>>6WYG:HELIX    9 AA9 ASP B  126  MET B  158  1                                  33    
DPHLADFIETHYLNEQVKAIKELGDHVTNLRCM
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 9 AA9 ASP B 126 MET B 158 1 33 ATOM 2378 N ASP B 126 0.945 57.926 10.915 1.00 54.76 N ANISOU 2378 N ASP B 126 4107 3545 13153 84 -440 -869 N ATOM 2379 CA ASP B 126 1.025 56.898 9.892 1.00 53.43 C ANISOU 2379 CA ASP B 126 3931 3497 12873 15 -490 -715 C ATOM 2380 C ASP B 126 0.903 55.542 10.575 1.00 56.24 C ANISOU 2380 C ASP B 126 4397 3986 12984 31 -466 -768 C ATOM 2381 O ASP B 126 1.916 54.859 10.801 1.00 53.25 O ANISOU 2381 O ASP B 126 4106 3682 12447 8 -518 -837 O ATOM 2382 CB ASP B 126 2.320 57.016 9.103 1.00 57.88 C ANISOU 2382 CB ASP B 126 4484 4059 13450 -51 -587 -681 C ATOM 2383 CG ASP B 126 2.321 56.181 7.843 1.00 53.05 C ANISOU 2383 CG ASP B 126 3854 3544 12758 -118 -633 -498 C ATOM 2384 OD1 ASP B 126 1.623 55.148 7.793 1.00 53.70 O ANISOU 2384 OD1 ASP B 126 3972 3729 12701 -122 -611 -439 O ATOM 2385 OD2 ASP B 126 3.021 56.566 6.886 1.00 58.46 O1- ANISOU 2385 OD2 ASP B 126 4491 4198 13524 -164 -689 -410 O1- ATOM 2386 N PRO B 127 -0.319 55.131 10.927 1.00 52.84 N ANISOU 2386 N PRO B 127 3962 3585 12528 74 -382 -732 N ATOM 2387 CA PRO B 127 -0.472 53.923 11.741 1.00 52.28 C ANISOU 2387 CA PRO B 127 3998 3628 12239 103 -342 -796 C ATOM 2388 C PRO B 127 -0.137 52.646 10.984 1.00 55.76 C ANISOU 2388 C PRO B 127 4471 4203 12514 32 -404 -693 C ATOM 2389 O PRO B 127 0.334 51.679 11.603 1.00 50.31 O ANISOU 2389 O PRO B 127 3884 3607 11624 40 -404 -774 O ATOM 2390 CB PRO B 127 -1.942 53.984 12.177 1.00 57.38 C ANISOU 2390 CB PRO B 127 4602 4245 12953 168 -228 -756 C ATOM 2391 CG PRO B 127 -2.624 54.745 11.108 1.00 53.45 C ANISOU 2391 CG PRO B 127 3964 3673 12670 135 -240 -595 C ATOM 2392 CD PRO B 127 -1.615 55.747 10.591 1.00 54.81 C ANISOU 2392 CD PRO B 127 4103 3763 12959 98 -318 -620 C ATOM 2393 N HIS B 128 -0.305 52.632 9.659 1.00 50.40 N ANISOU 2393 N HIS B 128 3712 3531 11906 -35 -460 -522 N ATOM 2394 CA HIS B 128 0.216 51.519 8.875 1.00 49.13 C ANISOU 2394 CA HIS B 128 3597 3483 11586 -104 -529 -436 C ATOM 2395 C HIS B 128 1.725 51.377 9.054 1.00 49.48 C ANISOU 2395 C HIS B 128 3718 3553 11528 -126 -587 -534 C ATOM 2396 O HIS B 128 2.233 50.269 9.277 1.00 49.68 O ANISOU 2396 O HIS B 128 3835 3685 11358 -141 -602 -565 O ATOM 2397 CB HIS B 128 -0.113 51.684 7.393 1.00 48.92 C ANISOU 2397 CB HIS B 128 3486 3445 11658 -166 -587 -242 C ATOM 2398 CG HIS B 128 0.489 50.605 6.542 1.00 54.70 C ANISOU 2398 CG HIS B 128 4280 4281 12224 -232 -658 -157 C ATOM 2399 ND1 HIS B 128 1.689 50.754 5.873 1.00 51.01 N ANISOU 2399 ND1 HIS B 128 3833 3810 11739 -274 -721 -138 N ATOM 2400 CD2 HIS B 128 0.084 49.331 6.307 1.00 46.96 C ANISOU 2400 CD2 HIS B 128 3351 3407 11085 -260 -668 -92 C ATOM 2401 CE1 HIS B 128 1.978 49.631 5.240 1.00 46.32 C ANISOU 2401 CE1 HIS B 128 3306 3316 10978 -320 -762 -62 C ATOM 2402 NE2 HIS B 128 1.020 48.753 5.482 1.00 46.08 N ANISOU 2402 NE2 HIS B 128 3298 3354 10859 -315 -736 -36 N ATOM 2403 N LEU B 129 2.470 52.485 8.929 1.00 49.18 N ANISOU 2403 N LEU B 129 3638 3414 11633 -129 -621 -578 N ATOM 2404 CA LEU B 129 3.927 52.390 9.025 1.00 48.78 C ANISOU 2404 CA LEU B 129 3643 3377 11514 -154 -683 -655 C ATOM 2405 C LEU B 129 4.344 51.929 10.411 1.00 52.29 C ANISOU 2405 C LEU B 129 4193 3863 11810 -107 -663 -838 C ATOM 2406 O LEU B 129 5.194 51.038 10.547 1.00 48.03 O ANISOU 2406 O LEU B 129 3733 3412 11105 -130 -699 -870 O ATOM 2407 CB LEU B 129 4.583 53.727 8.675 1.00 57.55 C ANISOU 2407 CB LEU B 129 4676 4357 12833 -164 -722 -664 C ATOM 2408 CG LEU B 129 6.127 53.782 8.728 1.00 56.52 C ANISOU 2408 CG LEU B 129 4578 4216 12679 -193 -791 -732 C ATOM 2409 CD1 LEU B 129 6.755 52.674 7.904 1.00 48.12 C ANISOU 2409 CD1 LEU B 129 3559 3262 11462 -248 -829 -624 C ATOM 2410 CD2 LEU B 129 6.665 55.146 8.282 1.00 50.24 C ANISOU 2410 CD2 LEU B 129 3686 3279 12122 -204 -825 -719 C ATOM 2411 N ALA B 130 3.739 52.522 11.446 1.00 49.86 N ANISOU 2411 N ALA B 130 3895 3492 11559 -36 -602 -955 N ATOM 2412 CA ALA B 130 3.941 52.076 12.824 1.00 52.10 C ANISOU 2412 CA ALA B 130 4292 3814 11688 24 -572 -1127 C ATOM 2413 C ALA B 130 3.765 50.567 12.968 1.00 49.01 C ANISOU 2413 C ALA B 130 3980 3572 11070 18 -549 -1094 C ATOM 2414 O ALA B 130 4.672 49.871 13.440 1.00 48.50 O ANISOU 2414 O ALA B 130 4003 3578 10845 13 -585 -1174 O ATOM 2415 CB ALA B 130 2.962 52.785 13.756 1.00 52.69 C ANISOU 2415 CB ALA B 130 4368 3808 11845 110 -482 -1215 C ATOM 2416 N ASP B 131 2.575 50.058 12.620 1.00 48.76 N ANISOU 2416 N ASP B 131 3914 3583 11031 21 -488 -978 N ATOM 2417 CA ASP B 131 2.268 48.653 12.875 1.00 54.63 C ANISOU 2417 CA ASP B 131 4727 4455 11573 24 -454 -954 C ATOM 2418 C ASP B 131 3.160 47.738 12.052 1.00 46.65 C ANISOU 2418 C ASP B 131 3748 3538 10439 -54 -531 -878 C ATOM 2419 O ASP B 131 3.531 46.659 12.519 1.00 48.52 O ANISOU 2419 O ASP B 131 4074 3875 10485 -50 -525 -921 O ATOM 2420 CB ASP B 131 0.785 48.358 12.591 1.00 50.66 C ANISOU 2420 CB ASP B 131 4164 3964 11122 36 -383 -831 C ATOM 2421 CG ASP B 131 0.393 46.914 12.946 1.00 58.33 C ANISOU 2421 CG ASP B 131 5204 5058 11902 44 -340 -810 C ATOM 2422 OD1 ASP B 131 0.553 46.518 14.134 1.00 57.01 O ANISOU 2422 OD1 ASP B 131 5129 4928 11605 109 -284 -939 O ATOM 2423 OD2 ASP B 131 -0.062 46.175 12.031 1.00 48.36 O1- ANISOU 2423 OD2 ASP B 131 3906 3852 10617 -13 -365 -664 O1- ATOM 2424 N PHE B 132 3.522 48.155 10.834 1.00 50.56 N ANISOU 2424 N PHE B 132 4176 3998 11039 -119 -597 -764 N ATOM 2425 CA PHE B 132 4.488 47.395 10.050 1.00 50.16 C ANISOU 2425 CA PHE B 132 4162 4020 10878 -184 -663 -696 C ATOM 2426 C PHE B 132 5.819 47.285 10.790 1.00 46.52 C ANISOU 2426 C PHE B 132 3776 3576 10326 -174 -697 -833 C ATOM 2427 O PHE B 132 6.375 46.184 10.938 1.00 46.08 O ANISOU 2427 O PHE B 132 3799 3620 10088 -190 -707 -844 O ATOM 2428 CB PHE B 132 4.676 48.049 8.676 1.00 45.30 C ANISOU 2428 CB PHE B 132 3464 3343 10406 -240 -717 -556 C ATOM 2429 CG PHE B 132 5.763 47.422 7.857 1.00 55.59 C ANISOU 2429 CG PHE B 132 4808 4702 11612 -297 -774 -487 C ATOM 2430 CD1 PHE B 132 5.493 46.334 7.045 1.00 62.60 C ANISOU 2430 CD1 PHE B 132 5734 5679 12371 -339 -784 -364 C ATOM 2431 CD2 PHE B 132 7.061 47.903 7.911 1.00 54.12 C ANISOU 2431 CD2 PHE B 132 4625 4473 11467 -307 -817 -544 C ATOM 2432 CE1 PHE B 132 6.502 45.736 6.296 1.00 48.49 C ANISOU 2432 CE1 PHE B 132 3998 3939 10488 -384 -825 -299 C ATOM 2433 CE2 PHE B 132 8.062 47.307 7.169 1.00 56.71 C ANISOU 2433 CE2 PHE B 132 4989 4848 11711 -353 -855 -471 C ATOM 2434 CZ PHE B 132 7.769 46.219 6.359 1.00 48.52 C ANISOU 2434 CZ PHE B 132 3999 3901 10535 -388 -854 -348 C ATOM 2435 N ILE B 133 6.340 48.422 11.266 1.00 52.74 N ANISOU 2435 N ILE B 133 4535 4259 11244 -150 -720 -938 N ATOM 2436 CA ILE B 133 7.607 48.415 11.999 1.00 49.40 C ANISOU 2436 CA ILE B 133 4173 3837 10757 -142 -770 -1072 C ATOM 2437 C ILE B 133 7.494 47.495 13.206 1.00 50.61 C ANISOU 2437 C ILE B 133 4437 4081 10709 -90 -731 -1188 C ATOM 2438 O ILE B 133 8.340 46.620 13.421 1.00 55.53 O ANISOU 2438 O ILE B 133 5132 4789 11179 -106 -761 -1216 O ATOM 2439 CB ILE B 133 8.009 49.845 12.402 1.00 49.46 C ANISOU 2439 CB ILE B 133 4133 3705 10954 -119 -804 -1176 C ATOM 2440 CG1 ILE B 133 8.493 50.656 11.185 1.00 47.51 C ANISOU 2440 CG1 ILE B 133 3782 3375 10896 -176 -854 -1059 C ATOM 2441 CG2 ILE B 133 9.075 49.845 13.506 1.00 47.95 C ANISOU 2441 CG2 ILE B 133 4021 3510 10688 -94 -857 -1350 C ATOM 2442 CD1 ILE B 133 9.770 50.187 10.557 1.00 47.87 C ANISOU 2442 CD1 ILE B 133 3836 3458 10895 -232 -917 -1001 C ATOM 2443 N GLU B 134 6.406 47.629 13.959 1.00 46.70 N ANISOU 2443 N GLU B 134 3958 3574 10212 -25 -653 -1242 N ATOM 2444 CA GLU B 134 6.122 46.800 15.126 1.00 54.45 C ANISOU 2444 CA GLU B 134 5044 4636 11010 39 -595 -1342 C ATOM 2445 C GLU B 134 6.201 45.316 14.786 1.00 61.81 C ANISOU 2445 C GLU B 134 6024 5706 11756 3 -586 -1257 C ATOM 2446 O GLU B 134 7.160 44.631 15.171 1.00 74.91 O ANISOU 2446 O GLU B 134 7759 7434 13270 -4 -623 -1315 O ATOM 2447 CB GLU B 134 4.732 47.124 15.690 1.00 54.93 C ANISOU 2447 CB GLU B 134 5092 4657 11122 111 -491 -1357 C ATOM 2448 CG GLU B 134 4.627 48.484 16.370 1.00 58.78 C ANISOU 2448 CG GLU B 134 5567 5012 11754 169 -480 -1480 C ATOM 2449 CD GLU B 134 3.191 48.828 16.794 1.00 72.65 C ANISOU 2449 CD GLU B 134 7299 6722 13582 242 -362 -1468 C ATOM 2450 OE1 GLU B 134 2.232 48.428 16.102 1.00 65.40 O ANISOU 2450 OE1 GLU B 134 6312 5834 12702 219 -315 -1320 O ATOM 2451 OE2 GLU B 134 3.020 49.523 17.821 1.00 80.80 O1- ANISOU 2451 OE2 GLU B 134 8383 7680 14638 323 -318 -1607 O1- ATOM 2452 N THR B 135 5.264 44.850 13.967 1.00 47.66 N ANISOU 2452 N THR B 135 4182 3947 9980 -27 -548 -1110 N ATOM 2453 CA THR B 135 5.066 43.417 13.833 1.00 56.08 C ANISOU 2453 CA THR B 135 5302 5136 10870 -46 -522 -1042 C ATOM 2454 C THR B 135 6.137 42.742 12.974 1.00 57.80 C ANISOU 2454 C THR B 135 5542 5415 11005 -120 -594 -971 C ATOM 2455 O THR B 135 6.337 41.528 13.095 1.00 59.09 O ANISOU 2455 O THR B 135 5775 5683 10994 -130 -580 -956 O ATOM 2456 CB THR B 135 3.650 43.141 13.307 1.00 55.79 C ANISOU 2456 CB THR B 135 5204 5105 10887 -51 -466 -914 C ATOM 2457 OG1 THR B 135 3.361 44.004 12.204 1.00 58.77 O ANISOU 2457 OG1 THR B 135 5481 5402 11448 -98 -508 -806 O ATOM 2458 CG2 THR B 135 2.639 43.436 14.411 1.00 55.83 C ANISOU 2458 CG2 THR B 135 5214 5078 10921 39 -367 -991 C ATOM 2459 N HIS B 136 6.859 43.472 12.128 1.00 63.23 N ANISOU 2459 N HIS B 136 6176 6039 11810 -169 -663 -925 N ATOM 2460 CA HIS B 136 7.890 42.804 11.346 1.00 52.77 C ANISOU 2460 CA HIS B 136 4880 4769 10404 -230 -715 -853 C ATOM 2461 C HIS B 136 9.301 43.150 11.797 1.00 54.48 C ANISOU 2461 C HIS B 136 5120 4961 10621 -229 -771 -952 C ATOM 2462 O HIS B 136 10.267 42.608 11.238 1.00 51.12 O ANISOU 2462 O HIS B 136 4717 4575 10132 -272 -807 -896 O ATOM 2463 CB HIS B 136 7.720 43.131 9.860 1.00 53.02 C ANISOU 2463 CB HIS B 136 4841 4759 10545 -290 -747 -690 C ATOM 2464 CG HIS B 136 6.468 42.557 9.261 1.00 55.50 C ANISOU 2464 CG HIS B 136 5141 5111 10835 -306 -716 -573 C ATOM 2465 ND1 HIS B 136 5.600 43.306 8.496 1.00 58.49 N ANISOU 2465 ND1 HIS B 136 5433 5419 11372 -320 -723 -476 N ATOM 2466 CD2 HIS B 136 5.947 41.308 9.303 1.00 55.44 C ANISOU 2466 CD2 HIS B 136 5191 5200 10675 -313 -686 -534 C ATOM 2467 CE1 HIS B 136 4.587 42.551 8.108 1.00 63.84 C ANISOU 2467 CE1 HIS B 136 6114 6146 11997 -336 -705 -384 C ATOM 2468 NE2 HIS B 136 4.776 41.331 8.581 1.00 60.45 N ANISOU 2468 NE2 HIS B 136 5771 5816 11382 -333 -682 -418 N ATOM 2469 N TYR B 137 9.471 44.019 12.793 1.00 51.91 N ANISOU 2469 N TYR B 137 4792 4566 10366 -179 -782 -1096 N ATOM 2470 CA TYR B 137 10.847 44.377 13.100 1.00 47.65 C ANISOU 2470 CA TYR B 137 4263 3992 9850 -189 -855 -1177 C ATOM 2471 C TYR B 137 11.102 44.400 14.596 1.00 53.89 C ANISOU 2471 C TYR B 137 5130 4790 10555 -125 -862 -1361 C ATOM 2472 O TYR B 137 12.179 43.977 15.032 1.00 65.35 O ANISOU 2472 O TYR B 137 6632 6280 11919 -130 -913 -1422 O ATOM 2473 CB TYR B 137 11.219 45.724 12.431 1.00 54.06 C ANISOU 2473 CB TYR B 137 4973 4672 10895 -217 -906 -1146 C ATOM 2474 CG TYR B 137 11.480 45.524 10.943 1.00 59.91 C ANISOU 2474 CG TYR B 137 5663 5419 11681 -283 -917 -964 C ATOM 2475 CD1 TYR B 137 10.409 45.469 10.042 1.00 59.12 C ANISOU 2475 CD1 TYR B 137 5525 5324 11613 -300 -877 -833 C ATOM 2476 CD2 TYR B 137 12.782 45.335 10.444 1.00 47.29 C ANISOU 2476 CD2 TYR B 137 4062 3823 10084 -324 -966 -918 C ATOM 2477 CE1 TYR B 137 10.607 45.233 8.698 1.00 54.43 C ANISOU 2477 CE1 TYR B 137 4906 4740 11035 -353 -889 -670 C ATOM 2478 CE2 TYR B 137 12.995 45.106 9.087 1.00 46.76 C ANISOU 2478 CE2 TYR B 137 3966 3762 10039 -373 -963 -748 C ATOM 2479 CZ TYR B 137 11.895 45.053 8.220 1.00 58.20 C ANISOU 2479 CZ TYR B 137 5392 5219 11502 -386 -926 -628 C ATOM 2480 OH TYR B 137 12.054 44.825 6.866 1.00 60.72 O ANISOU 2480 OH TYR B 137 5700 5544 11829 -428 -926 -462 O ATOM 2481 N LEU B 138 10.141 44.849 15.408 1.00 55.03 N ANISOU 2481 N LEU B 138 5291 4900 10717 -60 -809 -1448 N ATOM 2482 CA LEU B 138 10.539 45.234 16.761 1.00 55.88 C ANISOU 2482 CA LEU B 138 5471 4977 10783 4 -834 -1635 C ATOM 2483 C LEU B 138 10.659 44.026 17.689 1.00 59.08 C ANISOU 2483 C LEU B 138 5993 5504 10949 47 -804 -1701 C ATOM 2484 O LEU B 138 11.629 43.926 18.460 1.00 48.56 O ANISOU 2484 O LEU B 138 4726 4184 9540 64 -869 -1815 O ATOM 2485 CB LEU B 138 9.581 46.290 17.311 1.00 58.06 C ANISOU 2485 CB LEU B 138 5731 5153 11176 67 -787 -1714 C ATOM 2486 CG LEU B 138 9.553 47.527 16.403 1.00 62.37 C ANISOU 2486 CG LEU B 138 6158 5574 11969 24 -822 -1649 C ATOM 2487 CD1 LEU B 138 8.946 48.712 17.105 1.00 61.16 C ANISOU 2487 CD1 LEU B 138 5997 5300 11940 88 -795 -1761 C ATOM 2488 CD2 LEU B 138 10.958 47.886 15.902 1.00 69.29 C ANISOU 2488 CD2 LEU B 138 6991 6406 12930 -38 -932 -1642 C ATOM 2489 N ASN B 139 9.734 43.065 17.604 1.00 49.25 N ANISOU 2489 N ASN B 139 4774 4350 9589 62 -712 -1624 N ATOM 2490 CA ASN B 139 9.931 41.878 18.430 1.00 58.12 C ANISOU 2490 CA ASN B 139 6003 5589 10489 100 -682 -1675 C ATOM 2491 C ASN B 139 11.065 41.001 17.904 1.00 53.81 C ANISOU 2491 C ASN B 139 5470 5122 9853 35 -741 -1613 C ATOM 2492 O ASN B 139 11.728 40.309 18.687 1.00 53.90 O ANISOU 2492 O ASN B 139 5566 5205 9710 62 -758 -1688 O ATOM 2493 CB ASN B 139 8.642 41.072 18.561 1.00 61.96 C ANISOU 2493 CB ASN B 139 6510 6146 10886 137 -563 -1613 C ATOM 2494 CG ASN B 139 8.727 40.071 19.697 1.00 67.39 C ANISOU 2494 CG ASN B 139 7315 6934 11358 203 -516 -1695 C ATOM 2495 OD1 ASN B 139 8.900 40.450 20.863 1.00 71.98 O ANISOU 2495 OD1 ASN B 139 7973 7491 11885 279 -517 -1844 O ATOM 2496 ND2 ASN B 139 8.613 38.790 19.370 1.00 59.59 N ANISOU 2496 ND2 ASN B 139 6347 6053 10240 177 -476 -1601 N ATOM 2497 N GLU B 140 11.319 41.028 16.596 1.00 48.42 N ANISOU 2497 N GLU B 140 4710 4424 9264 -44 -770 -1474 N ATOM 2498 CA GLU B 140 12.436 40.271 16.076 1.00 41.75 C ANISOU 2498 CA GLU B 140 3879 3640 8346 -99 -817 -1411 C ATOM 2499 C GLU B 140 13.746 40.865 16.575 1.00 47.41 C ANISOU 2499 C GLU B 140 4598 4303 9113 -101 -915 -1514 C ATOM 2500 O GLU B 140 14.668 40.131 16.937 1.00 55.51 O ANISOU 2500 O GLU B 140 5676 5395 10021 -105 -948 -1540 O ATOM 2501 CB GLU B 140 12.383 40.222 14.552 1.00 43.76 C ANISOU 2501 CB GLU B 140 4061 3880 8686 -174 -818 -1238 C ATOM 2502 CG GLU B 140 11.951 38.843 13.997 1.00 54.25 C ANISOU 2502 CG GLU B 140 5431 5319 9861 -199 -760 -1122 C ATOM 2503 CD GLU B 140 13.032 37.739 14.160 1.00 77.98 C ANISOU 2503 CD GLU B 140 8506 8416 12706 -214 -774 -1120 C ATOM 2504 OE1 GLU B 140 13.978 37.662 13.330 1.00 79.20 O ANISOU 2504 OE1 GLU B 140 8639 8560 12892 -265 -813 -1039 O ATOM 2505 OE2 GLU B 140 12.929 36.944 15.128 1.00 85.67 O1- ANISOU 2505 OE2 GLU B 140 9556 9471 13522 -169 -738 -1193 O1- ATOM 2506 N GLN B 141 13.830 42.195 16.654 1.00 45.77 N ANISOU 2506 N GLN B 141 4332 3972 9086 -95 -966 -1577 N ATOM 2507 CA GLN B 141 15.014 42.811 17.241 1.00 45.99 C ANISOU 2507 CA GLN B 141 4362 3937 9175 -94 -1070 -1690 C ATOM 2508 C GLN B 141 15.139 42.465 18.719 1.00 45.05 C ANISOU 2508 C GLN B 141 4356 3864 8896 -23 -1084 -1854 C ATOM 2509 O GLN B 141 16.241 42.184 19.201 1.00 45.07 O ANISOU 2509 O GLN B 141 4395 3889 8842 -28 -1164 -1914 O ATOM 2510 CB GLN B 141 14.987 44.330 17.048 1.00 49.68 C ANISOU 2510 CB GLN B 141 4746 4253 9877 -101 -1119 -1728 C ATOM 2511 CG GLN B 141 15.398 44.761 15.653 1.00 61.42 C ANISOU 2511 CG GLN B 141 6119 5680 11536 -175 -1140 -1577 C ATOM 2512 CD GLN B 141 16.864 44.508 15.366 1.00 63.65 C ANISOU 2512 CD GLN B 141 6380 5965 11838 -222 -1219 -1543 C ATOM 2513 OE1 GLN B 141 17.729 44.859 16.174 1.00 71.65 O ANISOU 2513 OE1 GLN B 141 7409 6936 12879 -210 -1307 -1663 O ATOM 2514 NE2 GLN B 141 17.158 43.904 14.210 1.00 62.32 N ANISOU 2514 NE2 GLN B 141 6178 5840 11661 -274 -1188 -1376 N ATOM 2515 N VAL B 142 14.032 42.510 19.463 1.00 45.36 N ANISOU 2515 N VAL B 142 4454 3915 8867 49 -1008 -1926 N ATOM 2516 CA VAL B 142 14.108 42.221 20.895 1.00 47.80 C ANISOU 2516 CA VAL B 142 4884 4264 9014 130 -1013 -2084 C ATOM 2517 C VAL B 142 14.587 40.790 21.118 1.00 48.97 C ANISOU 2517 C VAL B 142 5102 4553 8953 128 -998 -2049 C ATOM 2518 O VAL B 142 15.425 40.529 21.995 1.00 47.55 O ANISOU 2518 O VAL B 142 4997 4402 8669 155 -1066 -2153 O ATOM 2519 CB VAL B 142 12.749 42.495 21.581 1.00 51.02 C ANISOU 2519 CB VAL B 142 5342 4655 9389 215 -909 -2146 C ATOM 2520 CG1 VAL B 142 12.563 41.632 22.821 1.00 47.05 C ANISOU 2520 CG1 VAL B 142 4975 4247 8654 302 -858 -2241 C ATOM 2521 CG2 VAL B 142 12.613 43.985 21.960 1.00 58.44 C ANISOU 2521 CG2 VAL B 142 6262 5446 10494 246 -952 -2261 C ATOM 2522 N LYS B 143 14.101 39.847 20.300 1.00 43.89 N ANISOU 2522 N LYS B 143 4434 3993 8250 92 -915 -1901 N ATOM 2523 CA LYS B 143 14.567 38.458 20.395 1.00 42.94 C ANISOU 2523 CA LYS B 143 4373 4001 7943 84 -894 -1854 C ATOM 2524 C LYS B 143 16.026 38.334 19.992 1.00 44.33 C ANISOU 2524 C LYS B 143 4517 4175 8150 23 -995 -1824 C ATOM 2525 O LYS B 143 16.779 37.577 20.614 1.00 46.86 O ANISOU 2525 O LYS B 143 4904 4570 8332 38 -1025 -1865 O ATOM 2526 CB LYS B 143 13.717 37.545 19.519 1.00 41.74 C ANISOU 2526 CB LYS B 143 4197 3921 7741 54 -793 -1700 C ATOM 2527 CG LYS B 143 12.282 37.365 20.023 1.00 46.26 C ANISOU 2527 CG LYS B 143 4803 4516 8258 120 -681 -1715 C ATOM 2528 N ALA B 144 16.435 39.052 18.938 1.00 42.55 N ANISOU 2528 N ALA B 144 4190 3866 8111 -45 -1043 -1742 N ATOM 2529 CA ALA B 144 17.822 39.001 18.492 1.00 51.61 C ANISOU 2529 CA ALA B 144 5295 4997 9316 -102 -1129 -1697 C ATOM 2530 C ALA B 144 18.759 39.498 19.583 1.00 48.31 C ANISOU 2530 C ALA B 144 4909 4537 8910 -73 -1243 -1851 C ATOM 2531 O ALA B 144 19.805 38.887 19.841 1.00 45.75 O ANISOU 2531 O ALA B 144 4607 4260 8516 -86 -1298 -1853 O ATOM 2532 CB ALA B 144 18.000 39.830 17.214 1.00 43.15 C ANISOU 2532 CB ALA B 144 4108 3828 8460 -167 -1149 -1584 C ATOM 2533 N ILE B 145 18.380 40.587 20.253 1.00 44.77 N ANISOU 2533 N ILE B 145 4468 3996 8548 -31 -1282 -1982 N ATOM 2534 CA ILE B 145 19.218 41.138 21.310 1.00 49.00 C ANISOU 2534 CA ILE B 145 5044 4477 9097 -3 -1407 -2142 C ATOM 2535 C ILE B 145 19.262 40.194 22.502 1.00 46.27 C ANISOU 2535 C ILE B 145 4831 4242 8509 65 -1398 -2237 C ATOM 2536 O ILE B 145 20.329 39.958 23.087 1.00 46.67 O ANISOU 2536 O ILE B 145 4913 4308 8511 64 -1501 -2298 O ATOM 2537 CB ILE B 145 18.725 42.541 21.717 1.00 47.44 C ANISOU 2537 CB ILE B 145 4834 4146 9044 30 -1444 -2262 C ATOM 2538 CG1 ILE B 145 18.835 43.511 20.546 1.00 47.41 C ANISOU 2538 CG1 ILE B 145 4692 4028 9295 -39 -1464 -2165 C ATOM 2539 CG2 ILE B 145 19.492 43.055 22.927 1.00 48.94 C ANISOU 2539 CG2 ILE B 145 5093 4282 9222 68 -1578 -2446 C ATOM 2540 CD1 ILE B 145 18.059 44.838 20.787 1.00 48.57 C ANISOU 2540 CD1 ILE B 145 4819 4047 9587 -5 -1463 -2256 C ATOM 2541 N LYS B 146 18.104 39.663 22.905 1.00 45.91 N ANISOU 2541 N LYS B 146 4861 4268 8314 127 -1278 -2248 N ATOM 2542 CA LYS B 146 18.091 38.657 23.966 1.00 59.32 C ANISOU 2542 CA LYS B 146 6685 6080 9773 196 -1248 -2316 C ATOM 2543 C LYS B 146 19.019 37.475 23.637 1.00 53.35 C ANISOU 2543 C LYS B 146 5924 5426 8920 150 -1263 -2219 C ATOM 2544 O LYS B 146 19.787 37.015 24.494 1.00 45.34 O ANISOU 2544 O LYS B 146 4981 4462 7784 180 -1330 -2295 O ATOM 2545 CB LYS B 146 16.647 38.190 24.198 1.00 57.55 C ANISOU 2545 CB LYS B 146 6516 5916 9434 260 -1093 -2298 C ATOM 2546 CG LYS B 146 16.457 37.163 25.310 1.00 48.69 C ANISOU 2546 CG LYS B 146 5526 4908 8066 344 -1036 -2360 C ATOM 2547 CD LYS B 146 16.926 37.716 26.639 1.00 47.81 C ANISOU 2547 CD LYS B 146 5520 4758 7887 419 -1131 -2550 C ATOM 2548 CE LYS B 146 16.678 36.739 27.761 1.00 47.51 C ANISOU 2548 CE LYS B 146 5622 4831 7599 514 -1066 -2609 C ATOM 2549 NZ LYS B 146 17.285 35.418 27.485 1.00 46.30 N ANISOU 2549 NZ LYS B 146 5465 4801 7326 476 -1051 -2505 N ATOM 2550 N GLU B 147 18.984 36.992 22.393 1.00 48.55 N ANISOU 2550 N GLU B 147 5236 4846 8365 80 -1204 -2051 N ATOM 2551 CA GLU B 147 19.769 35.817 22.025 1.00 42.59 C ANISOU 2551 CA GLU B 147 4483 4187 7512 42 -1196 -1948 C ATOM 2552 C GLU B 147 21.257 36.114 22.041 1.00 50.88 C ANISOU 2552 C GLU B 147 5488 5190 8654 1 -1331 -1964 C ATOM 2553 O GLU B 147 22.055 35.308 22.549 1.00 49.37 O ANISOU 2553 O GLU B 147 5343 5073 8343 10 -1366 -1974 O ATOM 2554 CB GLU B 147 19.351 35.319 20.645 1.00 44.84 C ANISOU 2554 CB GLU B 147 4703 4496 7836 -20 -1103 -1769 C ATOM 2555 CG GLU B 147 20.217 34.198 20.103 1.00 41.33 C ANISOU 2555 CG GLU B 147 4256 4132 7315 -64 -1090 -1653 C ATOM 2556 CD GLU B 147 19.712 33.677 18.774 1.00 49.48 C ANISOU 2556 CD GLU B 147 5250 5187 8364 -117 -998 -1486 C ATOM 2557 OE1 GLU B 147 18.735 32.898 18.748 1.00 60.97 O ANISOU 2557 OE1 GLU B 147 6752 6716 9696 -97 -899 -1450 O ATOM 2558 OE2 GLU B 147 20.281 34.065 17.738 1.00 61.29 O1- ANISOU 2558 OE2 GLU B 147 6668 6620 9999 -177 -1026 -1388 O1- ATOM 2559 N LEU B 148 21.653 37.256 21.470 1.00 43.64 N ANISOU 2559 N LEU B 148 4474 4148 7960 -47 -1408 -1956 N ATOM 2560 CA LEU B 148 23.060 37.634 21.503 1.00 50.83 C ANISOU 2560 CA LEU B 148 5327 4996 8990 -87 -1543 -1969 C ATOM 2561 C LEU B 148 23.538 37.823 22.939 1.00 50.27 C ANISOU 2561 C LEU B 148 5339 4922 8840 -31 -1659 -2147 C ATOM 2562 O LEU B 148 24.648 37.409 23.277 1.00 54.68 O ANISOU 2562 O LEU B 148 5898 5505 9373 -45 -1747 -2152 O ATOM 2563 CB LEU B 148 23.283 38.907 20.676 1.00 54.30 C ANISOU 2563 CB LEU B 148 5645 5291 9697 -140 -1596 -1933 C ATOM 2564 CG LEU B 148 23.155 38.616 19.179 1.00 43.55 C ANISOU 2564 CG LEU B 148 4202 3935 8409 -200 -1501 -1737 C ATOM 2565 CD1 LEU B 148 23.032 39.894 18.377 1.00 44.02 C ANISOU 2565 CD1 LEU B 148 4154 3857 8713 -238 -1524 -1700 C ATOM 2566 CD2 LEU B 148 24.323 37.775 18.700 1.00 42.94 C ANISOU 2566 CD2 LEU B 148 4096 3904 8316 -242 -1512 -1620 C ATOM 2567 N GLY B 149 22.721 38.458 23.791 1.00 51.52 N ANISOU 2567 N GLY B 149 5572 5046 8959 35 -1662 -2293 N ATOM 2568 CA GLY B 149 23.065 38.562 25.203 1.00 47.91 C ANISOU 2568 CA GLY B 149 5222 4592 8388 101 -1764 -2469 C ATOM 2569 C GLY B 149 23.284 37.207 25.854 1.00 55.64 C ANISOU 2569 C GLY B 149 6300 5719 9123 142 -1729 -2463 C ATOM 2570 O GLY B 149 24.259 37.005 26.577 1.00 48.16 O ANISOU 2570 O GLY B 149 5390 4786 8124 152 -1849 -2530 O ATOM 2571 N ASP B 150 22.359 36.275 25.632 1.00 47.39 N ANISOU 2571 N ASP B 150 5295 4779 7930 169 -1569 -2383 N ATOM 2572 CA ASP B 150 22.521 34.922 26.139 1.00 47.72 C ANISOU 2572 CA ASP B 150 5421 4962 7749 206 -1517 -2357 C ATOM 2573 C ASP B 150 23.849 34.332 25.685 1.00 45.15 C ANISOU 2573 C ASP B 150 5031 4665 7460 140 -1587 -2260 C ATOM 2574 O ASP B 150 24.565 33.704 26.472 1.00 45.53 O ANISOU 2574 O ASP B 150 5141 4779 7382 169 -1648 -2303 O ATOM 2575 CB ASP B 150 21.359 34.046 25.648 1.00 44.31 C ANISOU 2575 CB ASP B 150 5006 4620 7210 220 -1332 -2250 C ATOM 2576 CG ASP B 150 20.001 34.450 26.235 1.00 49.37 C ANISOU 2576 CG ASP B 150 5717 5246 7794 300 -1244 -2336 C ATOM 2577 OD1 ASP B 150 19.909 35.304 27.133 1.00 57.68 O ANISOU 2577 OD1 ASP B 150 6831 6233 8853 358 -1311 -2488 O ATOM 2578 OD2 ASP B 150 18.985 33.922 25.758 1.00 62.90 O1- ANISOU 2578 OD2 ASP B 150 7423 7008 9466 304 -1104 -2246 O1- ATOM 2579 N HIS B 151 24.179 34.512 24.404 1.00 44.36 N ANISOU 2579 N HIS B 151 4808 4515 7531 55 -1572 -2121 N ATOM 2580 CA HIS B 151 25.400 33.940 23.855 1.00 43.87 C ANISOU 2580 CA HIS B 151 4678 4473 7516 -5 -1614 -2007 C ATOM 2581 C HIS B 151 26.629 34.557 24.500 1.00 57.47 C ANISOU 2581 C HIS B 151 6374 6123 9339 -15 -1798 -2097 C ATOM 2582 O HIS B 151 27.561 33.843 24.885 1.00 46.60 O ANISOU 2582 O HIS B 151 5010 4803 7892 -16 -1853 -2079 O ATOM 2583 CB HIS B 151 25.447 34.155 22.350 1.00 44.16 C ANISOU 2583 CB HIS B 151 4598 4455 7724 -83 -1556 -1845 C ATOM 2584 CG HIS B 151 24.481 33.313 21.590 1.00 46.34 C ANISOU 2584 CG HIS B 151 4897 4812 7897 -87 -1391 -1729 C ATOM 2585 ND1 HIS B 151 23.816 32.249 22.162 1.00 40.96 N ANISOU 2585 ND1 HIS B 151 4318 4252 6992 -34 -1298 -1744 N ATOM 2586 CD2 HIS B 151 24.069 33.375 20.303 1.00 40.61 C ANISOU 2586 CD2 HIS B 151 4108 4059 7263 -137 -1309 -1594 C ATOM 2587 CE1 HIS B 151 23.026 31.698 21.257 1.00 43.16 C ANISOU 2587 CE1 HIS B 151 4589 4570 7238 -56 -1172 -1627 C ATOM 2588 NE2 HIS B 151 23.166 32.360 20.120 1.00 39.56 N ANISOU 2588 NE2 HIS B 151 4040 4028 6965 -118 -1180 -1536 N ATOM 2589 N VAL B 152 26.661 35.894 24.573 1.00 46.39 N ANISOU 2589 N VAL B 152 4924 4586 8115 -27 -1899 -2186 N ATOM 2590 CA VAL B 152 27.748 36.599 25.237 1.00 47.93 C ANISOU 2590 CA VAL B 152 5095 4694 8423 -38 -2092 -2289 C ATOM 2591 C VAL B 152 27.903 36.099 26.664 1.00 53.45 C ANISOU 2591 C VAL B 152 5932 5469 8908 38 -2164 -2429 C ATOM 2592 O VAL B 152 29.018 35.813 27.122 1.00 54.52 O ANISOU 2592 O VAL B 152 6059 5614 9042 26 -2289 -2442 O ATOM 2593 CB VAL B 152 27.510 38.126 25.213 1.00 49.09 C ANISOU 2593 CB VAL B 152 5194 4685 8773 -49 -2176 -2387 C ATOM 2594 CG1 VAL B 152 28.583 38.832 26.025 1.00 52.50 C ANISOU 2594 CG1 VAL B 152 5615 5022 9308 -56 -2391 -2512 C ATOM 2595 CG2 VAL B 152 27.516 38.666 23.804 1.00 48.39 C ANISOU 2595 CG2 VAL B 152 4961 4513 8911 -124 -2120 -2240 C ATOM 2596 N THR B 153 26.791 36.023 27.399 1.00 48.96 N ANISOU 2596 N THR B 153 5491 4950 8162 119 -2089 -2534 N ATOM 2597 CA THR B 153 26.820 35.533 28.772 1.00 49.84 C ANISOU 2597 CA THR B 153 5752 5139 8047 206 -2138 -2666 C ATOM 2598 C THR B 153 27.447 34.144 28.851 1.00 52.76 C ANISOU 2598 C THR B 153 6138 5641 8266 205 -2105 -2568 C ATOM 2599 O THR B 153 28.267 33.884 29.733 1.00 55.31 O ANISOU 2599 O THR B 153 6517 5991 8509 231 -2231 -2640 O ATOM 2600 CB THR B 153 25.400 35.506 29.343 1.00 49.86 C ANISOU 2600 CB THR B 153 5879 5183 7882 297 -2008 -2749 C ATOM 2601 OG1 THR B 153 24.872 36.832 29.377 1.00 50.83 O ANISOU 2601 OG1 THR B 153 5992 5176 8144 305 -2045 -2850 O ATOM 2602 CG2 THR B 153 25.380 34.919 30.754 1.00 50.77 C ANISOU 2602 CG2 THR B 153 6161 5386 7742 399 -2035 -2873 C ATOM 2603 N ASN B 154 27.083 33.241 27.934 1.00 47.29 N ANISOU 2603 N ASN B 154 5403 5030 7537 175 -1943 -2405 N ATOM 2604 CA ASN B 154 27.648 31.896 27.985 1.00 46.50 C ANISOU 2604 CA ASN B 154 5320 5052 7294 176 -1899 -2309 C ATOM 2605 C ASN B 154 29.134 31.891 27.631 1.00 46.77 C ANISOU 2605 C ASN B 154 5248 5044 7478 106 -2026 -2235 C ATOM 2606 O ASN B 154 29.940 31.272 28.331 1.00 47.26 O ANISOU 2606 O ASN B 154 5348 5165 7444 127 -2104 -2252 O ATOM 2607 CB ASN B 154 26.874 30.954 27.069 1.00 48.36 C ANISOU 2607 CB ASN B 154 5542 5373 7460 160 -1698 -2157 C ATOM 2608 CG ASN B 154 25.601 30.450 27.712 1.00 52.20 C ANISOU 2608 CG ASN B 154 6151 5945 7739 246 -1570 -2214 C ATOM 2609 OD1 ASN B 154 25.634 29.556 28.555 1.00 50.69 O ANISOU 2609 OD1 ASN B 154 6056 5857 7346 309 -1543 -2243 O ATOM 2610 ND2 ASN B 154 24.473 31.041 27.338 1.00 44.24 N ANISOU 2610 ND2 ASN B 154 5135 4889 6784 252 -1487 -2227 N ATOM 2611 N LEU B 155 29.514 32.549 26.534 1.00 46.50 N ANISOU 2611 N LEU B 155 5077 4908 7683 25 -2043 -2141 N ATOM 2612 CA LEU B 155 30.931 32.667 26.219 1.00 55.73 C ANISOU 2612 CA LEU B 155 6133 6017 9023 -38 -2164 -2069 C ATOM 2613 C LEU B 155 31.713 33.175 27.422 1.00 55.99 C ANISOU 2613 C LEU B 155 6202 6004 9066 -13 -2376 -2223 C ATOM 2614 O LEU B 155 32.768 32.630 27.766 1.00 61.87 O ANISOU 2614 O LEU B 155 6927 6781 9800 -22 -2464 -2190 O ATOM 2615 CB LEU B 155 31.154 33.596 25.029 1.00 52.71 C ANISOU 2615 CB LEU B 155 5606 5504 8916 -115 -2168 -1978 C ATOM 2616 CG LEU B 155 31.126 32.952 23.649 1.00 53.68 C ANISOU 2616 CG LEU B 155 5656 5658 9081 -164 -2008 -1773 C ATOM 2617 CD1 LEU B 155 32.083 31.748 23.512 1.00 44.68 C ANISOU 2617 CD1 LEU B 155 4500 4602 7874 -178 -1980 -1647 C ATOM 2618 CD2 LEU B 155 29.758 32.552 23.344 1.00 57.44 C ANISOU 2618 CD2 LEU B 155 6209 6207 9410 -134 -1844 -1759 C ATOM 2619 N ARG B 156 31.182 34.188 28.105 1.00 56.53 N ANISOU 2619 N ARG B 156 6332 5998 9147 24 -2459 -2393 N ATOM 2620 CA ARG B 156 31.893 34.775 29.233 1.00 60.20 C ANISOU 2620 CA ARG B 156 6842 6403 9628 48 -2677 -2553 C ATOM 2621 C ARG B 156 31.975 33.801 30.398 1.00 57.11 C ANISOU 2621 C ARG B 156 6595 6141 8962 127 -2698 -2623 C ATOM 2622 O ARG B 156 33.059 33.584 30.953 1.00 58.68 O ANISOU 2622 O ARG B 156 6785 6342 9169 119 -2853 -2641 O ATOM 2623 CB ARG B 156 31.221 36.078 29.667 1.00 55.08 C ANISOU 2623 CB ARG B 156 6242 5641 9043 76 -2746 -2722 C ATOM 2624 CG ARG B 156 31.859 37.334 29.088 1.00 68.34 C ANISOU 2624 CG ARG B 156 7778 7147 11042 -3 -2876 -2721 C ATOM 2625 CD ARG B 156 31.029 38.600 29.391 1.00 71.14 C ANISOU 2625 CD ARG B 156 8181 7390 11461 26 -2908 -2876 C ATOM 2626 NE ARG B 156 31.144 39.573 28.308 1.00 72.94 N ANISOU 2626 NE ARG B 156 8250 7482 11982 -52 -2908 -2798 N ATOM 2627 CZ ARG B 156 30.503 40.739 28.261 1.00 75.32 C ANISOU 2627 CZ ARG B 156 8554 7686 12379 -36 -2892 -2860 C ATOM 2628 NH1 ARG B 156 29.680 41.093 29.238 1.00 78.38 N ANISOU 2628 NH1 ARG B 156 9092 8076 12612 46 -2897 -3031 N ATOM 2629 NH2 ARG B 156 30.677 41.550 27.224 1.00 73.01 N ANISOU 2629 NH2 ARG B 156 8115 7293 12333 -96 -2861 -2744 N ATOM 2630 N CYS B 157 30.839 33.218 30.796 1.00 51.63 N ANISOU 2630 N CYS B 157 6033 5553 8033 205 -2546 -2660 N ATOM 2631 CA CYS B 157 30.840 32.274 31.912 1.00 63.17 C ANISOU 2631 CA CYS B 157 7638 7140 9223 290 -2548 -2721 C ATOM 2632 C CYS B 157 31.763 31.091 31.658 1.00 53.08 C ANISOU 2632 C CYS B 157 6304 5955 7907 258 -2533 -2574 C ATOM 2633 O CYS B 157 32.411 30.604 32.589 1.00 58.69 O ANISOU 2633 O CYS B 157 7085 6723 8492 300 -2639 -2626 O ATOM 2634 CB CYS B 157 29.422 31.779 32.203 1.00 70.41 C ANISOU 2634 CB CYS B 157 8682 8151 9920 376 -2353 -2748 C ATOM 2635 SG CYS B 157 28.417 32.942 33.143 1.00 93.03 S ANISOU 2635 SG CYS B 157 11684 10936 12728 464 -2389 -2967 S ATOM 2636 N MET B 158 31.849 30.632 30.409 1.00 59.78 N ATOM 2637 CA MET B 158 32.727 29.531 30.031 1.00 59.61 C ATOM 2638 C MET B 158 34.206 29.897 30.041 1.00 67.02 C ATOM 2639 O MET B 158 35.046 29.003 29.895 1.00 62.82 O ATOM 2640 CB MET B 158 32.356 29.038 28.645 1.00 52.79 C ATOM 2641 CG MET B 158 31.012 28.380 28.602 1.00 55.72 C ATOM 2642 SD MET B 158 30.445 28.098 26.923 1.00 54.11 S ATOM 2643 CE MET B 158 31.403 26.620 26.531 1.00 50.08 C