>>6W4E:HELIX    3 AA3 SER A  299  LYS A  365  1                                  67    
SPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 SER A 299 LYS A 365 1 67 ATOM 1024 N SER A 299 -11.845 28.133 36.803 1.00 10.00 N ATOM 1025 CA SER A 299 -13.271 28.381 36.936 1.00 10.00 C ATOM 1026 C SER A 299 -13.628 29.854 36.683 1.00 10.00 C ATOM 1027 O SER A 299 -14.329 30.156 35.720 1.00 10.00 O ATOM 1028 CB SER A 299 -13.791 27.879 38.283 1.00 10.00 C ATOM 1029 OG SER A 299 -13.039 26.756 38.713 1.00 10.00 O ATOM 1030 H SER A 299 -11.308 27.949 37.604 1.00 10.00 H ATOM 1031 HG SER A 299 -12.584 26.973 39.536 1.00 10.00 H ATOM 1032 N PRO A 300 -13.121 30.809 37.502 1.00 10.00 N ATOM 1033 CA PRO A 300 -13.441 32.232 37.317 1.00 10.00 C ATOM 1034 C PRO A 300 -12.873 32.783 36.016 1.00 10.00 C ATOM 1035 O PRO A 300 -13.572 33.437 35.238 1.00 10.00 O ATOM 1036 CB PRO A 300 -12.798 32.921 38.523 1.00 10.00 C ATOM 1037 CG PRO A 300 -11.735 31.985 38.982 1.00 10.00 C ATOM 1038 CD PRO A 300 -12.206 30.599 38.641 1.00 10.00 C ATOM 1039 N LEU A 301 -11.607 32.480 35.763 1.00 10.00 N ATOM 1040 CA LEU A 301 -10.942 32.932 34.550 1.00 10.00 C ATOM 1041 C LEU A 301 -11.526 32.218 33.337 1.00 10.00 C ATOM 1042 O LEU A 301 -11.434 32.703 32.210 1.00 10.00 O ATOM 1043 CB LEU A 301 -9.429 32.723 34.638 1.00 10.00 C ATOM 1044 CG LEU A 301 -8.710 33.487 35.755 1.00 10.00 C ATOM 1045 CD1 LEU A 301 -7.209 33.284 35.666 1.00 10.00 C ATOM 1046 CD2 LEU A 301 -9.058 34.966 35.711 1.00 10.00 C ATOM 1047 H LEU A 301 -11.111 31.939 36.412 1.00 10.00 H ATOM 1048 N GLY A 302 -12.119 31.052 33.581 1.00 10.00 N ATOM 1049 CA GLY A 302 -12.749 30.296 32.515 1.00 10.00 C ATOM 1050 C GLY A 302 -14.066 30.935 32.149 1.00 10.00 C ATOM 1051 O GLY A 302 -14.361 31.136 30.977 1.00 10.00 O ATOM 1052 H GLY A 302 -12.125 30.699 34.499 1.00 10.00 H ATOM 1053 N GLU A 303 -14.850 31.274 33.169 1.00 10.00 N ATOM 1054 CA GLU A 303 -16.129 31.939 32.972 1.00 10.00 C ATOM 1055 C GLU A 303 -15.898 33.289 32.320 1.00 10.00 C ATOM 1056 O GLU A 303 -16.652 33.702 31.444 1.00 10.00 O ATOM 1057 CB GLU A 303 -16.851 32.109 34.307 1.00 10.00 C ATOM 1058 CG GLU A 303 -17.415 30.812 34.852 1.00 10.00 C ATOM 1059 CD GLU A 303 -18.060 30.985 36.206 1.00 10.00 C ATOM 1060 OE1 GLU A 303 -17.427 30.624 37.219 1.00 10.00 O ATOM 1061 OE2 GLU A 303 -19.210 31.477 36.266 1.00 10.00 O1- ATOM 1062 H GLU A 303 -14.564 31.052 34.085 1.00 10.00 H ATOM 1063 N GLU A 304 -14.839 33.956 32.753 1.00 10.00 N ATOM 1064 CA GLU A 304 -14.467 35.250 32.205 1.00 10.00 C ATOM 1065 C GLU A 304 -14.108 35.093 30.732 1.00 10.00 C ATOM 1066 O GLU A 304 -14.521 35.893 29.893 1.00 10.00 O ATOM 1067 CB GLU A 304 -13.282 35.832 32.978 1.00 10.00 C ATOM 1068 CG GLU A 304 -12.712 37.097 32.365 1.00 10.00 C ATOM 1069 CD GLU A 304 -11.317 37.411 32.862 1.00 10.00 C ATOM 1070 OE1 GLU A 304 -10.400 36.604 32.605 1.00 10.00 O ATOM 1071 OE2 GLU A 304 -11.131 38.473 33.495 1.00 10.00 O1- ATOM 1072 H GLU A 304 -14.298 33.570 33.478 1.00 10.00 H ATOM 1073 N MET A 305 -13.336 34.052 30.423 1.00 10.00 N ATOM 1074 CA MET A 305 -12.945 33.777 29.050 1.00 10.00 C ATOM 1075 C MET A 305 -14.182 33.455 28.222 1.00 10.00 C ATOM 1076 O MET A 305 -14.309 33.892 27.085 1.00 10.00 O ATOM 1077 CB MET A 305 -11.947 32.618 28.985 1.00 10.00 C ATOM 1078 CG MET A 305 -10.996 32.688 27.802 1.00 10.00 C ATOM 1079 SD MET A 305 -9.923 34.139 27.860 1.00 10.00 S ATOM 1080 CE MET A 305 -8.963 33.899 26.371 1.00 10.00 C ATOM 1081 H MET A 305 -13.017 33.463 31.140 1.00 10.00 H ATOM 1082 N ARG A 306 -15.102 32.702 28.819 1.00 10.00 N ATOM 1083 CA ARG A 306 -16.347 32.337 28.151 1.00 10.00 C ATOM 1084 C ARG A 306 -17.196 33.579 27.917 1.00 10.00 C ATOM 1085 O ARG A 306 -17.846 33.713 26.882 1.00 10.00 O ATOM 1086 CB ARG A 306 -17.133 31.315 28.982 1.00 10.00 C ATOM 1087 CG ARG A 306 -16.495 29.939 29.048 1.00 10.00 C ATOM 1088 CD ARG A 306 -17.215 29.043 30.047 1.00 10.00 C ATOM 1089 NE ARG A 306 -16.482 27.803 30.312 1.00 10.00 N ATOM 1090 CZ ARG A 306 -16.190 27.351 31.535 1.00 10.00 C ATOM 1091 NH1 ARG A 306 -16.565 28.042 32.605 1.00 10.00 N1+ ATOM 1092 NH2 ARG A 306 -15.523 26.207 31.685 1.00 10.00 N ATOM 1093 H ARG A 306 -14.936 32.377 29.731 1.00 10.00 H ATOM 1094 HE ARG A 306 -16.194 27.277 29.532 1.00 10.00 H ATOM 1095 HH11 ARG A 306 -16.347 27.706 33.528 1.00 10.00 H ATOM 1096 HH12 ARG A 306 -17.069 28.899 32.498 1.00 10.00 H ATOM 1097 HH21 ARG A 306 -15.238 25.677 30.876 1.00 10.00 H ATOM 1098 HH22 ARG A 306 -15.304 25.866 32.604 1.00 10.00 H ATOM 1099 N ASP A 307 -17.178 34.486 28.891 1.00 10.00 N ATOM 1100 CA ASP A 307 -17.928 35.731 28.798 1.00 10.00 C ATOM 1101 C ASP A 307 -17.356 36.590 27.684 1.00 10.00 C ATOM 1102 O ASP A 307 -18.094 37.171 26.888 1.00 10.00 O ATOM 1103 CB ASP A 307 -17.898 36.490 30.127 1.00 10.00 C ATOM 1104 CG ASP A 307 -19.277 36.682 30.725 1.00 10.00 C ATOM 1105 OD1 ASP A 307 -20.217 37.027 29.973 1.00 10.00 O ATOM 1106 OD2 ASP A 307 -19.433 36.488 31.949 1.00 10.00 O1- ATOM 1107 H ASP A 307 -16.651 34.305 29.701 1.00 10.00 H ATOM 1108 N ARG A 308 -16.029 36.654 27.622 1.00 10.00 N ATOM 1109 CA ARG A 308 -15.357 37.419 26.587 1.00 10.00 C ATOM 1110 C ARG A 308 -15.558 36.748 25.238 1.00 10.00 C ATOM 1111 O ARG A 308 -15.618 37.410 24.205 1.00 10.00 O ATOM 1112 CB ARG A 308 -13.872 37.558 26.903 1.00 10.00 C ATOM 1113 CG ARG A 308 -13.583 38.420 28.120 1.00 10.00 C ATOM 1114 CD ARG A 308 -13.976 39.867 27.882 1.00 10.00 C ATOM 1115 NE ARG A 308 -13.606 40.715 29.013 1.00 10.00 N ATOM 1116 CZ ARG A 308 -13.174 41.970 28.897 1.00 10.00 C ATOM 1117 NH1 ARG A 308 -13.050 42.541 27.700 1.00 10.00 N1+ ATOM 1118 NH2 ARG A 308 -12.860 42.659 29.988 1.00 10.00 N ATOM 1119 H ARG A 308 -15.492 36.185 28.299 1.00 10.00 H ATOM 1120 HE ARG A 308 -13.703 40.331 29.917 1.00 10.00 H ATOM 1121 HH11 ARG A 308 -13.282 42.026 26.862 1.00 10.00 H ATOM 1122 HH12 ARG A 308 -12.732 43.490 27.622 1.00 10.00 H ATOM 1123 HH21 ARG A 308 -12.536 43.605 29.912 1.00 10.00 H ATOM 1124 HH22 ARG A 308 -12.949 42.236 30.895 1.00 10.00 H ATOM 1125 N ALA A 309 -15.672 35.420 25.262 1.00 10.00 N ATOM 1126 CA ALA A 309 -15.898 34.650 24.051 1.00 10.00 C ATOM 1127 C ALA A 309 -17.275 34.972 23.499 1.00 10.00 C ATOM 1128 O ALA A 309 -17.475 34.976 22.285 1.00 10.00 O ATOM 1129 CB ALA A 309 -15.768 33.159 24.321 1.00 10.00 C ATOM 1130 H ALA A 309 -15.590 34.950 26.120 1.00 10.00 H ATOM 1131 N ARG A 310 -18.217 35.256 24.399 1.00 10.00 N ATOM 1132 CA ARG A 310 -19.566 35.612 23.999 1.00 10.00 C ATOM 1133 C ARG A 310 -19.511 36.847 23.119 1.00 10.00 C ATOM 1134 O ARG A 310 -20.106 36.883 22.049 1.00 10.00 O ATOM 1135 CB ARG A 310 -20.440 35.885 25.221 1.00 10.00 C ATOM 1136 CG ARG A 310 -20.794 34.651 26.032 1.00 10.00 C ATOM 1137 CD ARG A 310 -21.333 35.042 27.399 1.00 10.00 C ATOM 1138 NE ARG A 310 -22.067 33.950 28.032 1.00 10.00 N ATOM 1139 CZ ARG A 310 -22.210 33.806 29.350 1.00 10.00 C ATOM 1140 NH1 ARG A 310 -21.667 34.684 30.191 1.00 10.00 N1+ ATOM 1141 NH2 ARG A 310 -22.910 32.781 29.829 1.00 10.00 N ATOM 1142 H ARG A 310 -17.993 35.224 25.354 1.00 10.00 H ATOM 1143 HE ARG A 310 -22.478 33.283 27.434 1.00 10.00 H ATOM 1144 HH11 ARG A 310 -21.134 35.473 29.841 1.00 10.00 H ATOM 1145 HH12 ARG A 310 -21.779 34.570 31.178 1.00 10.00 H ATOM 1146 HH21 ARG A 310 -23.026 32.664 30.819 1.00 10.00 H ATOM 1147 HH22 ARG A 310 -23.327 32.117 29.198 1.00 10.00 H ATOM 1148 N ALA A 311 -18.771 37.852 23.577 1.00 10.00 N ATOM 1149 CA ALA A 311 -18.605 39.089 22.823 1.00 10.00 C ATOM 1150 C ALA A 311 -17.740 38.832 21.595 1.00 10.00 C ATOM 1151 O ALA A 311 -17.954 39.431 20.541 1.00 10.00 O ATOM 1152 CB ALA A 311 -17.978 40.163 23.696 1.00 10.00 C ATOM 1153 H ALA A 311 -18.325 37.761 24.446 1.00 10.00 H ATOM 1154 N HIS A 312 -16.759 37.938 21.750 1.00 10.00 N ATOM 1155 CA HIS A 312 -15.867 37.561 20.655 1.00 10.00 C ATOM 1156 C HIS A 312 -16.699 37.119 19.459 1.00 10.00 C ATOM 1157 O HIS A 312 -16.509 37.596 18.343 1.00 10.00 O ATOM 1158 CB HIS A 312 -14.968 36.393 21.086 1.00 10.00 C ATOM 1159 CG HIS A 312 -13.580 36.757 21.522 1.00 10.00 C ATOM 1160 ND1 HIS A 312 -13.303 37.782 22.398 1.00 10.00 N ATOM 1161 CD2 HIS A 312 -12.387 36.194 21.217 1.00 10.00 C ATOM 1162 CE1 HIS A 312 -11.998 37.833 22.615 1.00 10.00 C ATOM 1163 NE2 HIS A 312 -11.423 36.878 21.910 1.00 10.00 N ATOM 1164 H HIS A 312 -16.625 37.533 22.633 1.00 10.00 H ATOM 1165 HD1 HIS A 312 -13.966 38.391 22.801 1.00 10.00 H ATOM 1166 HE2 HIS A 312 -10.447 36.675 21.902 1.00 10.00 H ATOM 1167 N VAL A 313 -17.648 36.224 19.723 1.00 10.00 N ATOM 1168 CA VAL A 313 -18.530 35.700 18.690 1.00 10.00 C ATOM 1169 C VAL A 313 -19.649 36.687 18.370 1.00 10.00 C ATOM 1170 O VAL A 313 -20.028 36.845 17.212 1.00 10.00 O ATOM 1171 CB VAL A 313 -19.150 34.347 19.109 1.00 10.00 C ATOM 1172 CG1 VAL A 313 -19.929 33.728 17.958 1.00 10.00 C ATOM 1173 CG2 VAL A 313 -18.069 33.396 19.598 1.00 10.00 C ATOM 1174 H VAL A 313 -17.753 35.902 20.648 1.00 10.00 H ATOM 1175 N ASP A 314 -20.174 37.357 19.391 1.00 10.00 N ATOM 1176 CA ASP A 314 -21.259 38.326 19.195 1.00 10.00 C ATOM 1177 C ASP A 314 -20.846 39.452 18.255 1.00 10.00 C ATOM 1178 O ASP A 314 -21.590 39.818 17.343 1.00 10.00 O ATOM 1179 CB ASP A 314 -21.751 38.892 20.527 1.00 10.00 C ATOM 1180 CG ASP A 314 -23.069 39.623 20.394 1.00 10.00 C ATOM 1181 OD1 ASP A 314 -24.075 38.982 20.011 1.00 10.00 O ATOM 1182 OD2 ASP A 314 -23.114 40.833 20.693 1.00 10.00 O1- ATOM 1183 H ASP A 314 -19.834 37.190 20.302 1.00 10.00 H ATOM 1184 N ALA A 315 -19.654 39.992 18.479 1.00 10.00 N ATOM 1185 CA ALA A 315 -19.127 41.058 17.638 1.00 10.00 C ATOM 1186 C ALA A 315 -18.915 40.526 16.228 1.00 10.00 C ATOM 1187 O ALA A 315 -19.195 41.212 15.243 1.00 10.00 O ATOM 1188 CB ALA A 315 -17.831 41.605 18.212 1.00 10.00 C ATOM 1189 H ALA A 315 -19.117 39.671 19.239 1.00 10.00 H ATOM 1190 N LEU A 316 -18.439 39.287 16.143 1.00 10.00 N ATOM 1191 CA LEU A 316 -18.209 38.646 14.860 1.00 10.00 C ATOM 1192 C LEU A 316 -19.532 38.456 14.132 1.00 10.00 C ATOM 1193 O LEU A 316 -19.646 38.774 12.960 1.00 10.00 O ATOM 1194 CB LEU A 316 -17.499 37.302 15.039 1.00 10.00 C ATOM 1195 CG LEU A 316 -15.978 37.359 15.203 1.00 10.00 C ATOM 1196 CD1 LEU A 316 -15.415 35.971 15.454 1.00 10.00 C ATOM 1197 CD2 LEU A 316 -15.324 37.986 13.982 1.00 10.00 C ATOM 1198 H LEU A 316 -18.242 38.791 16.968 1.00 10.00 H ATOM 1199 N ARG A 317 -20.536 37.956 14.846 1.00 10.00 N ATOM 1200 CA ARG A 317 -21.863 37.744 14.268 1.00 10.00 C ATOM 1201 C ARG A 317 -22.463 39.067 13.815 1.00 10.00 C ATOM 1202 O ARG A 317 -23.033 39.167 12.733 1.00 10.00 O ATOM 1203 CB ARG A 317 -22.795 37.078 15.278 1.00 10.00 C ATOM 1204 CG ARG A 317 -22.857 35.565 15.171 1.00 10.00 C ATOM 1205 CD ARG A 317 -23.958 35.001 16.062 1.00 10.00 C ATOM 1206 NE ARG A 317 -23.481 34.688 17.408 1.00 10.00 N ATOM 1207 CZ ARG A 317 -23.645 35.478 18.471 1.00 10.00 C ATOM 1208 NH1 ARG A 317 -24.274 36.646 18.350 1.00 10.00 N1+ ATOM 1209 NH2 ARG A 317 -23.181 35.096 19.657 1.00 10.00 N ATOM 1210 H ARG A 317 -20.378 37.716 15.787 1.00 10.00 H ATOM 1211 HE ARG A 317 -23.022 33.828 17.531 1.00 10.00 H ATOM 1212 HH11 ARG A 317 -24.640 36.937 17.460 1.00 10.00 H ATOM 1213 HH12 ARG A 317 -24.390 37.243 19.151 1.00 10.00 H ATOM 1214 HH21 ARG A 317 -23.300 35.688 20.459 1.00 10.00 H ATOM 1215 HH22 ARG A 317 -22.716 34.211 19.760 1.00 10.00 H ATOM 1216 N THR A 318 -22.309 40.083 14.655 1.00 10.00 N ATOM 1217 CA THR A 318 -22.815 41.415 14.356 1.00 10.00 C ATOM 1218 C THR A 318 -22.124 41.983 13.115 1.00 10.00 C ATOM 1219 O THR A 318 -22.700 42.782 12.380 1.00 10.00 O ATOM 1220 CB THR A 318 -22.616 42.361 15.564 1.00 10.00 C ATOM 1221 OG1 THR A 318 -23.323 41.830 16.695 1.00 10.00 O ATOM 1222 CG2 THR A 318 -23.134 43.758 15.265 1.00 10.00 C ATOM 1223 H THR A 318 -21.842 39.933 15.505 1.00 10.00 H ATOM 1224 HG1 THR A 318 -22.810 41.112 17.087 1.00 10.00 H ATOM 1225 N HIS A 319 -20.891 41.548 12.889 1.00 10.00 N ATOM 1226 CA HIS A 319 -20.121 41.991 11.738 1.00 10.00 C ATOM 1227 C HIS A 319 -20.390 41.096 10.528 1.00 10.00 C ATOM 1228 O HIS A 319 -20.445 41.572 9.397 1.00 10.00 O ATOM 1229 CB HIS A 319 -18.624 42.008 12.060 1.00 10.00 C ATOM 1230 CG HIS A 319 -18.043 43.384 12.138 1.00 10.00 C ATOM 1231 ND1 HIS A 319 -17.361 43.859 13.238 1.00 10.00 N ATOM 1232 CD2 HIS A 319 -18.047 44.394 11.237 1.00 10.00 C ATOM 1233 CE1 HIS A 319 -16.977 45.103 13.012 1.00 10.00 C ATOM 1234 NE2 HIS A 319 -17.380 45.448 11.807 1.00 10.00 N ATOM 1235 H HIS A 319 -20.484 40.918 13.520 1.00 10.00 H ATOM 1236 HD1 HIS A 319 -17.165 43.349 14.066 1.00 10.00 H ATOM 1237 HE2 HIS A 319 -17.236 46.326 11.392 1.00 10.00 H ATOM 1238 N LEU A 320 -20.569 39.803 10.776 1.00 10.00 N ATOM 1239 CA LEU A 320 -20.825 38.845 9.706 1.00 10.00 C ATOM 1240 C LEU A 320 -22.229 38.991 9.137 1.00 10.00 C ATOM 1241 O LEU A 320 -22.467 38.650 7.979 1.00 10.00 O ATOM 1242 CB LEU A 320 -20.572 37.403 10.164 1.00 10.00 C ATOM 1243 CG LEU A 320 -19.117 37.042 10.477 1.00 10.00 C ATOM 1244 CD1 LEU A 320 -19.006 35.590 10.913 1.00 10.00 C ATOM 1245 CD2 LEU A 320 -18.227 37.307 9.276 1.00 10.00 C ATOM 1246 H LEU A 320 -20.513 39.477 11.706 1.00 10.00 H ATOM 1247 N ALA A 321 -23.158 39.489 9.946 1.00 10.00 N ATOM 1248 CA ALA A 321 -24.530 39.690 9.490 1.00 10.00 C ATOM 1249 C ALA A 321 -24.581 40.570 8.234 1.00 10.00 C ATOM 1250 O ALA A 321 -25.078 40.128 7.199 1.00 10.00 O ATOM 1251 CB ALA A 321 -25.430 40.208 10.602 1.00 10.00 C ATOM 1252 H ALA A 321 -22.921 39.706 10.879 1.00 10.00 H ATOM 1253 N PRO A 322 -24.065 41.824 8.285 1.00 10.00 N ATOM 1254 CA PRO A 322 -24.053 42.696 7.110 1.00 10.00 C ATOM 1255 C PRO A 322 -23.060 42.195 6.062 1.00 10.00 C ATOM 1256 O PRO A 322 -23.245 42.414 4.864 1.00 10.00 O ATOM 1257 CB PRO A 322 -23.612 44.055 7.660 1.00 10.00 C ATOM 1258 CG PRO A 322 -22.868 43.739 8.912 1.00 10.00 C ATOM 1259 CD PRO A 322 -23.498 42.497 9.470 1.00 10.00 C ATOM 1260 N TYR A 323 -22.009 41.515 6.521 1.00 10.00 N ATOM 1261 CA TYR A 323 -20.995 40.978 5.623 1.00 10.00 C ATOM 1262 C TYR A 323 -21.586 39.904 4.720 1.00 10.00 C ATOM 1263 O TYR A 323 -21.450 39.975 3.503 1.00 10.00 O ATOM 1264 CB TYR A 323 -19.786 40.433 6.393 1.00 10.00 C ATOM 1265 CG TYR A 323 -18.810 41.494 6.859 1.00 10.00 C ATOM 1266 CD1 TYR A 323 -19.071 42.847 6.674 1.00 10.00 C ATOM 1267 CD2 TYR A 323 -17.626 41.138 7.495 1.00 10.00 C ATOM 1268 CE1 TYR A 323 -18.184 43.812 7.115 1.00 10.00 C ATOM 1269 CE2 TYR A 323 -16.731 42.098 7.934 1.00 10.00 C ATOM 1270 CZ TYR A 323 -17.016 43.433 7.744 1.00 10.00 C ATOM 1271 OH TYR A 323 -16.136 44.392 8.195 1.00 10.00 O ATOM 1272 H TYR A 323 -21.915 41.378 7.489 1.00 10.00 H ATOM 1273 HH TYR A 323 -15.308 44.331 7.702 1.00 10.00 H ATOM 1274 N SER A 324 -22.253 38.926 5.320 1.00 10.00 N ATOM 1275 CA SER A 324 -22.871 37.849 4.559 1.00 10.00 C ATOM 1276 C SER A 324 -23.968 38.393 3.659 1.00 10.00 C ATOM 1277 O SER A 324 -24.145 37.928 2.533 1.00 10.00 O ATOM 1278 CB SER A 324 -23.417 36.762 5.484 1.00 10.00 C ATOM 1279 OG SER A 324 -24.234 37.313 6.501 1.00 10.00 O ATOM 1280 H SER A 324 -22.324 38.922 6.300 1.00 10.00 H ATOM 1281 HG SER A 324 -23.681 37.809 7.121 1.00 10.00 H ATOM 1282 N ASP A 325 -24.688 39.392 4.156 1.00 10.00 N ATOM 1283 CA ASP A 325 -25.756 40.023 3.389 1.00 10.00 C ATOM 1284 C ASP A 325 -25.184 40.605 2.105 1.00 10.00 C ATOM 1285 O ASP A 325 -25.652 40.309 1.006 1.00 10.00 O ATOM 1286 CB ASP A 325 -26.427 41.134 4.201 1.00 10.00 C ATOM 1287 CG ASP A 325 -27.871 41.352 3.797 1.00 10.00 C ATOM 1288 OD1 ASP A 325 -28.135 41.610 2.604 1.00 10.00 O ATOM 1289 OD2 ASP A 325 -28.757 41.240 4.672 1.00 10.00 O1- ATOM 1290 H ASP A 325 -24.498 39.709 5.067 1.00 10.00 H ATOM 1291 N GLU A 326 -24.141 41.415 2.256 1.00 10.00 N ATOM 1292 CA GLU A 326 -23.482 42.036 1.119 1.00 10.00 C ATOM 1293 C GLU A 326 -22.713 41.005 0.303 1.00 10.00 C ATOM 1294 O GLU A 326 -22.475 41.201 -0.884 1.00 10.00 O ATOM 1295 CB GLU A 326 -22.576 43.180 1.575 1.00 10.00 C ATOM 1296 CG GLU A 326 -23.336 44.318 2.242 1.00 10.00 C ATOM 1297 CD GLU A 326 -22.456 45.501 2.583 1.00 10.00 C ATOM 1298 OE1 GLU A 326 -21.305 45.287 3.019 1.00 10.00 O ATOM 1299 OE2 GLU A 326 -22.918 46.650 2.426 1.00 10.00 O1- ATOM 1300 H GLU A 326 -23.814 41.607 3.162 1.00 10.00 H ATOM 1301 N LEU A 327 -22.324 39.902 0.944 1.00 10.00 N ATOM 1302 CA LEU A 327 -21.614 38.825 0.257 1.00 10.00 C ATOM 1303 C LEU A 327 -22.553 38.181 -0.753 1.00 10.00 C ATOM 1304 O LEU A 327 -22.148 37.828 -1.859 1.00 10.00 O ATOM 1305 CB LEU A 327 -21.113 37.763 1.246 1.00 10.00 C ATOM 1306 CG LEU A 327 -19.720 37.986 1.848 1.00 10.00 C ATOM 1307 CD1 LEU A 327 -19.437 36.963 2.938 1.00 10.00 C ATOM 1308 CD2 LEU A 327 -18.654 37.912 0.766 1.00 10.00 C ATOM 1309 H LEU A 327 -22.509 39.820 1.906 1.00 10.00 H ATOM 1310 N ARG A 328 -23.815 38.038 -0.357 1.00 10.00 N ATOM 1311 CA ARG A 328 -24.839 37.471 -1.228 1.00 10.00 C ATOM 1312 C ARG A 328 -25.104 38.432 -2.379 1.00 10.00 C ATOM 1313 O ARG A 328 -25.355 38.019 -3.512 1.00 10.00 O ATOM 1314 CB ARG A 328 -26.128 37.223 -0.439 1.00 10.00 C ATOM 1315 CG ARG A 328 -25.975 36.200 0.675 1.00 10.00 C ATOM 1316 CD ARG A 328 -27.146 36.240 1.638 1.00 10.00 C ATOM 1317 NE ARG A 328 -26.845 35.521 2.875 1.00 10.00 N ATOM 1318 CZ ARG A 328 -27.116 35.993 4.093 1.00 10.00 C ATOM 1319 NH1 ARG A 328 -27.690 37.179 4.223 1.00 10.00 N1+ ATOM 1320 NH2 ARG A 328 -26.799 35.289 5.172 1.00 10.00 N ATOM 1321 H ARG A 328 -24.060 38.312 0.554 1.00 10.00 H ATOM 1322 HE ARG A 328 -26.415 34.638 2.792 1.00 10.00 H ATOM 1323 HH11 ARG A 328 -27.896 37.544 5.136 1.00 10.00 H ATOM 1324 HH12 ARG A 328 -27.923 37.719 3.410 1.00 10.00 H ATOM 1325 HH21 ARG A 328 -27.011 35.648 6.084 1.00 10.00 H ATOM 1326 HH22 ARG A 328 -26.347 34.397 5.084 1.00 10.00 H ATOM 1327 N GLN A 329 -25.038 39.721 -2.070 1.00 10.00 N ATOM 1328 CA GLN A 329 -25.237 40.761 -3.067 1.00 10.00 C ATOM 1329 C GLN A 329 -24.059 40.750 -4.039 1.00 10.00 C ATOM 1330 O GLN A 329 -24.236 40.872 -5.252 1.00 10.00 O ATOM 1331 CB GLN A 329 -25.357 42.126 -2.388 1.00 10.00 C ATOM 1332 CG GLN A 329 -26.499 42.229 -1.387 1.00 10.00 C ATOM 1333 CD GLN A 329 -26.438 43.507 -0.572 1.00 10.00 C ATOM 1334 OE1 GLN A 329 -25.962 44.535 -1.050 1.00 10.00 O ATOM 1335 NE2 GLN A 329 -26.903 43.449 0.668 1.00 10.00 N ATOM 1336 H GLN A 329 -24.853 39.979 -1.142 1.00 10.00 H ATOM 1337 HE21 GLN A 329 -27.263 42.592 0.992 1.00 10.00 H ATOM 1338 HE22 GLN A 329 -26.874 44.263 1.215 1.00 10.00 H ATOM 1339 N ARG A 330 -22.858 40.588 -3.488 1.00 10.00 N ATOM 1340 CA ARG A 330 -21.640 40.513 -4.287 1.00 10.00 C ATOM 1341 C ARG A 330 -21.719 39.309 -5.209 1.00 10.00 C ATOM 1342 O ARG A 330 -21.437 39.405 -6.399 1.00 10.00 O ATOM 1343 CB ARG A 330 -20.415 40.369 -3.380 1.00 10.00 C ATOM 1344 CG ARG A 330 -19.872 41.675 -2.831 1.00 10.00 C ATOM 1345 CD ARG A 330 -18.658 41.430 -1.949 1.00 10.00 C ATOM 1346 NE ARG A 330 -17.833 42.626 -1.812 1.00 10.00 N ATOM 1347 CZ ARG A 330 -16.502 42.627 -1.846 1.00 10.00 C ATOM 1348 NH1 ARG A 330 -15.837 41.490 -2.002 1.00 10.00 N1+ ATOM 1349 NH2 ARG A 330 -15.838 43.771 -1.732 1.00 10.00 N ATOM 1350 H ARG A 330 -22.791 40.526 -2.510 1.00 10.00 H ATOM 1351 HE ARG A 330 -18.314 43.489 -1.687 1.00 10.00 H ATOM 1352 HH11 ARG A 330 -14.833 41.487 -2.029 1.00 10.00 H ATOM 1353 HH12 ARG A 330 -16.336 40.627 -2.093 1.00 10.00 H ATOM 1354 HH21 ARG A 330 -16.341 44.629 -1.625 1.00 10.00 H ATOM 1355 HH22 ARG A 330 -14.834 43.781 -1.764 1.00 10.00 H ATOM 1356 N LEU A 331 -22.124 38.178 -4.636 1.00 10.00 N ATOM 1357 CA LEU A 331 -22.273 36.940 -5.387 1.00 10.00 C ATOM 1358 C LEU A 331 -23.269 37.134 -6.516 1.00 10.00 C ATOM 1359 O LEU A 331 -23.011 36.740 -7.648 1.00 10.00 O ATOM 1360 CB LEU A 331 -22.742 35.807 -4.471 1.00 10.00 C ATOM 1361 CG LEU A 331 -21.656 34.876 -3.938 1.00 10.00 C ATOM 1362 CD1 LEU A 331 -22.260 33.849 -2.999 1.00 10.00 C ATOM 1363 CD2 LEU A 331 -20.938 34.190 -5.090 1.00 10.00 C ATOM 1364 H LEU A 331 -22.323 38.175 -3.677 1.00 10.00 H ATOM 1365 N ALA A 332 -24.402 37.755 -6.205 1.00 10.00 N ATOM 1366 CA ALA A 332 -25.430 38.013 -7.201 1.00 10.00 C ATOM 1367 C ALA A 332 -24.877 38.886 -8.321 1.00 10.00 C ATOM 1368 O ALA A 332 -25.064 38.591 -9.500 1.00 10.00 O ATOM 1369 CB ALA A 332 -26.647 38.662 -6.561 1.00 10.00 C ATOM 1370 H ALA A 332 -24.549 38.044 -5.276 1.00 10.00 H ATOM 1371 N ALA A 333 -24.175 39.946 -7.937 1.00 10.00 N ATOM 1372 CA ALA A 333 -23.577 40.867 -8.896 1.00 10.00 C ATOM 1373 C ALA A 333 -22.560 40.146 -9.781 1.00 10.00 C ATOM 1374 O ALA A 333 -22.561 40.305 -11.006 1.00 10.00 O ATOM 1375 CB ALA A 333 -22.931 42.037 -8.168 1.00 10.00 C ATOM 1376 H ALA A 333 -24.063 40.122 -6.977 1.00 10.00 H ATOM 1377 N ARG A 334 -21.711 39.340 -9.155 1.00 10.00 N ATOM 1378 CA ARG A 334 -20.696 38.585 -9.872 1.00 10.00 C ATOM 1379 C ARG A 334 -21.330 37.517 -10.756 1.00 10.00 C ATOM 1380 O ARG A 334 -20.964 37.370 -11.917 1.00 10.00 O ATOM 1381 CB ARG A 334 -19.697 37.946 -8.903 1.00 10.00 C ATOM 1382 CG ARG A 334 -18.678 38.921 -8.327 1.00 10.00 C ATOM 1383 CD ARG A 334 -17.391 38.207 -7.946 1.00 10.00 C ATOM 1384 NE ARG A 334 -16.406 39.111 -7.341 1.00 10.00 N ATOM 1385 CZ ARG A 334 -15.258 39.453 -7.920 1.00 10.00 C ATOM 1386 NH1 ARG A 334 -14.945 38.982 -9.115 1.00 10.00 N1+ ATOM 1387 NH2 ARG A 334 -14.407 40.252 -7.292 1.00 10.00 N ATOM 1388 H ARG A 334 -21.769 39.252 -8.176 1.00 10.00 H ATOM 1389 HE ARG A 334 -16.627 39.492 -6.463 1.00 10.00 H ATOM 1390 HH11 ARG A 334 -14.080 39.241 -9.547 1.00 10.00 H ATOM 1391 HH12 ARG A 334 -15.577 38.372 -9.600 1.00 10.00 H ATOM 1392 HH21 ARG A 334 -14.626 40.609 -6.374 1.00 10.00 H ATOM 1393 HH22 ARG A 334 -13.542 40.507 -7.730 1.00 10.00 H ATOM 1394 N LEU A 335 -22.292 36.781 -10.204 1.00 10.00 N ATOM 1395 CA LEU A 335 -22.978 35.733 -10.950 1.00 10.00 C ATOM 1396 C LEU A 335 -23.685 36.317 -12.161 1.00 10.00 C ATOM 1397 O LEU A 335 -23.632 35.747 -13.245 1.00 10.00 O ATOM 1398 CB LEU A 335 -23.965 34.972 -10.058 1.00 10.00 C ATOM 1399 CG LEU A 335 -23.346 33.961 -9.085 1.00 10.00 C ATOM 1400 CD1 LEU A 335 -24.417 33.368 -8.184 1.00 10.00 C ATOM 1401 CD2 LEU A 335 -22.600 32.867 -9.840 1.00 10.00 C ATOM 1402 H LEU A 335 -22.551 36.948 -9.269 1.00 10.00 H ATOM 1403 N GLU A 336 -24.329 37.465 -11.969 1.00 10.00 N ATOM 1404 CA GLU A 336 -25.035 38.144 -13.051 1.00 10.00 C ATOM 1405 C GLU A 336 -24.056 38.546 -14.145 1.00 10.00 C ATOM 1406 O GLU A 336 -24.310 38.324 -15.328 1.00 10.00 O ATOM 1407 CB GLU A 336 -25.771 39.377 -12.522 1.00 10.00 C ATOM 1408 CG GLU A 336 -27.114 39.076 -11.880 1.00 10.00 C ATOM 1409 CD GLU A 336 -28.202 38.821 -12.902 1.00 10.00 C ATOM 1410 OE1 GLU A 336 -28.471 37.641 -13.204 1.00 10.00 O ATOM 1411 OE2 GLU A 336 -28.800 39.797 -13.395 1.00 10.00 O1- ATOM 1412 H GLU A 336 -24.337 37.866 -11.069 1.00 10.00 H ATOM 1413 N ALA A 337 -22.927 39.118 -13.738 1.00 10.00 N ATOM 1414 CA ALA A 337 -21.899 39.537 -14.676 1.00 10.00 C ATOM 1415 C ALA A 337 -21.343 38.323 -15.405 1.00 10.00 C ATOM 1416 O ALA A 337 -21.262 38.305 -16.633 1.00 10.00 O ATOM 1417 CB ALA A 337 -20.789 40.280 -13.950 1.00 10.00 C ATOM 1418 H ALA A 337 -22.780 39.258 -12.775 1.00 10.00 H ATOM 1419 N LEU A 338 -20.998 37.293 -14.634 1.00 10.00 N ATOM 1420 CA LEU A 338 -20.463 36.054 -15.187 1.00 10.00 C ATOM 1421 C LEU A 338 -21.500 35.351 -16.063 1.00 10.00 C ATOM 1422 O LEU A 338 -21.155 34.538 -16.917 1.00 10.00 O ATOM 1423 CB LEU A 338 -19.987 35.119 -14.071 1.00 10.00 C ATOM 1424 CG LEU A 338 -18.737 35.557 -13.303 1.00 10.00 C ATOM 1425 CD1 LEU A 338 -18.423 34.572 -12.188 1.00 10.00 C ATOM 1426 CD2 LEU A 338 -17.552 35.700 -14.247 1.00 10.00 C ATOM 1427 H LEU A 338 -21.098 37.375 -13.656 1.00 10.00 H ATOM 1428 N LYS A 339 -22.775 35.656 -15.839 1.00 10.00 N ATOM 1429 CA LYS A 339 -23.850 35.076 -16.638 1.00 10.00 C ATOM 1430 C LYS A 339 -24.021 35.850 -17.935 1.00 10.00 C ATOM 1431 O LYS A 339 -24.181 35.255 -19.000 1.00 10.00 O ATOM 1432 CB LYS A 339 -25.169 35.004 -15.867 1.00 10.00 C ATOM 1433 CG LYS A 339 -25.318 33.744 -15.030 1.00 10.00 C ATOM 1434 CD LYS A 339 -26.699 33.650 -14.405 1.00 10.00 C ATOM 1435 CE LYS A 339 -26.799 32.450 -13.478 1.00 10.00 C ATOM 1436 NZ LYS A 339 -28.130 32.360 -12.833 1.00 10.00 N1+ ATOM 1437 H LYS A 339 -22.996 36.279 -15.113 1.00 10.00 H ATOM 1438 HZ1 LYS A 339 -28.141 31.583 -12.136 1.00 10.00 H ATOM 1439 HZ2 LYS A 339 -28.862 32.183 -13.547 1.00 10.00 H ATOM 1440 HZ3 LYS A 339 -28.352 33.251 -12.344 1.00 10.00 H ATOM 1441 N GLU A 340 -23.995 37.175 -17.847 1.00 10.00 N ATOM 1442 CA GLU A 340 -24.106 38.014 -19.035 1.00 10.00 C ATOM 1443 C GLU A 340 -22.913 37.736 -19.935 1.00 10.00 C ATOM 1444 O GLU A 340 -23.059 37.346 -21.098 1.00 10.00 O ATOM 1445 CB GLU A 340 -24.081 39.490 -18.645 1.00 10.00 C ATOM 1446 CG GLU A 340 -25.390 40.018 -18.098 1.00 10.00 C ATOM 1447 CD GLU A 340 -25.389 41.527 -17.984 1.00 10.00 C ATOM 1448 OE1 GLU A 340 -24.342 42.155 -18.254 1.00 10.00 O ATOM 1449 OE2 GLU A 340 -26.443 42.094 -17.629 1.00 10.00 O1- ATOM 1450 H GLU A 340 -23.911 37.601 -16.961 1.00 10.00 H ATOM 1451 N ASN A 341 -21.733 37.917 -19.363 1.00 10.00 N ATOM 1452 CA ASN A 341 -20.486 37.687 -20.062 1.00 10.00 C ATOM 1453 C ASN A 341 -20.380 36.220 -20.452 1.00 10.00 C ATOM 1454 O ASN A 341 -19.940 35.884 -21.551 1.00 10.00 O ATOM 1455 CB ASN A 341 -19.321 38.071 -19.143 1.00 10.00 C ATOM 1456 CG ASN A 341 -17.967 37.895 -19.791 1.00 10.00 C ATOM 1457 OD1 ASN A 341 -17.379 36.817 -19.743 1.00 10.00 O ATOM 1458 ND2 ASN A 341 -17.454 38.958 -20.382 1.00 10.00 N ATOM 1459 H ASN A 341 -21.703 38.214 -18.425 1.00 10.00 H ATOM 1460 HD21 ASN A 341 -17.971 39.791 -20.365 1.00 10.00 H ATOM 1461 HD22 ASN A 341 -16.576 38.870 -20.809 1.00 10.00 H ATOM 1462 N GLY A 342 -20.817 35.352 -19.547 1.00 10.00 N ATOM 1463 CA GLY A 342 -20.780 33.925 -19.793 1.00 10.00 C ATOM 1464 C GLY A 342 -21.605 33.538 -20.998 1.00 10.00 C ATOM 1465 O GLY A 342 -21.163 32.737 -21.822 1.00 10.00 O ATOM 1466 H GLY A 342 -21.164 35.687 -18.693 1.00 10.00 H ATOM 1467 N GLY A 343 -22.802 34.110 -21.097 1.00 10.00 N ATOM 1468 CA GLY A 343 -23.672 33.836 -22.223 1.00 10.00 C ATOM 1469 C GLY A 343 -23.025 34.259 -23.522 1.00 10.00 C ATOM 1470 O GLY A 343 -23.102 33.549 -24.527 1.00 10.00 O ATOM 1471 H GLY A 343 -23.103 34.722 -20.386 1.00 10.00 H ATOM 1472 N ALA A 344 -22.381 35.418 -23.491 1.00 10.00 N ATOM 1473 CA ALA A 344 -21.685 35.944 -24.656 1.00 10.00 C ATOM 1474 C ALA A 344 -20.521 35.030 -25.015 1.00 10.00 C ATOM 1475 O ALA A 344 -20.321 34.689 -26.177 1.00 10.00 O ATOM 1476 CB ALA A 344 -21.188 37.355 -24.386 1.00 10.00 C ATOM 1477 H ALA A 344 -22.382 35.936 -22.657 1.00 10.00 H ATOM 1478 N ARG A 345 -19.768 34.622 -23.996 1.00 10.00 N ATOM 1479 CA ARG A 345 -18.632 33.730 -24.183 1.00 10.00 C ATOM 1480 C ARG A 345 -19.084 32.419 -24.799 1.00 10.00 C ATOM 1481 O ARG A 345 -18.441 31.901 -25.703 1.00 10.00 O ATOM 1482 CB ARG A 345 -17.946 33.438 -22.851 1.00 10.00 C ATOM 1483 CG ARG A 345 -17.167 34.603 -22.272 1.00 10.00 C ATOM 1484 CD ARG A 345 -16.289 34.150 -21.117 1.00 10.00 C ATOM 1485 NE ARG A 345 -17.059 33.479 -20.067 1.00 10.00 N ATOM 1486 CZ ARG A 345 -16.726 33.483 -18.774 1.00 10.00 C ATOM 1487 NH1 ARG A 345 -15.638 34.118 -18.366 1.00 10.00 N1+ ATOM 1488 NH2 ARG A 345 -17.487 32.837 -17.895 1.00 10.00 N ATOM 1489 H ARG A 345 -19.976 34.944 -23.093 1.00 10.00 H ATOM 1490 HE ARG A 345 -17.868 32.995 -20.341 1.00 10.00 H ATOM 1491 HH11 ARG A 345 -15.054 34.598 -19.035 1.00 10.00 H ATOM 1492 HH12 ARG A 345 -15.387 34.125 -17.397 1.00 10.00 H ATOM 1493 HH21 ARG A 345 -18.305 32.348 -18.204 1.00 10.00 H ATOM 1494 HH22 ARG A 345 -17.250 32.834 -16.917 1.00 10.00 H ATOM 1495 N LEU A 346 -20.197 31.895 -24.302 1.00 10.00 N ATOM 1496 CA LEU A 346 -20.737 30.640 -24.805 1.00 10.00 C ATOM 1497 C LEU A 346 -21.139 30.769 -26.265 1.00 10.00 C ATOM 1498 O LEU A 346 -20.780 29.928 -27.087 1.00 10.00 O ATOM 1499 CB LEU A 346 -21.914 30.158 -23.954 1.00 10.00 C ATOM 1500 CG LEU A 346 -21.594 29.778 -22.506 1.00 10.00 C ATOM 1501 CD1 LEU A 346 -22.810 29.170 -21.830 1.00 10.00 C ATOM 1502 CD2 LEU A 346 -20.407 28.830 -22.432 1.00 10.00 C ATOM 1503 H LEU A 346 -20.668 32.366 -23.577 1.00 10.00 H ATOM 1504 N ALA A 347 -21.859 31.838 -26.587 1.00 10.00 N ATOM 1505 CA ALA A 347 -22.295 32.082 -27.956 1.00 10.00 C ATOM 1506 C ALA A 347 -21.088 32.220 -28.884 1.00 10.00 C ATOM 1507 O ALA A 347 -21.051 31.633 -29.969 1.00 10.00 O ATOM 1508 CB ALA A 347 -23.155 33.333 -28.023 1.00 10.00 C ATOM 1509 H ALA A 347 -22.106 32.482 -25.885 1.00 10.00 H ATOM 1510 N GLU A 348 -20.100 32.979 -28.433 1.00 10.00 N ATOM 1511 CA GLU A 348 -18.887 33.198 -29.203 1.00 10.00 C ATOM 1512 C GLU A 348 -18.100 31.903 -29.340 1.00 10.00 C ATOM 1513 O GLU A 348 -17.594 31.587 -30.413 1.00 10.00 O ATOM 1514 CB GLU A 348 -18.020 34.261 -28.534 1.00 10.00 C ATOM 1515 CG GLU A 348 -16.740 34.573 -29.285 1.00 10.00 C ATOM 1516 CD GLU A 348 -15.663 35.121 -28.379 1.00 10.00 C ATOM 1517 OE1 GLU A 348 -14.707 34.376 -28.069 1.00 10.00 O ATOM 1518 OE2 GLU A 348 -15.772 36.292 -27.972 1.00 10.00 O1- ATOM 1519 H GLU A 348 -20.188 33.410 -27.554 1.00 10.00 H ATOM 1520 N TYR A 349 -17.994 31.154 -28.249 1.00 10.00 N ATOM 1521 CA TYR A 349 -17.261 29.898 -28.271 1.00 10.00 C ATOM 1522 C TYR A 349 -17.966 28.880 -29.148 1.00 10.00 C ATOM 1523 O TYR A 349 -17.320 28.068 -29.806 1.00 10.00 O ATOM 1524 CB TYR A 349 -17.010 29.341 -26.868 1.00 10.00 C ATOM 1525 CG TYR A 349 -15.680 28.626 -26.759 1.00 10.00 C ATOM 1526 CD1 TYR A 349 -15.608 27.239 -26.768 1.00 10.00 C ATOM 1527 CD2 TYR A 349 -14.494 29.341 -26.661 1.00 10.00 C ATOM 1528 CE1 TYR A 349 -14.389 26.588 -26.684 1.00 10.00 C ATOM 1529 CE2 TYR A 349 -13.275 28.697 -26.573 1.00 10.00 C ATOM 1530 CZ TYR A 349 -13.226 27.319 -26.587 1.00 10.00 C ATOM 1531 OH TYR A 349 -12.009 26.672 -26.508 1.00 10.00 O ATOM 1532 H TYR A 349 -18.412 31.460 -27.408 1.00 10.00 H ATOM 1533 HH TYR A 349 -11.488 27.055 -25.788 1.00 10.00 H ATOM 1534 N HIS A 350 -19.293 28.923 -29.148 1.00 10.00 N ATOM 1535 CA HIS A 350 -20.078 28.025 -29.981 1.00 10.00 C ATOM 1536 C HIS A 350 -19.795 28.334 -31.441 1.00 10.00 C ATOM 1537 O HIS A 350 -19.561 27.430 -32.241 1.00 10.00 O ATOM 1538 CB HIS A 350 -21.577 28.154 -29.685 1.00 10.00 C ATOM 1539 CG HIS A 350 -22.060 27.238 -28.603 1.00 10.00 C ATOM 1540 ND1 HIS A 350 -23.243 26.541 -28.723 1.00 10.00 N ATOM 1541 CD2 HIS A 350 -21.497 26.946 -27.404 1.00 10.00 C ATOM 1542 CE1 HIS A 350 -23.372 25.849 -27.604 1.00 10.00 C ATOM 1543 NE2 HIS A 350 -22.341 26.066 -26.779 1.00 10.00 N ATOM 1544 H HIS A 350 -19.756 29.563 -28.560 1.00 10.00 H ATOM 1545 HE2 HIS A 350 -22.206 25.667 -25.889 1.00 10.00 H ATOM 1546 N ALA A 351 -19.793 29.619 -31.776 1.00 10.00 N ATOM 1547 CA ALA A 351 -19.501 30.051 -33.136 1.00 10.00 C ATOM 1548 C ALA A 351 -18.070 29.665 -33.490 1.00 10.00 C ATOM 1549 O ALA A 351 -17.800 29.182 -34.587 1.00 10.00 O ATOM 1550 CB ALA A 351 -19.689 31.553 -33.269 1.00 10.00 C ATOM 1551 H ALA A 351 -19.996 30.293 -31.089 1.00 10.00 H ATOM 1552 N LYS A 352 -17.168 29.864 -32.531 1.00 10.00 N ATOM 1553 CA LYS A 352 -15.758 29.524 -32.698 1.00 10.00 C ATOM 1554 C LYS A 352 -15.611 28.042 -32.995 1.00 10.00 C ATOM 1555 O LYS A 352 -14.917 27.655 -33.931 1.00 10.00 O ATOM 1556 CB LYS A 352 -14.983 29.864 -31.424 1.00 10.00 C ATOM 1557 CG LYS A 352 -13.551 30.302 -31.665 1.00 10.00 C ATOM 1558 CD LYS A 352 -12.797 30.471 -30.356 1.00 10.00 C ATOM 1559 CE LYS A 352 -13.539 31.382 -29.387 1.00 10.00 C ATOM 1560 NZ LYS A 352 -13.620 32.778 -29.879 1.00 10.00 N1+ ATOM 1561 H LYS A 352 -17.458 30.276 -31.688 1.00 10.00 H ATOM 1562 HZ1 LYS A 352 -14.186 32.823 -30.758 1.00 10.00 H ATOM 1563 HZ2 LYS A 352 -12.671 33.141 -30.081 1.00 10.00 H ATOM 1564 HZ3 LYS A 352 -14.070 33.393 -29.160 1.00 10.00 H ATOM 1565 N ALA A 353 -16.279 27.220 -32.194 1.00 10.00 N ATOM 1566 CA ALA A 353 -16.242 25.775 -32.371 1.00 10.00 C ATOM 1567 C ALA A 353 -16.839 25.391 -33.720 1.00 10.00 C ATOM 1568 O ALA A 353 -16.360 24.475 -34.380 1.00 10.00 O ATOM 1569 CB ALA A 353 -16.979 25.080 -31.237 1.00 10.00 C ATOM 1570 H ALA A 353 -16.814 27.599 -31.461 1.00 10.00 H ATOM 1571 N THR A 354 -17.884 26.110 -34.128 1.00 10.00 N ATOM 1572 CA THR A 354 -18.537 25.856 -35.407 1.00 10.00 C ATOM 1573 C THR A 354 -17.556 26.113 -36.551 1.00 10.00 C ATOM 1574 O THR A 354 -17.430 25.298 -37.467 1.00 10.00 O ATOM 1575 CB THR A 354 -19.795 26.735 -35.578 1.00 10.00 C ATOM 1576 OG1 THR A 354 -20.655 26.556 -34.441 1.00 10.00 O ATOM 1577 CG2 THR A 354 -20.558 26.366 -36.844 1.00 10.00 C ATOM 1578 H THR A 354 -18.222 26.827 -33.552 1.00 10.00 H ATOM 1579 HG1 THR A 354 -20.267 27.004 -33.675 1.00 10.00 H ATOM 1580 N GLU A 355 -16.848 27.239 -36.475 1.00 10.00 N ATOM 1581 CA GLU A 355 -15.863 27.592 -37.488 1.00 10.00 C ATOM 1582 C GLU A 355 -14.699 26.618 -37.437 1.00 10.00 C ATOM 1583 O GLU A 355 -14.203 26.168 -38.470 1.00 10.00 O ATOM 1584 CB GLU A 355 -15.365 29.023 -37.288 1.00 10.00 C ATOM 1585 CG GLU A 355 -16.419 30.083 -37.552 1.00 10.00 C ATOM 1586 CD GLU A 355 -17.124 29.881 -38.875 1.00 10.00 C ATOM 1587 OE1 GLU A 355 -16.468 29.986 -39.934 1.00 10.00 O ATOM 1588 OE2 GLU A 355 -18.340 29.611 -38.864 1.00 10.00 O1- ATOM 1589 H GLU A 355 -16.995 27.848 -35.716 1.00 10.00 H ATOM 1590 N HIS A 356 -14.277 26.281 -36.223 1.00 10.00 N ATOM 1591 CA HIS A 356 -13.185 25.336 -36.029 1.00 10.00 C ATOM 1592 C HIS A 356 -13.525 23.991 -36.654 1.00 10.00 C ATOM 1593 O HIS A 356 -12.666 23.339 -37.239 1.00 10.00 O ATOM 1594 CB HIS A 356 -12.852 25.155 -34.543 1.00 10.00 C ATOM 1595 CG HIS A 356 -11.996 26.241 -33.964 1.00 10.00 C ATOM 1596 ND1 HIS A 356 -11.015 26.907 -34.663 1.00 10.00 N ATOM 1597 CD2 HIS A 356 -11.974 26.762 -32.710 1.00 10.00 C ATOM 1598 CE1 HIS A 356 -10.445 27.791 -33.837 1.00 10.00 C ATOM 1599 NE2 HIS A 356 -10.988 27.743 -32.636 1.00 10.00 N ATOM 1600 H HIS A 356 -14.700 26.696 -35.436 1.00 10.00 H ATOM 1601 HD1 HIS A 356 -10.773 26.759 -35.605 1.00 10.00 H ATOM 1602 N LEU A 357 -14.787 23.583 -36.533 1.00 10.00 N ATOM 1603 CA LEU A 357 -15.236 22.320 -37.107 1.00 10.00 C ATOM 1604 C LEU A 357 -15.121 22.334 -38.628 1.00 10.00 C ATOM 1605 O LEU A 357 -14.769 21.325 -39.241 1.00 10.00 O ATOM 1606 CB LEU A 357 -16.669 21.986 -36.684 1.00 10.00 C ATOM 1607 CG LEU A 357 -16.851 21.500 -35.247 1.00 10.00 C ATOM 1608 CD1 LEU A 357 -18.303 21.130 -34.993 1.00 10.00 C ATOM 1609 CD2 LEU A 357 -15.938 20.320 -34.956 1.00 10.00 C ATOM 1610 H LEU A 357 -15.426 24.144 -36.033 1.00 10.00 H ATOM 1611 N SER A 358 -15.412 23.481 -39.235 1.00 10.00 N ATOM 1612 CA SER A 358 -15.320 23.624 -40.678 1.00 10.00 C ATOM 1613 C SER A 358 -13.873 23.423 -41.125 1.00 10.00 C ATOM 1614 O SER A 358 -13.599 22.684 -42.072 1.00 10.00 O ATOM 1615 CB SER A 358 -15.841 24.995 -41.110 1.00 10.00 C ATOM 1616 OG SER A 358 -17.149 25.213 -40.609 1.00 10.00 O ATOM 1617 H SER A 358 -15.697 24.252 -38.697 1.00 10.00 H ATOM 1618 HG SER A 358 -17.718 24.484 -40.887 1.00 10.00 H ATOM 1619 N THR A 359 -12.947 24.063 -40.423 1.00 10.00 N ATOM 1620 CA THR A 359 -11.538 23.932 -40.741 1.00 10.00 C ATOM 1621 C THR A 359 -11.008 22.568 -40.308 1.00 10.00 C ATOM 1622 O THR A 359 -10.075 22.034 -40.906 1.00 10.00 O ATOM 1623 CB THR A 359 -10.714 25.054 -40.096 1.00 10.00 C ATOM 1624 OG1 THR A 359 -11.527 26.229 -39.988 1.00 10.00 O ATOM 1625 CG2 THR A 359 -9.514 25.372 -40.975 1.00 10.00 C ATOM 1626 H THR A 359 -13.216 24.656 -39.685 1.00 10.00 H ATOM 1627 HG1 THR A 359 -11.375 26.799 -40.749 1.00 10.00 H ATOM 1628 N LEU A 360 -11.605 22.008 -39.262 1.00 10.00 N ATOM 1629 CA LEU A 360 -11.212 20.690 -38.774 1.00 10.00 C ATOM 1630 C LEU A 360 -11.559 19.650 -39.827 1.00 10.00 C ATOM 1631 O LEU A 360 -10.842 18.671 -40.015 1.00 10.00 O ATOM 1632 CB LEU A 360 -11.934 20.364 -37.467 1.00 10.00 C ATOM 1633 CG LEU A 360 -11.615 19.006 -36.839 1.00 10.00 C ATOM 1634 CD1 LEU A 360 -10.257 19.027 -36.157 1.00 10.00 C ATOM 1635 CD2 LEU A 360 -12.705 18.596 -35.863 1.00 10.00 C ATOM 1636 H LEU A 360 -12.317 22.502 -38.794 1.00 10.00 H ATOM 1637 N SER A 361 -12.664 19.891 -40.525 1.00 10.00 N ATOM 1638 CA SER A 361 -13.114 19.003 -41.584 1.00 10.00 C ATOM 1639 C SER A 361 -12.086 18.961 -42.712 1.00 10.00 C ATOM 1640 O SER A 361 -11.982 17.970 -43.430 1.00 10.00 O ATOM 1641 CB SER A 361 -14.480 19.440 -42.113 1.00 10.00 C ATOM 1642 OG SER A 361 -15.448 19.454 -41.076 1.00 10.00 O ATOM 1643 H SER A 361 -13.200 20.687 -40.309 1.00 10.00 H ATOM 1644 HG SER A 361 -15.268 20.192 -40.475 1.00 10.00 H ATOM 1645 N GLU A 362 -11.317 20.037 -42.849 1.00 10.00 N ATOM 1646 CA GLU A 362 -10.281 20.112 -43.872 1.00 10.00 C ATOM 1647 C GLU A 362 -9.189 19.090 -43.561 1.00 10.00 C ATOM 1648 O GLU A 362 -8.529 18.570 -44.460 1.00 10.00 O ATOM 1649 CB GLU A 362 -9.691 21.523 -43.935 1.00 10.00 C ATOM 1650 CG GLU A 362 -10.705 22.610 -44.253 1.00 10.00 C ATOM 1651 CD GLU A 362 -10.972 22.743 -45.739 1.00 10.00 C ATOM 1652 OE1 GLU A 362 -11.091 21.706 -46.424 1.00 10.00 O ATOM 1653 OE2 GLU A 362 -11.072 23.888 -46.230 1.00 10.00 O1- ATOM 1654 H GLU A 362 -11.452 20.803 -42.249 1.00 10.00 H ATOM 1655 N LYS A 363 -9.036 18.789 -42.277 1.00 10.00 N ATOM 1656 CA LYS A 363 -8.049 17.825 -41.818 1.00 10.00 C ATOM 1657 C LYS A 363 -8.670 16.434 -41.740 1.00 10.00 C ATOM 1658 O LYS A 363 -7.968 15.426 -41.785 1.00 10.00 O ATOM 1659 CB LYS A 363 -7.509 18.215 -40.438 1.00 10.00 C ATOM 1660 CG LYS A 363 -7.129 19.682 -40.285 1.00 10.00 C ATOM 1661 CD LYS A 363 -6.259 19.906 -39.051 1.00 10.00 C ATOM 1662 CE LYS A 363 -6.988 19.541 -37.761 1.00 10.00 C ATOM 1663 NZ LYS A 363 -6.125 19.701 -36.556 1.00 10.00 N1+ ATOM 1664 H LYS A 363 -9.611 19.231 -41.612 1.00 10.00 H ATOM 1665 HZ1 LYS A 363 -6.598 19.305 -35.717 1.00 10.00 H ATOM 1666 HZ2 LYS A 363 -5.937 20.708 -36.381 1.00 10.00 H ATOM 1667 HZ3 LYS A 363 -5.217 19.209 -36.692 1.00 10.00 H ATOM 1668 N ALA A 364 -9.994 16.391 -41.640 1.00 10.00 N ATOM 1669 CA ALA A 364 -10.723 15.130 -41.534 1.00 10.00 C ATOM 1670 C ALA A 364 -11.070 14.542 -42.899 1.00 10.00 C ATOM 1671 O ALA A 364 -11.162 13.322 -43.052 1.00 10.00 O ATOM 1672 CB ALA A 364 -11.983 15.325 -40.703 1.00 10.00 C ATOM 1673 H ALA A 364 -10.497 17.234 -41.632 1.00 10.00 H ATOM 1674 N LYS A 365 -11.273 15.398 -43.892 1.00 10.00 N ATOM 1675 CA LYS A 365 -11.611 14.922 -45.223 1.00 10.00 C ATOM 1676 C LYS A 365 -10.483 15.123 -46.245 1.00 10.00 C ATOM 1677 O LYS A 365 -9.837 14.149 -46.619 1.00 10.00 O ATOM 1678 CB LYS A 365 -12.982 15.407 -45.705 1.00 10.00 C ATOM 1679 CG LYS A 365 -14.142 14.671 -45.057 1.00 10.00 C ATOM 1680 CD LYS A 365 -15.395 15.530 -45.007 1.00 10.00 C ATOM 1681 CE LYS A 365 -16.573 14.738 -44.467 1.00 10.00 C ATOM 1682 NZ LYS A 365 -17.745 15.602 -44.164 1.00 10.00 N1+ ATOM 1683 H LYS A 365 -11.207 16.366 -43.721 1.00 10.00 H ATOM 1684 HZ1 LYS A 365 -18.036 16.124 -45.014 1.00 10.00 H ATOM 1685 HZ2 LYS A 365 -17.506 16.287 -43.417 1.00 10.00 H ATOM 1686 HZ3 LYS A 365 -18.544 15.023 -43.839 1.00 10.00 H