D 585 28.872 -11.279 -44.204 1.00 10.00 N ATOM 3888 CA LEU D 585 29.051 -10.622 -45.490 1.00 10.00 C ATOM 3889 C LEU D 585 27.768 -10.653 -46.303 1.00 10.00 C ATOM 3890 O LEU D 585 27.356 -9.637 -46.867 1.00 10.00 O ATOM 3891 CB LEU D 585 30.183 -11.278 -46.284 1.00 10.00 C ATOM 3892 CG LEU D 585 31.606 -10.950 -45.828 1.00 10.00 C ATOM 3893 CD1 LEU D 585 32.619 -11.776 -46.604 1.00 10.00 C ATOM 3894 CD2 LEU D 585 31.898 -9.464 -45.978 1.00 10.00 C ATOM 3895 H LEU D 585 29.445 -12.049 -43.979 1.00 10.00 H ATOM 3896 N SER D 586 27.134 -11.817 -46.355 1.00 10.00 N ATOM 3897 CA SER D 586 25.897 -11.978 -47.101 1.00 10.00 C ATOM 3898 C SER D 586 24.780 -11.144 -46.479 1.00 10.00 C ATOM 3899 O SER D 586 23.906 -10.627 -47.176 1.00 10.00 O ATOM 3900 CB SER D 586 25.500 -13.448 -47.130 1.00 10.00 C ATOM 3901 OG SER D 586 25.675 -14.034 -45.853 1.00 10.00 O ATOM 3902 H SER D 586 27.510 -12.593 -45.877 1.00 10.00 H ATOM 3903 HG SER D 586 26.262 -14.796 -45.927 1.00 10.00 H ATOM 3904 N ALA D 587 24.806 -11.027 -45.158 1.00 10.00 N ATOM 3905 CA ALA D 587 23.809 -10.245 -44.444 1.00 10.00 C ATOM 3906 C ALA D 587 24.007 -8.760 -44.715 1.00 10.00 C ATOM 3907 O ALA D 587 23.096 -8.085 -45.186 1.00 10.00 O ATOM 3908 CB ALA D 587 23.871 -10.524 -42.949 1.00 10.00 C ATOM 3909 H ALA D 587 25.515 -11.484 -44.651 1.00 10.00 H ATOM 3910 N LEU D 588 25.211 -8.264 -44.441 1.00 10.00 N ATOM 3911 CA LEU D 588 25.536 -6.855 -44.634 1.00 10.00 C ATOM 3912 C LEU D 588 25.287 -6.390 -46.068 1.00 10.00 C ATOM 3913 O LEU D 588 24.658 -5.353 -46.289 1.00 10.00 O ATOM 3914 CB LEU D 588 26.988 -6.576 -44.235 1.00 10.00 C ATOM 3915 CG LEU D 588 27.334 -6.801 -42.759 1.00 10.00 C ATOM 3916 CD1 LEU D 588 28.836 -6.692 -42.532 1.00 10.00 C ATOM 3917 CD2 LEU D 588 26.587 -5.813 -41.877 1.00 10.00 C ATOM 3918 H LEU D 588 25.907 -8.865 -44.092 1.00 10.00 H ATOM 3919 N GLU D 589 25.766 -7.170 -47.035 1.00 10.00 N ATOM 3920 CA GLU D 589 25.602 -6.828 -48.446 1.00 10.00 C ATOM 3921 C GLU D 589 24.128 -6.700 -48.821 1.00 10.00 C ATOM 3922 O GLU D 589 23.719 -5.713 -49.434 1.00 10.00 O ATOM 3923 CB GLU D 589 26.299 -7.849 -49.353 1.00 10.00 C ATOM 3924 CG GLU D 589 26.703 -7.291 -50.713 1.00 10.00 C ATOM 3925 CD GLU D 589 27.154 -8.365 -51.689 1.00 10.00 C ATOM 3926 OE1 GLU D 589 26.397 -8.672 -52.634 1.00 10.00 O ATOM 3927 OE2 GLU D 589 28.267 -8.907 -51.517 1.00 10.00 O1- ATOM 3928 H GLU D 589 26.244 -7.995 -46.794 1.00 10.00 H ATOM 3929 N GLU D 590 23.327 -7.680 -48.423 1.00 10.00 N ATOM 3930 CA GLU D 590 21.903 -7.674 -48.738 1.00 10.00 C ATOM 3931 C GLU D 590 21.150 -6.595 -47.959 1.00 10.00 C ATOM 3932 O GLU D 590 20.266 -5.940 -48.507 1.00 10.00 O ATOM 3933 CB GLU D 590 21.268 -9.054 -48.532 1.00 10.00 C ATOM 3934 CG GLU D 590 21.805 -10.133 -49.466 1.00 10.00 C ATOM 3935 CD GLU D 590 20.773 -11.187 -49.819 1.00 10.00 C ATOM 3936 OE1 GLU D 590 19.928 -10.923 -50.702 1.00 10.00 O ATOM 3937 OE2 GLU D 590 20.811 -12.293 -49.231 1.00 10.00 O1- ATOM 3938 H GLU D 590 23.701 -8.418 -47.898 1.00 10.00 H ATOM 3939 N TYR D 591 21.508 -6.402 -46.690 1.00 10.00 N ATOM 3940 CA TYR D 591 20.854 -5.393 -45.854 1.00 10.00 C ATOM 3941 C TYR D 591 21.031 -3.995 -46.439 1.00 10.00 C ATOM 3942 O TYR D 591 20.075 -3.226 -46.529 1.00 10.00 O ATOM 3943 CB TYR D 591 21.372 -5.429 -44.409 1.00 10.00 C ATOM 3944 CG TYR D 591 20.789 -6.541 -43.561 1.00 10.00 C ATOM 3945 CD1 TYR D 591 19.466 -6.940 -43.709 1.00 10.00 C ATOM 3946 CD2 TYR D 591 21.563 -7.192 -42.608 1.00 10.00 C ATOM 3947 CE1 TYR D 591 18.935 -7.954 -42.935 1.00 10.00 C ATOM 3948 CE2 TYR D 591 21.040 -8.208 -41.831 1.00 10.00 C ATOM 3949 CZ TYR D 591 19.726 -8.583 -41.998 1.00 10.00 C ATOM 3950 OH TYR D 591 19.200 -9.596 -41.229 1.00 10.00 O ATOM 3951 H TYR D 591 22.222 -6.953 -46.301 1.00 10.00 H ATOM 3952 HH TYR D 591 18.447 -9.982 -41.687 1.00 10.00 H ATOM 3953 N THR D 592 22.256 -3.681 -46.852 1.00 10.00 N ATOM 3954 CA THR D 592 22.563 -2.379 -47.427 1.00 10.00 C ATOM 3955 C THR D 592 21.822 -2.169 -48.749 1.00 10.00 C ATOM 3956 O THR D 592 21.573 -1.037 -49.158 1.00 10.00 O ATOM 3957 CB THR D 592 24.082 -2.210 -47.653 1.00 10.00 C ATOM 3958 OG1 THR D 592 24.799 -2.712 -46.512 1.00 10.00 O ATOM 3959 CG2 THR D 592 24.434 -0.743 -47.850 1.00 10.00 C ATOM 3960 H THR D 592 22.972 -4.345 -46.766 1.00 10.00 H ATOM 3961 HG1 THR D 592 24.813 -3.679 -46.539 1.00 10.00 H ATOM 3962 N LYS D 593 21.475 -3.267 -49.414 1.00 10.00 N ATOM 3963 CA LYS D 593 20.759 -3.194 -50.682 1.00 10.00 C ATOM 3964 C LYS D 593 19.262 -3.016 -50.454 1.00 10.00 C ATOM 3965 O LYS D 593 18.586 -2.328 -51.216 1.00 10.00 O ATOM 3966 CB LYS D 593 21.047 -4.427 -51.542 1.00 10.00 C ATOM 3967 CG LYS D 593 22.469 -4.462 -52.078 1.00 10.00 C ATOM 3968 CD LYS D 593 22.784 -5.780 -52.754 1.00 10.00 C ATOM 3969 CE LYS D 593 24.226 -5.820 -53.234 1.00 10.00 C ATOM 3970 NZ LYS D 593 24.563 -7.124 -53.861 1.00 10.00 N1+ ATOM 3971 H LYS D 593 21.712 -4.142 -49.047 1.00 10.00 H ATOM 3972 HZ1 LYS D 593 23.729 -7.743 -53.872 1.00 10.00 H ATOM 3973 HZ2 LYS D 593 25.324 -7.599 -53.320 1.00 10.00 H ATOM 3974 HZ3 LYS D 593 24.888 -6.977 -54.835 1.00 10.00 H ATOM 3975 N LYS D 594 18.749 -3.643 -49.406 1.00 10.00 N ATOM 3976 CA LYS D 594 17.342 -3.524 -49.071 1.00 10.00 C ATOM 3977 C LYS D 594 17.051 -2.134 -48.525 1.00 10.00 C ATOM 3978 O LYS D 594 16.009 -1.546 -48.809 1.00 10.00 O ATOM 3979 CB LYS D 594 16.931 -4.586 -48.049 1.00 10.00 C ATOM 3980 CG LYS D 594 16.253 -5.799 -48.664 1.00 10.00 C ATOM 3981 CD LYS D 594 17.267 -6.801 -49.207 1.00 10.00 C ATOM 3982 CE LYS D 594 16.571 -7.955 -49.914 1.00 10.00 C ATOM 3983 NZ LYS D 594 17.517 -9.033 -50.310 1.00 10.00 N1+ ATOM 3984 H LYS D 594 19.330 -4.211 -48.852 1.00 10.00 H ATOM 3985 HZ1 LYS D 594 17.061 -9.664 -50.999 1.00 10.00 H ATOM 3986 HZ2 LYS D 594 17.794 -9.597 -49.472 1.00 10.00 H ATOM 3987 HZ3 LYS D 594 18.369 -8.625 -50.735 1.00 10.00 H ATOM 3988 N LEU D 595 17.996 -1.616 -47.757 1.00 10.00 N ATOM 3989 CA LEU D 595 17.868 -0.297 -47.157 1.00 10.00 C ATOM 3990 C LEU D 595 18.651 0.734 -47.961 1.00 10.00 C ATOM 3991 O LEU D 595 19.090 1.751 -47.426 1.00 10.00 O ATOM 3992 CB LEU D 595 18.388 -0.336 -45.714 1.00 10.00 C ATOM 3993 CG LEU D 595 17.639 -1.257 -44.753 1.00 10.00 C ATOM 3994 CD1 LEU D 595 18.601 -1.876 -43.752 1.00 10.00 C ATOM 3995 CD2 LEU D 595 16.547 -0.485 -44.035 1.00 10.00 C ATOM 3996 H LEU D 595 18.807 -2.144 -47.580 1.00 10.00 H