>>6W4E:HELIX    2 AA2 LEU A  247  GLU A  296  1                                  50    
LEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 AA2 LEU A 247 GLU A 296 1 50 ATOM 470 N LEU A 247 30.723 -22.978 29.213 1.00 10.00 N ATOM 471 CA LEU A 247 29.332 -23.143 29.616 1.00 10.00 C ATOM 472 C LEU A 247 29.204 -23.690 31.034 1.00 10.00 C ATOM 473 O LEU A 247 28.197 -23.457 31.705 1.00 10.00 O ATOM 474 CB LEU A 247 28.572 -24.024 28.622 1.00 10.00 C ATOM 475 CG LEU A 247 28.142 -23.345 27.317 1.00 10.00 C ATOM 476 CD1 LEU A 247 27.582 -24.367 26.338 1.00 10.00 C ATOM 477 CD2 LEU A 247 27.127 -22.241 27.586 1.00 10.00 C ATOM 478 H LEU A 247 31.269 -23.768 29.029 1.00 10.00 H ATOM 479 N GLU A 248 30.216 -24.416 31.490 1.00 10.00 N ATOM 480 CA GLU A 248 30.192 -24.986 32.833 1.00 10.00 C ATOM 481 C GLU A 248 30.617 -23.975 33.892 1.00 10.00 C ATOM 482 O GLU A 248 29.928 -23.797 34.897 1.00 10.00 O ATOM 483 CB GLU A 248 31.053 -26.240 32.918 1.00 10.00 C ATOM 484 CG GLU A 248 30.501 -27.409 32.124 1.00 10.00 C ATOM 485 CD GLU A 248 29.233 -27.972 32.728 1.00 10.00 C ATOM 486 OE1 GLU A 248 28.133 -27.599 32.274 1.00 10.00 O ATOM 487 OE2 GLU A 248 29.339 -28.800 33.655 1.00 10.00 O1- ATOM 488 H GLU A 248 30.986 -24.587 30.908 1.00 10.00 H ATOM 489 N GLU A 249 31.738 -23.303 33.663 1.00 10.00 N ATOM 490 CA GLU A 249 32.229 -22.314 34.615 1.00 10.00 C ATOM 491 C GLU A 249 31.278 -21.132 34.668 1.00 10.00 C ATOM 492 O GLU A 249 31.089 -20.518 35.716 1.00 10.00 O ATOM 493 CB GLU A 249 33.634 -21.827 34.247 1.00 10.00 C ATOM 494 CG GLU A 249 34.700 -22.908 34.221 1.00 10.00 C ATOM 495 CD GLU A 249 36.086 -22.355 33.939 1.00 10.00 C ATOM 496 OE1 GLU A 249 36.236 -21.556 32.990 1.00 10.00 O ATOM 497 OE2 GLU A 249 37.032 -22.726 34.663 1.00 10.00 O1- ATOM 498 H GLU A 249 32.234 -23.460 32.835 1.00 10.00 H ATOM 499 N VAL A 250 30.668 -20.819 33.531 1.00 10.00 N ATOM 500 CA VAL A 250 29.728 -19.709 33.463 1.00 10.00 C ATOM 501 C VAL A 250 28.481 -20.004 34.295 1.00 10.00 C ATOM 502 O VAL A 250 27.930 -19.109 34.923 1.00 10.00 O ATOM 503 CB VAL A 250 29.352 -19.315 32.014 1.00 10.00 C ATOM 504 CG1 VAL A 250 28.271 -20.215 31.441 1.00 10.00 C ATOM 505 CG2 VAL A 250 28.924 -17.858 31.950 1.00 10.00 C ATOM 506 H VAL A 250 30.868 -21.337 32.721 1.00 10.00 H ATOM 507 N LYS A 251 28.071 -21.270 34.326 1.00 10.00 N ATOM 508 CA LYS A 251 26.899 -21.673 35.098 1.00 10.00 C ATOM 509 C LYS A 251 27.248 -21.820 36.573 1.00 10.00 C ATOM 510 O LYS A 251 26.373 -21.825 37.441 1.00 10.00 O ATOM 511 CB LYS A 251 26.303 -22.972 34.559 1.00 10.00 C ATOM 512 CG LYS A 251 25.396 -22.775 33.360 1.00 10.00 C ATOM 513 CD LYS A 251 24.447 -23.952 33.195 1.00 10.00 C ATOM 514 CE LYS A 251 23.431 -23.694 32.096 1.00 10.00 C ATOM 515 NZ LYS A 251 22.490 -24.834 31.919 1.00 10.00 N1+ ATOM 516 H LYS A 251 28.561 -21.947 33.813 1.00 10.00 H ATOM 517 HZ1 LYS A 251 21.791 -24.608 31.179 1.00 10.00 H ATOM 518 HZ2 LYS A 251 21.985 -25.024 32.808 1.00 10.00 H ATOM 519 HZ3 LYS A 251 23.012 -25.688 31.640 1.00 10.00 H ATOM 520 N ALA A 252 28.529 -21.973 36.844 1.00 10.00 N ATOM 521 CA ALA A 252 29.001 -22.095 38.209 1.00 10.00 C ATOM 522 C ALA A 252 29.198 -20.705 38.793 1.00 10.00 C ATOM 523 O ALA A 252 28.799 -20.420 39.921 1.00 10.00 O ATOM 524 CB ALA A 252 30.298 -22.876 38.243 1.00 10.00 C ATOM 525 H ALA A 252 29.175 -22.018 36.106 1.00 10.00 H ATOM 526 N LYS A 253 29.793 -19.832 37.998 1.00 10.00 N ATOM 527 CA LYS A 253 30.038 -18.463 38.414 1.00 10.00 C ATOM 528 C LYS A 253 28.763 -17.641 38.364 1.00 10.00 C ATOM 529 O LYS A 253 28.634 -16.653 39.079 1.00 10.00 O ATOM 530 CB LYS A 253 31.110 -17.822 37.540 1.00 10.00 C ATOM 531 CG LYS A 253 32.527 -18.048 38.032 1.00 10.00 C ATOM 532 CD LYS A 253 33.512 -17.232 37.217 1.00 10.00 C ATOM 533 CE LYS A 253 34.772 -16.936 38.008 1.00 10.00 C ATOM 534 NZ LYS A 253 35.606 -15.907 37.339 1.00 10.00 N1+ ATOM 535 H LYS A 253 30.091 -20.121 37.105 1.00 10.00 H ATOM 536 HZ1 LYS A 253 35.053 -15.042 37.190 1.00 10.00 H ATOM 537 HZ2 LYS A 253 35.936 -16.264 36.408 1.00 10.00 H ATOM 538 HZ3 LYS A 253 36.436 -15.683 37.923 1.00 10.00 H ATOM 539 N VAL A 254 27.816 -18.053 37.528 1.00 10.00 N ATOM 540 CA VAL A 254 26.550 -17.340 37.409 1.00 10.00 C ATOM 541 C VAL A 254 25.793 -17.335 38.735 1.00 10.00 C ATOM 542 O VAL A 254 24.985 -16.445 38.991 1.00 10.00 O ATOM 543 CB VAL A 254 25.652 -17.880 36.268 1.00 10.00 C ATOM 544 CG1 VAL A 254 24.791 -19.050 36.721 1.00 10.00 C ATOM 545 CG2 VAL A 254 24.801 -16.768 35.674 1.00 10.00 C ATOM 546 H VAL A 254 27.979 -18.844 36.968 1.00 10.00 H ATOM 547 N GLN A 255 26.077 -18.325 39.583 1.00 10.00 N ATOM 548 CA GLN A 255 25.431 -18.423 40.884 1.00 10.00 C ATOM 549 C GLN A 255 25.726 -17.172 41.724 1.00 10.00 C ATOM 550 O GLN A 255 24.814 -16.401 42.004 1.00 10.00 O ATOM 551 CB GLN A 255 25.814 -19.720 41.616 1.00 10.00 C ATOM 552 CG GLN A 255 25.627 -20.990 40.796 1.00 10.00 C ATOM 553 CD GLN A 255 26.441 -22.154 41.339 1.00 10.00 C ATOM 554 OE1 GLN A 255 26.699 -22.244 42.541 1.00 10.00 O ATOM 555 NE2 GLN A 255 26.854 -23.048 40.458 1.00 10.00 N ATOM 556 H GLN A 255 26.743 -18.997 39.326 1.00 10.00 H ATOM 557 HE21 GLN A 255 26.614 -22.919 39.514 1.00 10.00 H ATOM 558 HE22 GLN A 255 27.394 -23.801 40.782 1.00 10.00 H ATOM 559 N PRO A 256 27.001 -16.922 42.110 1.00 10.00 N ATOM 560 CA PRO A 256 27.343 -15.733 42.893 1.00 10.00 C ATOM 561 C PRO A 256 27.135 -14.451 42.087 1.00 10.00 C ATOM 562 O PRO A 256 26.813 -13.405 42.648 1.00 10.00 O ATOM 563 CB PRO A 256 28.821 -15.927 43.235 1.00 10.00 C ATOM 564 CG PRO A 256 29.335 -16.860 42.199 1.00 10.00 C ATOM 565 CD PRO A 256 28.189 -17.763 41.853 1.00 10.00 C ATOM 566 N TYR A 257 27.304 -14.541 40.766 1.00 10.00 N ATOM 567 CA TYR A 257 27.119 -13.386 39.894 1.00 10.00 C ATOM 568 C TYR A 257 25.672 -12.901 39.959 1.00 10.00 C ATOM 569 O TYR A 257 25.410 -11.725 40.215 1.00 10.00 O ATOM 570 CB TYR A 257 27.484 -13.731 38.442 1.00 10.00 C ATOM 571 CG TYR A 257 28.968 -13.748 38.123 1.00 10.00 C ATOM 572 CD1 TYR A 257 29.928 -13.888 39.122 1.00 10.00 C ATOM 573 CD2 TYR A 257 29.408 -13.637 36.811 1.00 10.00 C ATOM 574 CE1 TYR A 257 31.278 -13.911 38.820 1.00 10.00 C ATOM 575 CE2 TYR A 257 30.754 -13.659 36.499 1.00 10.00 C ATOM 576 CZ TYR A 257 31.686 -13.795 37.504 1.00 10.00 C ATOM 577 OH TYR A 257 33.031 -13.821 37.194 1.00 10.00 O ATOM 578 H TYR A 257 27.559 -15.406 40.370 1.00 10.00 H ATOM 579 HH TYR A 257 33.228 -13.107 36.571 1.00 10.00 H ATOM 580 N LEU A 258 24.735 -13.819 39.734 1.00 10.00 N ATOM 581 CA LEU A 258 23.318 -13.490 39.769 1.00 10.00 C ATOM 582 C LEU A 258 22.849 -13.229 41.188 1.00 10.00 C ATOM 583 O LEU A 258 22.049 -12.329 41.420 1.00 10.00 O ATOM 584 CB LEU A 258 22.469 -14.589 39.124 1.00 10.00 C ATOM 585 CG LEU A 258 22.446 -14.624 37.594 1.00 10.00 C ATOM 586 CD1 LEU A 258 21.484 -15.694 37.100 1.00 10.00 C ATOM 587 CD2 LEU A 258 22.053 -13.265 37.042 1.00 10.00 C ATOM 588 H LEU A 258 25.002 -14.745 39.535 1.00 10.00 H ATOM 589 N ASP A 259 23.349 -14.016 42.134 1.00 10.00 N ATOM 590 CA ASP A 259 22.978 -13.857 43.538 1.00 10.00 C ATOM 591 C ASP A 259 23.376 -12.478 44.050 1.00 10.00 C ATOM 592 O ASP A 259 22.648 -11.861 44.829 1.00 10.00 O ATOM 593 CB ASP A 259 23.606 -14.954 44.405 1.00 10.00 C ATOM 594 CG ASP A 259 23.299 -14.797 45.884 1.00 10.00 C ATOM 595 OD1 ASP A 259 22.130 -14.970 46.281 1.00 10.00 O ATOM 596 OD2 ASP A 259 24.236 -14.507 46.660 1.00 10.00 O1- ATOM 597 H ASP A 259 23.977 -14.730 41.882 1.00 10.00 H ATOM 598 N ASP A 260 24.531 -11.997 43.603 1.00 10.00 N ATOM 599 CA ASP A 260 25.018 -10.680 43.998 1.00 10.00 C ATOM 600 C ASP A 260 24.126 -9.602 43.413 1.00 10.00 C ATOM 601 O ASP A 260 23.628 -8.733 44.134 1.00 10.00 O ATOM 602 CB ASP A 260 26.461 -10.469 43.530 1.00 10.00 C ATOM 603 CG ASP A 260 27.049 -9.158 44.012 1.00 10.00 C ATOM 604 OD1 ASP A 260 27.538 -9.110 45.160 1.00 10.00 O ATOM 605 OD2 ASP A 260 27.033 -8.173 43.248 1.00 10.00 O1- ATOM 606 H ASP A 260 25.077 -12.546 42.997 1.00 10.00 H ATOM 607 N PHE A 261 23.910 -9.677 42.103 1.00 10.00 N ATOM 608 CA PHE A 261 23.071 -8.714 41.400 1.00 10.00 C ATOM 609 C PHE A 261 21.636 -8.749 41.914 1.00 10.00 C ATOM 610 O PHE A 261 21.021 -7.708 42.115 1.00 10.00 O ATOM 611 CB PHE A 261 23.094 -8.965 39.890 1.00 10.00 C ATOM 612 CG PHE A 261 24.126 -8.160 39.157 1.00 10.00 C ATOM 613 CD1 PHE A 261 23.751 -7.287 38.144 1.00 10.00 C ATOM 614 CD2 PHE A 261 25.466 -8.273 39.475 1.00 10.00 C ATOM 615 CE1 PHE A 261 24.695 -6.544 37.466 1.00 10.00 C ATOM 616 CE2 PHE A 261 26.415 -7.533 38.801 1.00 10.00 C ATOM 617 CZ PHE A 261 26.031 -6.667 37.794 1.00 10.00 C ATOM 618 H PHE A 261 24.340 -10.400 41.592 1.00 10.00 H ATOM 619 N GLN A 262 21.119 -9.951 42.140 1.00 10.00 N ATOM 620 CA GLN A 262 19.758 -10.131 42.629 1.00 10.00 C ATOM 621 C GLN A 262 19.610 -9.565 44.037 1.00 10.00 C ATOM 622 O GLN A 262 18.588 -8.962 44.366 1.00 10.00 O ATOM 623 CB GLN A 262 19.377 -11.617 42.607 1.00 10.00 C ATOM 624 CG GLN A 262 17.939 -11.911 42.995 1.00 10.00 C ATOM 625 CD GLN A 262 17.623 -13.390 42.941 1.00 10.00 C ATOM 626 OE1 GLN A 262 17.800 -14.110 43.922 1.00 10.00 O ATOM 627 NE2 GLN A 262 17.160 -13.856 41.791 1.00 10.00 N ATOM 628 H GLN A 262 21.675 -10.746 41.972 1.00 10.00 H ATOM 629 HE21 GLN A 262 17.048 -13.229 41.046 1.00 10.00 H ATOM 630 HE22 GLN A 262 16.944 -14.811 41.733 1.00 10.00 H ATOM 631 N LYS A 263 20.634 -9.764 44.859 1.00 10.00 N ATOM 632 CA LYS A 263 20.630 -9.263 46.225 1.00 10.00 C ATOM 633 C LYS A 263 20.601 -7.741 46.208 1.00 10.00 C ATOM 634 O LYS A 263 19.743 -7.119 46.831 1.00 10.00 O ATOM 635 CB LYS A 263 21.880 -9.744 46.956 1.00 10.00 C ATOM 636 CG LYS A 263 21.776 -9.710 48.473 1.00 10.00 C ATOM 637 CD LYS A 263 23.008 -10.321 49.134 1.00 10.00 C ATOM 638 CE LYS A 263 22.914 -11.839 49.226 1.00 10.00 C ATOM 639 NZ LYS A 263 22.861 -12.486 47.888 1.00 10.00 N1+ ATOM 640 H LYS A 263 21.415 -10.264 44.538 1.00 10.00 H ATOM 641 HZ1 LYS A 263 23.575 -12.066 47.258 1.00 10.00 H ATOM 642 HZ2 LYS A 263 21.922 -12.359 47.464 1.00 10.00 H ATOM 643 HZ3 LYS A 263 23.055 -13.508 47.971 1.00 10.00 H ATOM 644 N LYS A 264 21.533 -7.155 45.461 1.00 10.00 N ATOM 645 CA LYS A 264 21.623 -5.709 45.345 1.00 10.00 C ATOM 646 C LYS A 264 20.372 -5.148 44.682 1.00 10.00 C ATOM 647 O LYS A 264 19.910 -4.064 45.029 1.00 10.00 O ATOM 648 CB LYS A 264 22.870 -5.317 44.552 1.00 10.00 C ATOM 649 CG LYS A 264 24.178 -5.565 45.282 1.00 10.00 C ATOM 650 CD LYS A 264 25.369 -5.363 44.361 1.00 10.00 C ATOM 651 CE LYS A 264 26.682 -5.512 45.108 1.00 10.00 C ATOM 652 NZ LYS A 264 27.802 -5.856 44.194 1.00 10.00 N1+ ATOM 653 H LYS A 264 22.185 -7.712 44.978 1.00 10.00 H ATOM 654 HZ1 LYS A 264 27.606 -6.773 43.727 1.00 10.00 H ATOM 655 HZ2 LYS A 264 28.690 -5.937 44.728 1.00 10.00 H ATOM 656 HZ3 LYS A 264 27.915 -5.123 43.460 1.00 10.00 H ATOM 657 N TRP A 265 19.824 -5.908 43.735 1.00 10.00 N ATOM 658 CA TRP A 265 18.614 -5.509 43.025 1.00 10.00 C ATOM 659 C TRP A 265 17.434 -5.456 43.982 1.00 10.00 C ATOM 660 O TRP A 265 16.566 -4.589 43.873 1.00 10.00 O ATOM 661 CB TRP A 265 18.314 -6.477 41.877 1.00 10.00 C ATOM 662 CG TRP A 265 18.373 -5.838 40.524 1.00 10.00 C ATOM 663 CD1 TRP A 265 19.378 -5.946 39.607 1.00 10.00 C ATOM 664 CD2 TRP A 265 17.383 -4.985 39.933 1.00 10.00 C ATOM 665 NE1 TRP A 265 19.078 -5.210 38.486 1.00 10.00 N ATOM 666 CE2 TRP A 265 17.858 -4.615 38.660 1.00 10.00 C ATOM 667 CE3 TRP A 265 16.141 -4.502 40.354 1.00 10.00 C ATOM 668 CZ2 TRP A 265 17.140 -3.781 37.809 1.00 10.00 C ATOM 669 CZ3 TRP A 265 15.430 -3.677 39.506 1.00 10.00 C ATOM 670 CH2 TRP A 265 15.930 -3.324 38.248 1.00 10.00 C ATOM 671 H TRP A 265 20.254 -6.758 43.503 1.00 10.00 H ATOM 672 HE1 TRP A 265 19.643 -5.126 37.687 1.00 10.00 H ATOM 673 N GLN A 266 17.405 -6.392 44.922 1.00 10.00 N ATOM 674 CA GLN A 266 16.344 -6.425 45.912 1.00 10.00 C ATOM 675 C GLN A 266 16.406 -5.154 46.741 1.00 10.00 C ATOM 676 O GLN A 266 15.388 -4.500 46.966 1.00 10.00 O ATOM 677 CB GLN A 266 16.434 -7.673 46.791 1.00 10.00 C ATOM 678 CG GLN A 266 15.839 -8.912 46.142 1.00 10.00 C ATOM 679 CD GLN A 266 15.962 -10.150 47.005 1.00 10.00 C ATOM 680 OE1 GLN A 266 15.932 -10.076 48.232 1.00 10.00 O ATOM 681 NE2 GLN A 266 16.099 -11.297 46.368 1.00 10.00 N ATOM 682 H GLN A 266 18.113 -7.072 44.947 1.00 10.00 H ATOM 683 HE21 GLN A 266 16.108 -11.283 45.387 1.00 10.00 H ATOM 684 HE22 GLN A 266 16.185 -12.116 46.898 1.00 10.00 H ATOM 685 N GLU A 267 17.616 -4.784 47.153 1.00 10.00 N ATOM 686 CA GLU A 267 17.817 -3.564 47.923 1.00 10.00 C ATOM 687 C GLU A 267 17.452 -2.373 47.049 1.00 10.00 C ATOM 688 O GLU A 267 16.800 -1.437 47.501 1.00 10.00 O ATOM 689 CB GLU A 267 19.272 -3.426 48.375 1.00 10.00 C ATOM 690 CG GLU A 267 19.931 -4.712 48.840 1.00 10.00 C ATOM 691 CD GLU A 267 21.425 -4.547 49.027 1.00 10.00 C ATOM 692 OE1 GLU A 267 21.972 -5.083 50.015 1.00 10.00 O ATOM 693 OE2 GLU A 267 22.060 -3.865 48.192 1.00 10.00 O1- ATOM 694 H GLU A 267 18.390 -5.349 46.937 1.00 10.00 H ATOM 695 N GLU A 268 17.875 -2.432 45.782 1.00 10.00 N ATOM 696 CA GLU A 268 17.592 -1.377 44.813 1.00 10.00 C ATOM 697 C GLU A 268 16.095 -1.101 44.738 1.00 10.00 C ATOM 698 O GLU A 268 15.663 0.055 44.732 1.00 10.00 O ATOM 699 CB GLU A 268 18.103 -1.773 43.423 1.00 10.00 C ATOM 700 CG GLU A 268 19.585 -1.511 43.186 1.00 10.00 C ATOM 701 CD GLU A 268 19.897 -1.256 41.724 1.00 10.00 C ATOM 702 OE1 GLU A 268 19.391 -0.250 41.178 1.00 10.00 O ATOM 703 OE2 GLU A 268 20.635 -2.057 41.115 1.00 10.00 O1- ATOM 704 H GLU A 268 18.408 -3.208 45.494 1.00 10.00 H ATOM 705 N MET A 269 15.312 -2.171 44.682 1.00 10.00 N ATOM 706 CA MET A 269 13.865 -2.050 44.617 1.00 10.00 C ATOM 707 C MET A 269 13.288 -1.650 45.968 1.00 10.00 C ATOM 708 O MET A 269 12.401 -0.804 46.039 1.00 10.00 O ATOM 709 CB MET A 269 13.223 -3.341 44.102 1.00 10.00 C ATOM 710 CG MET A 269 13.493 -3.614 42.631 1.00 10.00 C ATOM 711 SD MET A 269 12.810 -2.345 41.545 1.00 10.00 S ATOM 712 CE MET A 269 11.090 -2.842 41.480 1.00 10.00 C ATOM 713 H MET A 269 15.721 -3.068 44.675 1.00 10.00 H ATOM 714 N GLU A 270 13.803 -2.241 47.039 1.00 10.00 N ATOM 715 CA GLU A 270 13.334 -1.922 48.383 1.00 10.00 C ATOM 716 C GLU A 270 13.564 -0.445 48.678 1.00 10.00 C ATOM 717 O GLU A 270 12.724 0.217 49.285 1.00 10.00 O ATOM 718 CB GLU A 270 14.018 -2.805 49.431 1.00 10.00 C ATOM 719 CG GLU A 270 13.561 -4.255 49.416 1.00 10.00 C ATOM 720 CD GLU A 270 13.903 -4.977 50.699 1.00 10.00 C ATOM 721 OE1 GLU A 270 13.404 -4.560 51.765 1.00 10.00 O ATOM 722 OE2 GLU A 270 14.672 -5.959 50.655 1.00 10.00 O1- ATOM 723 H GLU A 270 14.514 -2.909 46.925 1.00 10.00 H ATOM 724 N LEU A 271 14.704 0.061 48.229 1.00 10.00 N ATOM 725 CA LEU A 271 15.042 1.466 48.404 1.00 10.00 C ATOM 726 C LEU A 271 14.078 2.318 47.599 1.00 10.00 C ATOM 727 O LEU A 271 13.587 3.340 48.074 1.00 10.00 O ATOM 728 CB LEU A 271 16.475 1.745 47.943 1.00 10.00 C ATOM 729 CG LEU A 271 17.592 1.230 48.848 1.00 10.00 C ATOM 730 CD1 LEU A 271 18.934 1.332 48.140 1.00 10.00 C ATOM 731 CD2 LEU A 271 17.616 1.996 50.160 1.00 10.00 C ATOM 732 H LEU A 271 15.351 -0.535 47.779 1.00 10.00 H ATOM 733 N TYR A 272 13.794 1.884 46.376 1.00 10.00 N ATOM 734 CA TYR A 272 12.865 2.603 45.520 1.00 10.00 C ATOM 735 C TYR A 272 11.462 2.582 46.112 1.00 10.00 C ATOM 736 O TYR A 272 10.700 3.526 45.947 1.00 10.00 O ATOM 737 CB TYR A 272 12.877 2.071 44.087 1.00 10.00 C ATOM 738 CG TYR A 272 13.909 2.744 43.203 1.00 10.00 C ATOM 739 CD1 TYR A 272 14.321 4.050 43.459 1.00 10.00 C ATOM 740 CD2 TYR A 272 14.476 2.079 42.126 1.00 10.00 C ATOM 741 CE1 TYR A 272 15.266 4.671 42.667 1.00 10.00 C ATOM 742 CE2 TYR A 272 15.424 2.698 41.327 1.00 10.00 C ATOM 743 CZ TYR A 272 15.814 3.993 41.603 1.00 10.00 C ATOM 744 OH TYR A 272 16.768 4.607 40.825 1.00 10.00 O ATOM 745 H TYR A 272 14.218 1.062 46.047 1.00 10.00 H ATOM 746 HH TYR A 272 17.490 4.915 41.393 1.00 10.00 H ATOM 747 N ARG A 273 11.125 1.504 46.809 1.00 10.00 N ATOM 748 CA ARG A 273 9.822 1.383 47.458 1.00 10.00 C ATOM 749 C ARG A 273 9.784 2.269 48.698 1.00 10.00 C ATOM 750 O ARG A 273 8.756 2.854 49.041 1.00 10.00 O ATOM 751 CB ARG A 273 9.542 -0.070 47.849 1.00 10.00 C ATOM 752 CG ARG A 273 9.319 -1.009 46.673 1.00 10.00 C ATOM 753 CD ARG A 273 9.265 -2.457 47.129 1.00 10.00 C ATOM 754 NE ARG A 273 9.360 -3.389 46.004 1.00 10.00 N ATOM 755 CZ ARG A 273 9.772 -4.653 46.119 1.00 10.00 C ATOM 756 NH1 ARG A 273 10.118 -5.146 47.308 1.00 10.00 N1+ ATOM 757 NH2 ARG A 273 9.818 -5.437 45.048 1.00 10.00 N ATOM 758 H ARG A 273 11.765 0.760 46.872 1.00 10.00 H ATOM 759 HE ARG A 273 9.084 -3.049 45.118 1.00 10.00 H ATOM 760 HH11 ARG A 273 10.063 -4.572 48.128 1.00 10.00 H ATOM 761 HH12 ARG A 273 10.433 -6.097 47.392 1.00 10.00 H ATOM 762 HH21 ARG A 273 9.539 -5.084 44.155 1.00 10.00 H ATOM 763 HH22 ARG A 273 10.133 -6.387 45.133 1.00 10.00 H ATOM 764 N GLN A 274 10.929 2.361 49.360 1.00 10.00 N ATOM 765 CA GLN A 274 11.068 3.179 50.554 1.00 10.00 C ATOM 766 C GLN A 274 10.994 4.653 50.189 1.00 10.00 C ATOM 767 O GLN A 274 10.697 5.497 51.034 1.00 10.00 O ATOM 768 CB GLN A 274 12.403 2.879 51.242 1.00 10.00 C ATOM 769 CG GLN A 274 12.279 2.426 52.687 1.00 10.00 C ATOM 770 CD GLN A 274 11.726 3.507 53.598 1.00 10.00 C ATOM 771 OE1 GLN A 274 12.471 4.337 54.119 1.00 10.00 O ATOM 772 NE2 GLN A 274 10.417 3.504 53.794 1.00 10.00 N ATOM 773 H GLN A 274 11.705 1.847 49.045 1.00 10.00 H ATOM 774 HE21 GLN A 274 9.880 2.816 53.345 1.00 10.00 H ATOM 775 HE22 GLN A 274 10.036 4.189 54.385 1.00 10.00 H ATOM 776 N LYS A 275 11.281 4.954 48.926 1.00 10.00 N ATOM 777 CA LYS A 275 11.233 6.316 48.433 1.00 10.00 C ATOM 778 C LYS A 275 9.926 6.585 47.694 1.00 10.00 C ATOM 779 O LYS A 275 9.383 7.682 47.771 1.00 10.00 O ATOM 780 CB LYS A 275 12.420 6.598 47.507 1.00 10.00 C ATOM 781 CG LYS A 275 13.608 7.258 48.187 1.00 10.00 C ATOM 782 CD LYS A 275 14.541 6.225 48.794 1.00 10.00 C ATOM 783 CE LYS A 275 15.781 6.874 49.375 1.00 10.00 C ATOM 784 NZ LYS A 275 16.740 5.863 49.880 1.00 10.00 N1+ ATOM 785 H LYS A 275 11.551 4.237 48.317 1.00 10.00 H ATOM 786 HZ1 LYS A 275 16.226 5.059 50.292 1.00 10.00 H ATOM 787 HZ2 LYS A 275 17.341 6.283 50.615 1.00 10.00 H ATOM 788 HZ3 LYS A 275 17.349 5.516 49.103 1.00 10.00 H ATOM 789 N VAL A 276 9.414 5.574 47.001 1.00 10.00 N ATOM 790 CA VAL A 276 8.183 5.713 46.229 1.00 10.00 C ATOM 791 C VAL A 276 7.010 6.203 47.074 1.00 10.00 C ATOM 792 O VAL A 276 6.214 7.007 46.607 1.00 10.00 O ATOM 793 CB VAL A 276 7.808 4.430 45.442 1.00 10.00 C ATOM 794 CG1 VAL A 276 7.125 3.396 46.327 1.00 10.00 C ATOM 795 CG2 VAL A 276 6.938 4.774 44.244 1.00 10.00 C ATOM 796 H VAL A 276 9.880 4.710 46.998 1.00 10.00 H ATOM 797 N GLU A 277 6.922 5.745 48.317 1.00 10.00 N ATOM 798 CA GLU A 277 5.835 6.158 49.194 1.00 10.00 C ATOM 799 C GLU A 277 5.908 7.652 49.540 1.00 10.00 C ATOM 800 O GLU A 277 4.977 8.397 49.225 1.00 10.00 O ATOM 801 CB GLU A 277 5.736 5.282 50.444 1.00 10.00 C ATOM 802 CG GLU A 277 5.768 3.792 50.158 1.00 10.00 C ATOM 803 CD GLU A 277 5.105 2.979 51.245 1.00 10.00 C ATOM 804 OE1 GLU A 277 5.325 3.277 52.443 1.00 10.00 O ATOM 805 OE2 GLU A 277 4.359 2.033 50.907 1.00 10.00 O1- ATOM 806 H GLU A 277 7.596 5.115 48.648 1.00 10.00 H ATOM 807 N PRO A 278 6.998 8.127 50.190 1.00 10.00 N ATOM 808 CA PRO A 278 7.140 9.543 50.534 1.00 10.00 C ATOM 809 C PRO A 278 7.117 10.430 49.291 1.00 10.00 C ATOM 810 O PRO A 278 6.516 11.503 49.304 1.00 10.00 O ATOM 811 CB PRO A 278 8.500 9.637 51.232 1.00 10.00 C ATOM 812 CG PRO A 278 9.216 8.389 50.849 1.00 10.00 C ATOM 813 CD PRO A 278 8.154 7.344 50.668 1.00 10.00 C ATOM 814 N LEU A 279 7.759 9.973 48.216 1.00 10.00 N ATOM 815 CA LEU A 279 7.792 10.737 46.974 1.00 10.00 C ATOM 816 C LEU A 279 6.402 10.832 46.365 1.00 10.00 C ATOM 817 O LEU A 279 6.012 11.882 45.863 1.00 10.00 O ATOM 818 CB LEU A 279 8.789 10.156 45.962 1.00 10.00 C ATOM 819 CG LEU A 279 10.253 10.063 46.408 1.00 10.00 C ATOM 820 CD1 LEU A 279 11.161 9.755 45.229 1.00 10.00 C ATOM 821 CD2 LEU A 279 10.698 11.325 47.129 1.00 10.00 C ATOM 822 H LEU A 279 8.222 9.107 48.263 1.00 10.00 H ATOM 823 N ARG A 280 5.647 9.736 46.417 1.00 10.00 N ATOM 824 CA ARG A 280 4.292 9.726 45.886 1.00 10.00 C ATOM 825 C ARG A 280 3.422 10.669 46.698 1.00 10.00 C ATOM 826 O ARG A 280 2.581 11.371 46.145 1.00 10.00 O ATOM 827 CB ARG A 280 3.700 8.316 45.898 1.00 10.00 C ATOM 828 CG ARG A 280 2.323 8.205 45.265 1.00 10.00 C ATOM 829 CD ARG A 280 1.861 6.758 45.197 1.00 10.00 C ATOM 830 NE ARG A 280 2.674 5.963 44.276 1.00 10.00 N ATOM 831 CZ ARG A 280 2.488 4.664 44.047 1.00 10.00 C ATOM 832 NH1 ARG A 280 1.516 4.007 44.672 1.00 10.00 N1+ ATOM 833 NH2 ARG A 280 3.277 4.021 43.188 1.00 10.00 N ATOM 834 H ARG A 280 6.015 8.913 46.815 1.00 10.00 H ATOM 835 HE ARG A 280 3.399 6.426 43.801 1.00 10.00 H ATOM 836 HH11 ARG A 280 0.915 4.491 45.316 1.00 10.00 H ATOM 837 HH12 ARG A 280 1.373 3.031 44.500 1.00 10.00 H ATOM 838 HH21 ARG A 280 3.142 3.042 43.011 1.00 10.00 H ATOM 839 HH22 ARG A 280 4.008 4.515 42.709 1.00 10.00 H ATOM 840 N ALA A 281 3.637 10.679 48.009 1.00 10.00 N ATOM 841 CA ALA A 281 2.889 11.558 48.891 1.00 10.00 C ATOM 842 C ALA A 281 3.210 13.010 48.555 1.00 10.00 C ATOM 843 O ALA A 281 2.313 13.848 48.473 1.00 10.00 O ATOM 844 CB ALA A 281 3.202 11.253 50.346 1.00 10.00 C ATOM 845 H ALA A 281 4.314 10.081 48.392 1.00 10.00 H ATOM 846 N GLU A 282 4.497 13.296 48.341 1.00 10.00 N ATOM 847 CA GLU A 282 4.932 14.641 47.976 1.00 10.00 C ATOM 848 C GLU A 282 4.295 15.036 46.649 1.00 10.00 C ATOM 849 O GLU A 282 3.799 16.151 46.487 1.00 10.00 O ATOM 850 CB GLU A 282 6.461 14.710 47.852 1.00 10.00 C ATOM 851 CG GLU A 282 7.207 14.548 49.167 1.00 10.00 C ATOM 852 CD GLU A 282 8.687 14.856 49.043 1.00 10.00 C ATOM 853 OE1 GLU A 282 9.376 14.197 48.232 1.00 10.00 O ATOM 854 OE2 GLU A 282 9.174 15.759 49.758 1.00 10.00 O1- ATOM 855 H GLU A 282 5.169 12.585 48.447 1.00 10.00 H ATOM 856 N LEU A 283 4.314 14.101 45.706 1.00 10.00 N ATOM 857 CA LEU A 283 3.732 14.320 44.391 1.00 10.00 C ATOM 858 C LEU A 283 2.231 14.547 44.507 1.00 10.00 C ATOM 859 O LEU A 283 1.690 15.466 43.902 1.00 10.00 O ATOM 860 CB LEU A 283 4.023 13.139 43.457 1.00 10.00 C ATOM 861 CG LEU A 283 5.479 12.959 43.010 1.00 10.00 C ATOM 862 CD1 LEU A 283 5.622 11.736 42.117 1.00 10.00 C ATOM 863 CD2 LEU A 283 5.990 14.203 42.302 1.00 10.00 C ATOM 864 H LEU A 283 4.749 13.242 45.901 1.00 10.00 H ATOM 865 N GLN A 284 1.575 13.717 45.307 1.00 10.00 N ATOM 866 CA GLN A 284 0.136 13.818 45.515 1.00 10.00 C ATOM 867 C GLN A 284 -0.236 15.159 46.133 1.00 10.00 C ATOM 868 O GLN A 284 -1.052 15.892 45.584 1.00 10.00 O ATOM 869 CB GLN A 284 -0.362 12.678 46.404 1.00 10.00 C ATOM 870 CG GLN A 284 -1.874 12.543 46.459 1.00 10.00 C ATOM 871 CD GLN A 284 -2.319 11.382 47.326 1.00 10.00 C ATOM 872 OE1 GLN A 284 -1.668 11.037 48.311 1.00 10.00 O ATOM 873 NE2 GLN A 284 -3.426 10.762 46.957 1.00 10.00 N ATOM 874 H GLN A 284 2.075 13.007 45.772 1.00 10.00 H ATOM 875 HE21 GLN A 284 -3.892 11.080 46.155 1.00 10.00 H ATOM 876 HE22 GLN A 284 -3.742 10.013 47.506 1.00 10.00 H ATOM 877 N GLU A 285 0.378 15.477 47.269 1.00 10.00 N ATOM 878 CA GLU A 285 0.107 16.734 47.961 1.00 10.00 C ATOM 879 C GLU A 285 0.484 17.924 47.089 1.00 10.00 C ATOM 880 O GLU A 285 -0.228 18.927 47.057 1.00 10.00 O ATOM 881 CB GLU A 285 0.843 16.798 49.297 1.00 10.00 C ATOM 882 CG GLU A 285 0.336 15.791 50.315 1.00 10.00 C ATOM 883 CD GLU A 285 1.139 15.808 51.592 1.00 10.00 C ATOM 884 OE1 GLU A 285 1.192 16.863 52.249 1.00 10.00 O ATOM 885 OE2 GLU A 285 1.730 14.764 51.946 1.00 10.00 O1- ATOM 886 H GLU A 285 1.030 14.846 47.655 1.00 10.00 H ATOM 887 N GLY A 286 1.600 17.798 46.383 1.00 10.00 N ATOM 888 CA GLY A 286 2.046 18.856 45.501 1.00 10.00 C ATOM 889 C GLY A 286 1.078 19.060 44.355 1.00 10.00 C ATOM 890 O GLY A 286 0.683 20.186 44.064 1.00 10.00 O ATOM 891 H GLY A 286 2.131 16.973 46.467 1.00 10.00 H ATOM 892 N ALA A 287 0.676 17.961 43.719 1.00 10.00 N ATOM 893 CA ALA A 287 -0.266 18.016 42.608 1.00 10.00 C ATOM 894 C ALA A 287 -1.595 18.581 43.079 1.00 10.00 C ATOM 895 O ALA A 287 -2.260 19.309 42.350 1.00 10.00 O ATOM 896 CB ALA A 287 -0.455 16.641 41.989 1.00 10.00 C ATOM 897 H ALA A 287 1.023 17.088 44.008 1.00 10.00 H ATOM 898 N ARG A 288 -1.972 18.242 44.311 1.00 10.00 N ATOM 899 CA ARG A 288 -3.208 18.736 44.902 1.00 10.00 C ATOM 900 C ARG A 288 -3.212 20.257 44.889 1.00 10.00 C ATOM 901 O ARG A 288 -4.150 20.879 44.392 1.00 10.00 O ATOM 902 CB ARG A 288 -3.355 18.245 46.344 1.00 10.00 C ATOM 903 CG ARG A 288 -3.919 16.843 46.494 1.00 10.00 C ATOM 904 CD ARG A 288 -3.889 16.415 47.950 1.00 10.00 C ATOM 905 NE ARG A 288 -4.610 15.167 48.185 1.00 10.00 N ATOM 906 CZ ARG A 288 -4.768 14.626 49.396 1.00 10.00 C ATOM 907 NH1 ARG A 288 -4.251 15.229 50.461 1.00 10.00 N1+ ATOM 908 NH2 ARG A 288 -5.438 13.489 49.542 1.00 10.00 N ATOM 909 H ARG A 288 -1.404 17.628 44.830 1.00 10.00 H ATOM 910 HE ARG A 288 -4.995 14.712 47.400 1.00 10.00 H ATOM 911 HH11 ARG A 288 -3.740 16.087 50.356 1.00 10.00 H ATOM 912 HH12 ARG A 288 -4.365 14.830 51.376 1.00 10.00 H ATOM 913 HH21 ARG A 288 -5.829 13.022 48.742 1.00 10.00 H ATOM 914 HH22 ARG A 288 -5.562 13.090 50.456 1.00 10.00 H ATOM 915 N GLN A 289 -2.144 20.843 45.418 1.00 10.00 N ATOM 916 CA GLN A 289 -2.005 22.287 45.485 1.00 10.00 C ATOM 917 C GLN A 289 -1.848 22.891 44.091 1.00 10.00 C ATOM 918 O GLN A 289 -2.511 23.875 43.755 1.00 10.00 O ATOM 919 CB GLN A 289 -0.793 22.650 46.347 1.00 10.00 C ATOM 920 CG GLN A 289 -0.787 24.088 46.839 1.00 10.00 C ATOM 921 CD GLN A 289 0.510 24.463 47.532 1.00 10.00 C ATOM 922 OE1 GLN A 289 1.206 23.610 48.079 1.00 10.00 O ATOM 923 NE2 GLN A 289 0.837 25.745 47.521 1.00 10.00 N ATOM 924 H GLN A 289 -1.427 20.280 45.786 1.00 10.00 H ATOM 925 HE21 GLN A 289 0.234 26.374 47.070 1.00 10.00 H ATOM 926 HE22 GLN A 289 1.666 26.014 47.970 1.00 10.00 H ATOM 927 N LYS A 290 -0.978 22.293 43.283 1.00 10.00 N ATOM 928 CA LYS A 290 -0.723 22.774 41.932 1.00 10.00 C ATOM 929 C LYS A 290 -1.985 22.762 41.069 1.00 10.00 C ATOM 930 O LYS A 290 -2.252 23.716 40.336 1.00 10.00 O ATOM 931 CB LYS A 290 0.395 21.959 41.271 1.00 10.00 C ATOM 932 CG LYS A 290 1.779 22.197 41.861 1.00 10.00 C ATOM 933 CD LYS A 290 2.716 21.044 41.538 1.00 10.00 C ATOM 934 CE LYS A 290 4.050 21.197 42.251 1.00 10.00 C ATOM 935 NZ LYS A 290 4.800 19.915 42.327 1.00 10.00 N1+ ATOM 936 H LYS A 290 -0.490 21.501 43.608 1.00 10.00 H ATOM 937 HZ1 LYS A 290 5.112 19.628 41.380 1.00 10.00 H ATOM 938 HZ2 LYS A 290 4.198 19.165 42.721 1.00 10.00 H ATOM 939 HZ3 LYS A 290 5.640 20.023 42.940 1.00 10.00 H ATOM 940 N LEU A 291 -2.761 21.686 41.162 1.00 10.00 N ATOM 941 CA LEU A 291 -3.991 21.568 40.389 1.00 10.00 C ATOM 942 C LEU A 291 -5.098 22.430 40.974 1.00 10.00 C ATOM 943 O LEU A 291 -5.873 23.036 40.236 1.00 10.00 O ATOM 944 CB LEU A 291 -4.439 20.111 40.270 1.00 10.00 C ATOM 945 CG LEU A 291 -3.574 19.213 39.377 1.00 10.00 C ATOM 946 CD1 LEU A 291 -4.163 17.816 39.296 1.00 10.00 C ATOM 947 CD2 LEU A 291 -3.419 19.806 37.983 1.00 10.00 C ATOM 948 H LEU A 291 -2.496 20.949 41.760 1.00 10.00 H ATOM 949 N HIS A 292 -5.166 22.491 42.302 1.00 10.00 N ATOM 950 CA HIS A 292 -6.179 23.296 42.971 1.00 10.00 C ATOM 951 C HIS A 292 -6.006 24.762 42.595 1.00 10.00 C ATOM 952 O HIS A 292 -6.981 25.464 42.327 1.00 10.00 O ATOM 953 CB HIS A 292 -6.101 23.120 44.488 1.00 10.00 C ATOM 954 CG HIS A 292 -7.366 23.470 45.209 1.00 10.00 C ATOM 955 ND1 HIS A 292 -7.664 24.771 45.542 1.00 10.00 N ATOM 956 CD2 HIS A 292 -8.355 22.657 45.648 1.00 10.00 C ATOM 957 CE1 HIS A 292 -8.824 24.724 46.176 1.00 10.00 C ATOM 958 NE2 HIS A 292 -9.275 23.465 46.261 1.00 10.00 N ATOM 959 H HIS A 292 -4.524 21.978 42.843 1.00 10.00 H ATOM 960 HE2 HIS A 292 -10.105 23.178 46.696 1.00 10.00 H ATOM 961 N GLU A 293 -4.753 25.206 42.565 1.00 10.00 N ATOM 962 CA GLU A 293 -4.432 26.582 42.199 1.00 10.00 C ATOM 963 C GLU A 293 -4.887 26.842 40.764 1.00 10.00 C ATOM 964 O GLU A 293 -5.433 27.902 40.450 1.00 10.00 O ATOM 965 CB GLU A 293 -2.925 26.816 42.319 1.00 10.00 C ATOM 966 CG GLU A 293 -2.506 28.276 42.238 1.00 10.00 C ATOM 967 CD GLU A 293 -2.803 29.046 43.512 1.00 10.00 C ATOM 968 OE1 GLU A 293 -3.809 29.782 43.550 1.00 10.00 O ATOM 969 OE2 GLU A 293 -2.018 28.926 44.480 1.00 10.00 O1- ATOM 970 H GLU A 293 -4.022 24.593 42.805 1.00 10.00 H ATOM 971 N LEU A 294 -4.675 25.850 39.901 1.00 10.00 N ATOM 972 CA LEU A 294 -5.074 25.949 38.508 1.00 10.00 C ATOM 973 C LEU A 294 -6.589 26.064 38.399 1.00 10.00 C ATOM 974 O LEU A 294 -7.094 26.786 37.547 1.00 10.00 O ATOM 975 CB LEU A 294 -4.576 24.747 37.700 1.00 10.00 C ATOM 976 CG LEU A 294 -3.068 24.672 37.456 1.00 10.00 C ATOM 977 CD1 LEU A 294 -2.731 23.474 36.580 1.00 10.00 C ATOM 978 CD2 LEU A 294 -2.548 25.966 36.838 1.00 10.00 C ATOM 979 H LEU A 294 -4.236 25.032 40.214 1.00 10.00 H ATOM 980 N GLN A 295 -7.302 25.355 39.275 1.00 10.00 N ATOM 981 CA GLN A 295 -8.762 25.394 39.290 1.00 10.00 C ATOM 982 C GLN A 295 -9.250 26.797 39.647 1.00 10.00 C ATOM 983 O GLN A 295 -10.202 27.313 39.051 1.00 10.00 O ATOM 984 CB GLN A 295 -9.316 24.376 40.288 1.00 10.00 C ATOM 985 CG GLN A 295 -9.049 22.933 39.910 1.00 10.00 C ATOM 986 CD GLN A 295 -9.226 21.984 41.077 1.00 10.00 C ATOM 987 OE1 GLN A 295 -10.029 22.224 41.980 1.00 10.00 O ATOM 988 NE2 GLN A 295 -8.473 20.900 41.069 1.00 10.00 N ATOM 989 H GLN A 295 -6.831 24.785 39.925 1.00 10.00 H ATOM 990 HE21 GLN A 295 -7.857 20.777 40.317 1.00 10.00 H ATOM 991 HE22 GLN A 295 -8.563 20.263 41.809 1.00 10.00 H ATOM 992 N GLU A 296 -8.565 27.423 40.601 1.00 10.00 N ATOM 993 CA GLU A 296 -8.901 28.776 41.036 1.00 10.00 C ATOM 994 C GLU A 296 -8.644 29.777 39.908 1.00 10.00 C ATOM 995 O GLU A 296 -9.072 30.928 39.974 1.00 10.00 O ATOM 996 CB GLU A 296 -8.090 29.159 42.277 1.00 10.00 C ATOM 997 CG GLU A 296 -8.191 28.165 43.423 1.00 10.00 C ATOM 998 CD GLU A 296 -9.531 28.195 44.134 1.00 10.00 C ATOM 999 OE1 GLU A 296 -10.567 27.915 43.488 1.00 10.00 O ATOM 1000 OE2 GLU A 296 -9.554 28.482 45.348 1.00 10.00 O1- ATOM 1001 H GLU A 296 -7.817 26.956 41.032 1.00 10.00 H