>>6WYG:HELIX   19 AC1 ASP D  126  MET D  158  1                                  33    
DPHLADFIETHYLNEQVKAIKELGDHVTNLRCM
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 19 AC1 ASP D 126 MET D 158 1 33 ATOM 5101 N ASP D 126 -7.494 5.089 58.205 1.00 84.67 N ANISOU 5101 N ASP D 126 13773 13099 5299 535 839 -848 N ATOM 5102 CA ASP D 126 -7.971 5.548 56.902 1.00 78.03 C ANISOU 5102 CA ASP D 126 12873 12146 4628 481 868 -908 C ATOM 5103 C ASP D 126 -7.050 4.970 55.831 1.00 76.12 C ANISOU 5103 C ASP D 126 12622 11814 4487 456 792 -847 C ATOM 5104 O ASP D 126 -6.169 5.667 55.305 1.00 79.09 O ANISOU 5104 O ASP D 126 12974 12152 4925 441 658 -948 O ATOM 5105 CB ASP D 126 -8.030 7.075 56.846 1.00 77.14 C ANISOU 5105 CB ASP D 126 12724 12030 4554 465 802 -1107 C ATOM 5106 CG ASP D 126 -8.590 7.598 55.528 1.00 85.34 C ANISOU 5106 CG ASP D 126 13697 12958 5768 411 839 -1167 C ATOM 5107 OD1 ASP D 126 -9.117 6.793 54.720 1.00 79.31 O ANISOU 5107 OD1 ASP D 126 12918 12124 5090 382 934 -1058 O ATOM 5108 OD2 ASP D 126 -8.523 8.829 55.317 1.00 88.84 O1- ANISOU 5108 OD2 ASP D 126 14105 13382 6269 396 776 -1324 O1- ATOM 5109 N PRO D 127 -7.256 3.709 55.450 1.00 73.82 N ANISOU 5109 N PRO D 127 12346 11479 4224 448 880 -683 N ATOM 5110 CA PRO D 127 -6.256 3.023 54.619 1.00 69.12 C ANISOU 5110 CA PRO D 127 11756 10809 3698 432 805 -611 C ATOM 5111 C PRO D 127 -6.258 3.472 53.168 1.00 71.47 C ANISOU 5111 C PRO D 127 12004 10984 4168 367 782 -679 C ATOM 5112 O PRO D 127 -5.229 3.340 52.489 1.00 74.53 O ANISOU 5112 O PRO D 127 12388 11316 4612 352 673 -676 O ATOM 5113 CB PRO D 127 -6.667 1.554 54.746 1.00 68.92 C ANISOU 5113 CB PRO D 127 11763 10773 3652 440 932 -417 C ATOM 5114 CG PRO D 127 -8.158 1.625 54.861 1.00 70.17 C ANISOU 5114 CG PRO D 127 11898 10932 3830 422 1093 -411 C ATOM 5115 CD PRO D 127 -8.489 2.919 55.588 1.00 74.18 C ANISOU 5115 CD PRO D 127 12394 11520 4270 442 1059 -567 C ATOM 5116 N HIS D 128 -7.382 3.987 52.666 1.00 64.54 N ANISOU 5116 N HIS D 128 11084 10064 3376 326 882 -736 N ATOM 5117 CA HIS D 128 -7.404 4.490 51.301 1.00 60.68 C ANISOU 5117 CA HIS D 128 10542 9463 3049 258 860 -806 C ATOM 5118 C HIS D 128 -6.537 5.734 51.160 1.00 67.03 C ANISOU 5118 C HIS D 128 11320 10270 3879 263 698 -964 C ATOM 5119 O HIS D 128 -5.787 5.866 50.187 1.00 67.55 O ANISOU 5119 O HIS D 128 11337 10259 4071 222 603 -986 O ATOM 5120 CB HIS D 128 -8.837 4.788 50.864 1.00 60.83 C ANISOU 5120 CB HIS D 128 10513 9445 3153 213 1006 -828 C ATOM 5121 CG HIS D 128 -8.920 5.657 49.646 1.00 64.92 C ANISOU 5121 CG HIS D 128 10950 9874 3842 145 971 -932 C ATOM 5122 ND1 HIS D 128 -8.944 7.035 49.713 1.00 58.69 N ANISOU 5122 ND1 HIS D 128 10137 9101 3063 153 910 -1092 N ATOM 5123 CD2 HIS D 128 -8.961 5.343 48.329 1.00 60.31 C ANISOU 5123 CD2 HIS D 128 10270 9189 3454 68 980 -895 C ATOM 5124 CE1 HIS D 128 -9.005 7.531 48.490 1.00 55.50 C ANISOU 5124 CE1 HIS D 128 9626 8608 2856 84 885 -1139 C ATOM 5125 NE2 HIS D 128 -9.017 6.526 47.632 1.00 59.31 N ANISOU 5125 NE2 HIS D 128 10064 9024 3449 33 926 -1023 N ATOM 5126 N LEU D 129 -6.625 6.658 52.117 1.00 73.59 N ANISOU 5126 N LEU D 129 12150 11186 4623 304 660 -1073 N ATOM 5127 CA LEU D 129 -5.806 7.864 52.046 1.00 72.85 C ANISOU 5127 CA LEU D 129 12027 11092 4562 307 508 -1228 C ATOM 5128 C LEU D 129 -4.329 7.524 52.170 1.00 75.93 C ANISOU 5128 C LEU D 129 12439 11495 4916 330 354 -1200 C ATOM 5129 O LEU D 129 -3.481 8.119 51.488 1.00 73.24 O ANISOU 5129 O LEU D 129 12061 11100 4669 309 226 -1278 O ATOM 5130 CB LEU D 129 -6.225 8.844 53.140 1.00 69.43 C ANISOU 5130 CB LEU D 129 11595 10747 4038 339 511 -1347 C ATOM 5131 CG LEU D 129 -5.402 10.128 53.211 1.00 65.50 C ANISOU 5131 CG LEU D 129 11066 10247 3572 339 360 -1514 C ATOM 5132 CD1 LEU D 129 -5.713 10.992 52.019 1.00 65.95 C ANISOU 5132 CD1 LEU D 129 11054 10203 3800 291 357 -1608 C ATOM 5133 CD2 LEU D 129 -5.711 10.868 54.483 1.00 63.85 C ANISOU 5133 CD2 LEU D 129 10882 10132 3247 369 367 -1610 C ATOM 5134 N ALA D 130 -4.008 6.545 53.021 1.00 73.12 N ANISOU 5134 N ALA D 130 12140 11211 4432 372 365 -1082 N ATOM 5135 CA ALA D 130 -2.620 6.137 53.205 1.00 70.82 C ANISOU 5135 CA ALA D 130 11869 10939 4101 398 226 -1040 C ATOM 5136 C ALA D 130 -2.062 5.504 51.938 1.00 70.05 C ANISOU 5136 C ALA D 130 11757 10733 4126 361 193 -966 C ATOM 5137 O ALA D 130 -0.964 5.850 51.492 1.00 78.42 O ANISOU 5137 O ALA D 130 12791 11761 5244 354 47 -1013 O ATOM 5138 CB ALA D 130 -2.512 5.173 54.386 1.00 70.03 C ANISOU 5138 CB ALA D 130 11832 10939 3839 451 265 -915 C ATOM 5139 N ASP D 131 -2.803 4.568 51.341 1.00 65.66 N ANISOU 5139 N ASP D 131 11215 10117 3615 331 328 -849 N ATOM 5140 CA ASP D 131 -2.313 3.950 50.117 1.00 65.72 C ANISOU 5140 CA ASP D 131 11149 10015 3807 270 301 -774 C ATOM 5141 C ASP D 131 -2.278 4.941 48.962 1.00 66.67 C ANISOU 5141 C ASP D 131 11162 10049 4118 206 242 -890 C ATOM 5142 O ASP D 131 -1.416 4.835 48.083 1.00 60.51 O ANISOU 5142 O ASP D 131 10320 9201 3469 172 148 -876 O ATOM 5143 CB ASP D 131 -3.172 2.744 49.746 1.00 69.86 C ANISOU 5143 CB ASP D 131 11668 10490 4384 237 462 -628 C ATOM 5144 CG ASP D 131 -2.826 2.190 48.376 1.00 75.42 C ANISOU 5144 CG ASP D 131 12285 11078 5294 166 447 -570 C ATOM 5145 OD1 ASP D 131 -1.738 1.572 48.248 1.00 79.74 O ANISOU 5145 OD1 ASP D 131 12837 11609 5852 178 359 -501 O ATOM 5146 OD2 ASP D 131 -3.633 2.392 47.430 1.00 68.98 O1- ANISOU 5146 OD2 ASP D 131 11393 10191 4626 100 522 -598 O1- ATOM 5147 N PHE D 132 -3.216 5.890 48.935 1.00 69.50 N ANISOU 5147 N PHE D 132 11497 10412 4501 190 301 -997 N ATOM 5148 CA PHE D 132 -3.190 6.954 47.940 1.00 67.03 C ANISOU 5148 CA PHE D 132 11082 10027 4361 138 244 -1112 C ATOM 5149 C PHE D 132 -1.909 7.774 48.055 1.00 62.40 C ANISOU 5149 C PHE D 132 10483 9451 3774 162 58 -1212 C ATOM 5150 O PHE D 132 -1.213 8.010 47.057 1.00 56.83 O ANISOU 5150 O PHE D 132 9695 8673 3227 122 -32 -1227 O ATOM 5151 CB PHE D 132 -4.431 7.833 48.121 1.00 67.17 C ANISOU 5151 CB PHE D 132 11088 10060 4374 130 344 -1207 C ATOM 5152 CG PHE D 132 -4.513 8.970 47.160 1.00 66.32 C ANISOU 5152 CG PHE D 132 10874 9884 4442 81 300 -1321 C ATOM 5153 CD1 PHE D 132 -5.123 8.798 45.921 1.00 69.28 C ANISOU 5153 CD1 PHE D 132 11153 10175 4995 9 374 -1282 C ATOM 5154 CD2 PHE D 132 -3.987 10.213 47.489 1.00 67.55 C ANISOU 5154 CD2 PHE D 132 11021 10060 4586 106 185 -1468 C ATOM 5155 CE1 PHE D 132 -5.207 9.841 45.020 1.00 65.75 C ANISOU 5155 CE1 PHE D 132 10601 9670 4710 -32 337 -1376 C ATOM 5156 CE2 PHE D 132 -4.061 11.268 46.596 1.00 72.82 C ANISOU 5156 CE2 PHE D 132 11584 10660 5426 63 149 -1565 C ATOM 5157 CZ PHE D 132 -4.673 11.081 45.355 1.00 67.36 C ANISOU 5157 CZ PHE D 132 10796 9889 4909 -5 226 -1514 C ATOM 5158 N ILE D 133 -1.587 8.222 49.271 1.00 63.53 N ANISOU 5158 N ILE D 133 10707 9691 3742 229 -1 -1281 N ATOM 5159 CA ILE D 133 -0.330 8.928 49.498 1.00 65.38 C ANISOU 5159 CA ILE D 133 10936 9944 3961 256 -181 -1374 C ATOM 5160 C ILE D 133 0.850 8.084 49.030 1.00 72.41 C ANISOU 5160 C ILE D 133 11811 10799 4901 249 -276 -1268 C ATOM 5161 O ILE D 133 1.710 8.563 48.283 1.00 73.87 O ANISOU 5161 O ILE D 133 11922 10924 5219 222 -396 -1313 O ATOM 5162 CB ILE D 133 -0.183 9.312 50.975 1.00 69.92 C ANISOU 5162 CB ILE D 133 11566 10637 4362 315 -214 -1434 C ATOM 5163 CG1 ILE D 133 -1.123 10.464 51.312 1.00 73.72 C ANISOU 5163 CG1 ILE D 133 12024 11135 4852 307 -156 -1571 C ATOM 5164 CG2 ILE D 133 1.244 9.720 51.249 1.00 70.78 C ANISOU 5164 CG2 ILE D 133 11654 10765 4473 330 -396 -1486 C ATOM 5165 CD1 ILE D 133 -0.708 11.762 50.676 1.00 71.91 C ANISOU 5165 CD1 ILE D 133 11718 10841 4763 279 -262 -1721 C ATOM 5166 N GLU D 134 0.901 6.815 49.453 1.00 67.83 N ANISOU 5166 N GLU D 134 11297 10254 4221 275 -219 -1122 N ATOM 5167 CA GLU D 134 1.941 5.884 49.011 1.00 69.39 C ANISOU 5167 CA GLU D 134 11483 10415 4468 270 -290 -1005 C ATOM 5168 C GLU D 134 2.080 5.910 47.497 1.00 68.87 C ANISOU 5168 C GLU D 134 11304 10228 4636 196 -303 -995 C ATOM 5169 O GLU D 134 3.004 6.531 46.955 1.00 80.43 O ANISOU 5169 O GLU D 134 12707 11653 6199 182 -438 -1058 O ATOM 5170 CB GLU D 134 1.620 4.450 49.441 1.00 71.52 C ANISOU 5170 CB GLU D 134 11820 10712 4644 292 -177 -836 C ATOM 5171 CG GLU D 134 1.583 4.197 50.933 1.00 71.87 C ANISOU 5171 CG GLU D 134 11976 10884 4447 374 -160 -810 C ATOM 5172 CD GLU D 134 0.827 2.926 51.279 1.00 72.37 C ANISOU 5172 CD GLU D 134 12092 10963 4441 386 -2 -651 C ATOM 5173 OE1 GLU D 134 0.419 2.199 50.344 1.00 71.22 O ANISOU 5173 OE1 GLU D 134 11896 10723 4442 330 85 -563 O ATOM 5174 OE2 GLU D 134 0.639 2.657 52.485 1.00 75.50 O1- ANISOU 5174 OE2 GLU D 134 12548 11465 4674 443 36 -611 O1- ATOM 5175 N THR D 135 1.117 5.261 46.847 1.00 60.86 N ANISOU 5175 N THR D 135 10260 9158 3705 149 -160 -918 N ATOM 5176 CA THR D 135 0.910 5.147 45.411 1.00 62.46 C ANISOU 5176 CA THR D 135 10358 9256 4117 76 -130 -897 C ATOM 5177 C THR D 135 1.290 6.368 44.585 1.00 64.10 C ANISOU 5177 C THR D 135 10468 9414 4472 43 -231 -1020 C ATOM 5178 O THR D 135 2.023 6.241 43.595 1.00 65.37 O ANISOU 5178 O THR D 135 10555 9510 4774 10 -304 -994 O ATOM 5179 CB THR D 135 -0.569 4.824 45.175 1.00 64.34 C ANISOU 5179 CB THR D 135 10587 9476 4384 39 50 -864 C ATOM 5180 OG1 THR D 135 -0.989 3.814 46.106 1.00 70.57 O ANISOU 5180 OG1 THR D 135 11471 10318 5023 78 149 -758 O ATOM 5181 CG2 THR D 135 -0.814 4.347 43.757 1.00 53.73 C ANISOU 5181 CG2 THR D 135 9146 8035 3235 -34 100 -811 C ATOM 5182 N HIS D 136 0.779 7.545 44.950 1.00 67.92 N ANISOU 5182 N HIS D 136 10947 9927 4933 51 -232 -1149 N ATOM 5183 CA HIS D 136 0.869 8.708 44.080 1.00 64.17 C ANISOU 5183 CA HIS D 136 10367 9396 4620 13 -294 -1258 C ATOM 5184 C HIS D 136 1.864 9.763 44.543 1.00 69.21 C ANISOU 5184 C HIS D 136 11004 10058 5233 49 -455 -1376 C ATOM 5185 O HIS D 136 2.055 10.754 43.829 1.00 70.18 O ANISOU 5185 O HIS D 136 11035 10129 5500 20 -517 -1463 O ATOM 5186 CB HIS D 136 -0.517 9.337 43.922 1.00 65.41 C ANISOU 5186 CB HIS D 136 10493 9546 4815 -15 -167 -1320 C ATOM 5187 CG HIS D 136 -1.509 8.440 43.243 1.00 70.05 C ANISOU 5187 CG HIS D 136 11054 10096 5467 -62 -17 -1218 C ATOM 5188 ND1 HIS D 136 -2.712 8.089 43.818 1.00 69.25 N ANISOU 5188 ND1 HIS D 136 11008 10032 5273 -56 132 -1190 N ATOM 5189 CD2 HIS D 136 -1.477 7.826 42.035 1.00 66.58 C ANISOU 5189 CD2 HIS D 136 10536 9586 5176 -117 8 -1142 C ATOM 5190 CE1 HIS D 136 -3.375 7.292 42.998 1.00 69.77 C ANISOU 5190 CE1 HIS D 136 11029 10049 5431 -107 240 -1100 C ATOM 5191 NE2 HIS D 136 -2.648 7.116 41.909 1.00 67.54 N ANISOU 5191 NE2 HIS D 136 10665 9702 5293 -145 166 -1073 N ATOM 5192 N TYR D 137 2.522 9.584 45.696 1.00 68.64 N ANISOU 5192 N TYR D 137 11027 10065 4989 110 -527 -1380 N ATOM 5193 CA TYR D 137 3.425 10.620 46.174 1.00 68.17 C ANISOU 5193 CA TYR D 137 10965 10032 4904 142 -680 -1504 C ATOM 5194 C TYR D 137 4.720 10.058 46.739 1.00 74.78 C ANISOU 5194 C TYR D 137 11857 10915 5643 186 -806 -1452 C ATOM 5195 O TYR D 137 5.773 10.660 46.532 1.00 79.16 O ANISOU 5195 O TYR D 137 12366 11448 6263 189 -953 -1512 O ATOM 5196 CB TYR D 137 2.721 11.489 47.227 1.00 68.35 C ANISOU 5196 CB TYR D 137 11044 10126 4800 178 -645 -1630 C ATOM 5197 CG TYR D 137 1.646 12.324 46.598 1.00 71.05 C ANISOU 5197 CG TYR D 137 11314 10415 5269 134 -554 -1706 C ATOM 5198 CD1 TYR D 137 0.376 11.801 46.397 1.00 71.13 C ANISOU 5198 CD1 TYR D 137 11332 10418 5278 110 -384 -1639 C ATOM 5199 CD2 TYR D 137 1.905 13.619 46.160 1.00 72.84 C ANISOU 5199 CD2 TYR D 137 11456 10593 5628 116 -636 -1836 C ATOM 5200 CE1 TYR D 137 -0.611 12.537 45.783 1.00 77.07 C ANISOU 5200 CE1 TYR D 137 12012 11124 6150 70 -299 -1700 C ATOM 5201 CE2 TYR D 137 0.914 14.377 45.549 1.00 75.48 C ANISOU 5201 CE2 TYR D 137 11717 10877 6085 77 -548 -1896 C ATOM 5202 CZ TYR D 137 -0.341 13.826 45.362 1.00 75.67 C ANISOU 5202 CZ TYR D 137 11752 10901 6099 55 -381 -1826 C ATOM 5203 OH TYR D 137 -1.340 14.550 44.759 1.00 74.72 O ANISOU 5203 OH TYR D 137 11557 10736 6099 17 -291 -1878 O ATOM 5204 N LEU D 138 4.681 8.929 47.453 1.00 75.24 N ANISOU 5204 N LEU D 138 12006 11034 5548 222 -752 -1337 N ATOM 5205 CA LEU D 138 5.852 8.543 48.242 1.00 75.40 C ANISOU 5205 CA LEU D 138 12089 11121 5440 277 -873 -1304 C ATOM 5206 C LEU D 138 7.024 8.160 47.341 1.00 67.75 C ANISOU 5206 C LEU D 138 11055 10082 4606 254 -980 -1235 C ATOM 5207 O LEU D 138 8.127 8.713 47.458 1.00 69.68 O ANISOU 5207 O LEU D 138 11280 10335 4862 271 -1136 -1296 O ATOM 5208 CB LEU D 138 5.493 7.399 49.197 1.00 75.60 C ANISOU 5208 CB LEU D 138 12221 11229 5275 324 -779 -1183 C ATOM 5209 N ASN D 139 6.801 7.225 46.418 1.00 61.09 N ANISOU 5209 N ASN D 139 10174 9167 3871 213 -899 -1112 N ATOM 5210 CA ASN D 139 7.889 6.824 45.536 1.00 62.66 C ANISOU 5210 CA ASN D 139 10311 9299 4198 192 -993 -1044 C ATOM 5211 C ASN D 139 8.222 7.919 44.530 1.00 61.47 C ANISOU 5211 C ASN D 139 10046 9074 4236 150 -1078 -1146 C ATOM 5212 O ASN D 139 9.385 8.056 44.132 1.00 60.31 O ANISOU 5212 O ASN D 139 9853 8897 4164 151 -1210 -1142 O ATOM 5213 CB ASN D 139 7.544 5.509 44.835 1.00 59.27 C ANISOU 5213 CB ASN D 139 9873 8815 3833 162 -880 -892 C ATOM 5214 CG ASN D 139 8.762 4.835 44.226 1.00 60.97 C ANISOU 5214 CG ASN D 139 10053 8983 4128 159 -974 -800 C ATOM 5215 OD1 ASN D 139 9.729 4.483 44.925 1.00 64.66 O ANISOU 5215 OD1 ASN D 139 10575 9502 4493 208 -1066 -757 O ATOM 5216 ND2 ASN D 139 8.720 4.640 42.915 1.00 48.95 N ANISOU 5216 ND2 ASN D 139 8441 7369 2790 104 -948 -768 N ATOM 5217 N GLU D 140 7.232 8.724 44.135 1.00 58.73 N ANISOU 5217 N GLU D 140 9649 8697 3967 115 -1004 -1233 N ATOM 5218 CA GLU D 140 7.511 9.873 43.272 1.00 63.08 C ANISOU 5218 CA GLU D 140 10090 9184 4693 80 -1082 -1333 C ATOM 5219 C GLU D 140 8.482 10.843 43.941 1.00 64.49 C ANISOU 5219 C GLU D 140 10276 9398 4831 118 -1243 -1447 C ATOM 5220 O GLU D 140 9.464 11.274 43.326 1.00 67.70 O ANISOU 5220 O GLU D 140 10607 9756 5360 106 -1366 -1467 O ATOM 5221 CB GLU D 140 6.209 10.585 42.891 1.00 62.14 C ANISOU 5221 CB GLU D 140 9924 9039 4645 44 -966 -1406 C ATOM 5222 N GLN D 141 8.235 11.189 45.208 1.00 66.38 N ANISOU 5222 N GLN D 141 10602 9723 4894 163 -1246 -1523 N ATOM 5223 CA GLN D 141 9.146 12.090 45.907 1.00 67.84 C ANISOU 5223 CA GLN D 141 10789 9947 5040 196 -1396 -1636 C ATOM 5224 C GLN D 141 10.490 11.429 46.158 1.00 64.96 C ANISOU 5224 C GLN D 141 10431 9605 4646 217 -1508 -1548 C ATOM 5225 O GLN D 141 11.518 12.103 46.118 1.00 63.64 O ANISOU 5225 O GLN D 141 10194 9419 4566 211 -1636 -1599 O ATOM 5226 CB GLN D 141 8.547 12.576 47.230 1.00 72.39 C ANISOU 5226 CB GLN D 141 11420 10611 5475 220 -1343 -1718 C ATOM 5227 CG GLN D 141 7.239 13.357 47.092 1.00 78.83 C ANISOU 5227 CG GLN D 141 12224 11406 6320 202 -1235 -1817 C ATOM 5228 CD GLN D 141 7.413 14.747 46.497 1.00 82.09 C ANISOU 5228 CD GLN D 141 12533 11748 6911 170 -1306 -1950 C ATOM 5229 OE1 GLN D 141 6.767 15.098 45.498 1.00 84.73 O ANISOU 5229 OE1 GLN D 141 12810 12013 7371 140 -1255 -1975 O ATOM 5230 NE2 GLN D 141 8.273 15.551 47.117 1.00 77.12 N ANISOU 5230 NE2 GLN D 141 11873 11133 6297 176 -1419 -2033 N ATOM 5231 N VAL D 142 10.518 10.118 46.390 1.00 69.46 N ANISOU 5231 N VAL D 142 11079 10211 5103 242 -1459 -1410 N ATOM 5232 CA VAL D 142 11.811 9.455 46.562 1.00 67.73 C ANISOU 5232 CA VAL D 142 10861 10009 4866 264 -1563 -1317 C ATOM 5233 C VAL D 142 12.626 9.552 45.276 1.00 59.16 C ANISOU 5233 C VAL D 142 9686 8824 3966 232 -1655 -1295 C ATOM 5234 O VAL D 142 13.804 9.930 45.292 1.00 66.87 O ANISOU 5234 O VAL D 142 10602 9794 5011 234 -1784 -1310 O ATOM 5235 CB VAL D 142 11.618 7.996 47.024 1.00 68.05 C ANISOU 5235 CB VAL D 142 11001 10098 4756 298 -1480 -1164 C ATOM 5236 CG1 VAL D 142 12.799 7.119 46.620 1.00 61.33 C ANISOU 5236 CG1 VAL D 142 10140 9220 3942 308 -1564 -1041 C ATOM 5237 CG2 VAL D 142 11.435 7.952 48.539 1.00 65.68 C ANISOU 5237 CG2 VAL D 142 10768 9918 4269 341 -1451 -1176 C ATOM 5238 N LYS D 143 12.001 9.245 44.139 1.00 56.93 N ANISOU 5238 N LYS D 143 9351 8461 3816 186 -1562 -1244 N ATOM 5239 CA LYS D 143 12.707 9.341 42.865 1.00 63.42 C ANISOU 5239 CA LYS D 143 10064 9193 4841 148 -1627 -1212 C ATOM 5240 C LYS D 143 13.146 10.775 42.583 1.00 63.64 C ANISOU 5240 C LYS D 143 10007 9187 4986 136 -1742 -1351 C ATOM 5241 O LYS D 143 14.248 11.004 42.065 1.00 63.95 O ANISOU 5241 O LYS D 143 9981 9187 5132 134 -1867 -1344 O ATOM 5242 CB LYS D 143 11.827 8.810 41.731 1.00 58.50 C ANISOU 5242 CB LYS D 143 9385 8499 4343 95 -1488 -1140 C ATOM 5243 N ALA D 144 12.302 11.754 42.932 1.00 61.45 N ANISOU 5243 N ALA D 144 9729 8925 4696 130 -1700 -1477 N ATOM 5244 CA ALA D 144 12.628 13.155 42.694 1.00 49.39 C ANISOU 5244 CA ALA D 144 8116 7359 3289 118 -1797 -1613 C ATOM 5245 C ALA D 144 13.834 13.582 43.513 1.00 55.38 C ANISOU 5245 C ALA D 144 8856 8154 4033 137 -1919 -1642 C ATOM 5246 O ALA D 144 14.755 14.225 42.997 1.00 64.71 O ANISOU 5246 O ALA D 144 9940 9281 5366 121 -2024 -1666 O ATOM 5247 CB ALA D 144 11.423 14.032 43.023 1.00 51.41 C ANISOU 5247 CB ALA D 144 8379 7627 3528 109 -1707 -1732 C ATOM 5248 N ILE D 145 13.843 13.242 44.801 1.00 56.36 N ANISOU 5248 N ILE D 145 9068 8370 3975 172 -1905 -1638 N ATOM 5249 CA ILE D 145 14.965 13.615 45.652 1.00 59.27 C ANISOU 5249 CA ILE D 145 9424 8783 4314 189 -2019 -1668 C ATOM 5250 C ILE D 145 16.242 12.917 45.199 1.00 62.19 C ANISOU 5250 C ILE D 145 9759 9131 4739 196 -2113 -1555 C ATOM 5251 O ILE D 145 17.322 13.528 45.189 1.00 59.41 O ANISOU 5251 O ILE D 145 9335 8758 4480 190 -2228 -1587 O ATOM 5252 CB ILE D 145 14.617 13.330 47.127 1.00 62.68 C ANISOU 5252 CB ILE D 145 9958 9329 4527 226 -1974 -1682 C ATOM 5253 CG1 ILE D 145 13.311 14.029 47.518 1.00 61.69 C ANISOU 5253 CG1 ILE D 145 9863 9220 4356 219 -1872 -1792 C ATOM 5254 CG2 ILE D 145 15.728 13.767 48.050 1.00 59.84 C ANISOU 5254 CG2 ILE D 145 9587 9023 4128 241 -2092 -1723 C ATOM 5255 CD1 ILE D 145 12.808 13.641 48.891 1.00 63.24 C ANISOU 5255 CD1 ILE D 145 10164 9531 4334 255 -1806 -1790 C ATOM 5256 N LYS D 146 16.144 11.649 44.785 1.00 63.74 N ANISOU 5256 N LYS D 146 10003 9324 4889 207 -2064 -1420 N ATOM 5257 CA LYS D 146 17.319 10.951 44.264 1.00 58.70 C ANISOU 5257 CA LYS D 146 9331 8657 4316 212 -2146 -1307 C ATOM 5258 C LYS D 146 17.855 11.632 43.011 1.00 58.49 C ANISOU 5258 C LYS D 146 9180 8530 4516 176 -2214 -1331 C ATOM 5259 O LYS D 146 19.067 11.834 42.875 1.00 65.48 O ANISOU 5259 O LYS D 146 9998 9396 5487 177 -2321 -1310 O ATOM 5260 CB LYS D 146 16.977 9.485 43.970 1.00 58.61 C ANISOU 5260 CB LYS D 146 9397 8648 4226 227 -2066 -1163 C ATOM 5261 CG LYS D 146 18.113 8.673 43.346 1.00 50.45 C ANISOU 5261 CG LYS D 146 8331 7575 3264 233 -2137 -1038 C ATOM 5262 CD LYS D 146 19.345 8.681 44.243 1.00 51.70 C ANISOU 5262 CD LYS D 146 8482 7794 3369 264 -2241 -1019 C ATOM 5263 CE LYS D 146 20.295 7.520 43.928 1.00 51.42 C ANISOU 5263 CE LYS D 146 8452 7745 3341 284 -2279 -866 C ATOM 5264 NZ LYS D 146 20.775 7.519 42.509 1.00 49.84 N ANISOU 5264 NZ LYS D 146 8159 7441 3337 253 -2316 -827 N ATOM 5265 N GLU D 147 16.965 11.980 42.078 1.00 60.42 N ANISOU 5265 N GLU D 147 9387 8712 4859 144 -2150 -1368 N ATOM 5266 CA GLU D 147 17.388 12.658 40.857 1.00 51.89 C ANISOU 5266 CA GLU D 147 8181 7540 3997 110 -2206 -1386 C ATOM 5267 C GLU D 147 18.070 13.983 41.168 1.00 54.03 C ANISOU 5267 C GLU D 147 8369 7797 4364 104 -2299 -1493 C ATOM 5268 O GLU D 147 19.133 14.289 40.611 1.00 52.25 O ANISOU 5268 O GLU D 147 8050 7523 4279 96 -2390 -1467 O ATOM 5269 CB GLU D 147 16.183 12.861 39.945 1.00 53.40 C ANISOU 5269 CB GLU D 147 8351 7683 4258 79 -2112 -1418 C ATOM 5270 CG GLU D 147 16.371 13.891 38.852 1.00 62.52 C ANISOU 5270 CG GLU D 147 9366 8756 5633 45 -2157 -1470 C ATOM 5271 CD GLU D 147 15.230 13.879 37.846 1.00 62.73 C ANISOU 5271 CD GLU D 147 9342 8738 5754 5 -2029 -1455 C ATOM 5272 OE1 GLU D 147 15.073 12.855 37.147 1.00 65.01 O ANISOU 5272 OE1 GLU D 147 9625 9010 6066 -12 -1954 -1336 O ATOM 5273 OE2 GLU D 147 14.486 14.885 37.761 1.00 69.47 O1- ANISOU 5273 OE2 GLU D 147 10150 9574 6670 -13 -1989 -1556 O1- ATOM 5274 N LEU D 148 17.482 14.777 42.072 1.00 55.88 N ANISOU 5274 N LEU D 148 8636 8072 4524 107 -2274 -1611 N ATOM 5275 CA LEU D 148 18.081 16.060 42.419 1.00 53.26 C ANISOU 5275 CA LEU D 148 8233 7722 4281 100 -2359 -1720 C ATOM 5276 C LEU D 148 19.436 15.866 43.087 1.00 56.05 C ANISOU 5276 C LEU D 148 8587 8114 4595 122 -2466 -1683 C ATOM 5277 O LEU D 148 20.366 16.646 42.860 1.00 51.39 O ANISOU 5277 O LEU D 148 7907 7480 4141 111 -2558 -1716 O ATOM 5278 CB LEU D 148 17.134 16.857 43.321 1.00 56.36 C ANISOU 5278 CB LEU D 148 8674 8154 4587 101 -2303 -1853 C ATOM 5279 CG LEU D 148 15.931 17.452 42.585 1.00 54.36 C ANISOU 5279 CG LEU D 148 8385 7846 4424 75 -2215 -1917 C ATOM 5280 CD1 LEU D 148 14.899 17.995 43.541 1.00 51.56 C ANISOU 5280 CD1 LEU D 148 8097 7541 3955 83 -2140 -2029 C ATOM 5281 CD2 LEU D 148 16.391 18.533 41.621 1.00 52.34 C ANISOU 5281 CD2 LEU D 148 7991 7494 4404 46 -2279 -1963 C ATOM 5282 N GLY D 149 19.570 14.824 43.908 1.00 58.43 N ANISOU 5282 N GLY D 149 8986 8499 4715 153 -2452 -1609 N ATOM 5283 CA GLY D 149 20.862 14.541 44.514 1.00 53.56 C ANISOU 5283 CA GLY D 149 8368 7925 4058 175 -2552 -1562 C ATOM 5284 C GLY D 149 21.909 14.175 43.481 1.00 56.71 C ANISOU 5284 C GLY D 149 8684 8257 4606 168 -2616 -1460 C ATOM 5285 O GLY D 149 23.053 14.630 43.554 1.00 61.03 O ANISOU 5285 O GLY D 149 9166 8790 5232 168 -2716 -1467 O ATOM 5286 N ASP D 150 21.534 13.342 42.510 1.00 51.95 N ANISOU 5286 N ASP D 150 8083 7611 4044 162 -2558 -1363 N ATOM 5287 CA ASP D 150 22.433 13.052 41.397 1.00 55.36 C ANISOU 5287 CA ASP D 150 8428 7972 4635 152 -2608 -1270 C ATOM 5288 C ASP D 150 22.859 14.334 40.688 1.00 55.99 C ANISOU 5288 C ASP D 150 8379 7973 4921 124 -2666 -1344 C ATOM 5289 O ASP D 150 24.031 14.502 40.325 1.00 60.09 O ANISOU 5289 O ASP D 150 8820 8458 5554 125 -2747 -1303 O ATOM 5290 CB ASP D 150 21.758 12.108 40.394 1.00 56.03 C ANISOU 5290 CB ASP D 150 8531 8018 4741 142 -2526 -1177 C ATOM 5291 CG ASP D 150 21.335 10.788 41.010 1.00 64.92 C ANISOU 5291 CG ASP D 150 9784 9208 5675 171 -2461 -1090 C ATOM 5292 OD1 ASP D 150 22.146 10.147 41.714 1.00 66.26 O ANISOU 5292 OD1 ASP D 150 9994 9430 5753 202 -2506 -1021 O ATOM 5293 OD2 ASP D 150 20.179 10.383 40.770 1.00 70.54 O1- ANISOU 5293 OD2 ASP D 150 10552 9916 6332 162 -2360 -1085 O1- ATOM 5294 N HIS D 151 21.907 15.225 40.434 1.00 56.40 N ANISOU 5294 N HIS D 151 8405 7993 5031 100 -2619 -1446 N ATOM 5295 CA HIS D 151 22.220 16.473 39.748 1.00 52.71 C ANISOU 5295 CA HIS D 151 7813 7448 4765 75 -2664 -1513 C ATOM 5296 C HIS D 151 23.216 17.298 40.557 1.00 54.60 C ANISOU 5296 C HIS D 151 8024 7702 5021 84 -2762 -1580 C ATOM 5297 O HIS D 151 24.194 17.840 40.016 1.00 56.02 O ANISOU 5297 O HIS D 151 8103 7824 5359 77 -2834 -1566 O ATOM 5298 CB HIS D 151 20.927 17.258 39.515 1.00 52.25 C ANISOU 5298 CB HIS D 151 7745 7363 4743 52 -2588 -1615 C ATOM 5299 CG HIS D 151 20.065 16.699 38.432 1.00 46.68 C ANISOU 5299 CG HIS D 151 7030 6625 4083 35 -2504 -1556 C ATOM 5300 ND1 HIS D 151 20.422 15.593 37.692 1.00 51.16 N ANISOU 5300 ND1 HIS D 151 7595 7180 4662 38 -2498 -1424 N ATOM 5301 CD2 HIS D 151 18.868 17.108 37.947 1.00 49.08 C ANISOU 5301 CD2 HIS D 151 7319 6903 4425 13 -2423 -1612 C ATOM 5302 CE1 HIS D 151 19.479 15.340 36.802 1.00 45.19 C ANISOU 5302 CE1 HIS D 151 6827 6395 3948 16 -2419 -1405 C ATOM 5303 NE2 HIS D 151 18.527 16.246 36.934 1.00 48.56 N ANISOU 5303 NE2 HIS D 151 7244 6815 4390 1 -2373 -1517 N ATOM 5304 N VAL D 152 22.971 17.404 41.864 1.00 52.94 N ANISOU 5304 N VAL D 152 7900 7569 4644 100 -2763 -1655 N ATOM 5305 CA VAL D 152 23.857 18.149 42.751 1.00 60.16 C ANISOU 5305 CA VAL D 152 8799 8510 5551 108 -2856 -1729 C ATOM 5306 C VAL D 152 25.261 17.553 42.717 1.00 60.23 C ANISOU 5306 C VAL D 152 8780 8529 5577 124 -2940 -1625 C ATOM 5307 O VAL D 152 26.264 18.276 42.620 1.00 61.91 O ANISOU 5307 O VAL D 152 8911 8703 5910 119 -3025 -1650 O ATOM 5308 CB VAL D 152 23.280 18.160 44.182 1.00 59.84 C ANISOU 5308 CB VAL D 152 8867 8568 5301 125 -2831 -1812 C ATOM 5309 CG1 VAL D 152 24.325 18.611 45.176 1.00 57.70 C ANISOU 5309 CG1 VAL D 152 8593 8344 4987 137 -2933 -1863 C ATOM 5310 CG2 VAL D 152 22.039 19.036 44.263 1.00 54.03 C ANISOU 5310 CG2 VAL D 152 8140 7812 4576 108 -2759 -1937 C ATOM 5311 N THR D 153 25.340 16.219 42.787 1.00 57.00 N ANISOU 5311 N THR D 153 8438 8168 5052 145 -2913 -1506 N ATOM 5312 CA THR D 153 26.617 15.512 42.803 1.00 52.42 C ANISOU 5312 CA THR D 153 7841 7604 4471 164 -2983 -1397 C ATOM 5313 C THR D 153 27.384 15.729 41.508 1.00 51.50 C ANISOU 5313 C THR D 153 7605 7389 4572 149 -3016 -1335 C ATOM 5314 O THR D 153 28.595 15.983 41.521 1.00 58.61 O ANISOU 5314 O THR D 153 8446 8276 5548 154 -3099 -1314 O ATOM 5315 CB THR D 153 26.374 14.021 43.044 1.00 57.85 C ANISOU 5315 CB THR D 153 8627 8354 5002 191 -2930 -1278 C ATOM 5316 OG1 THR D 153 26.080 13.802 44.431 1.00 59.00 O ANISOU 5316 OG1 THR D 153 8873 8606 4938 214 -2923 -1318 O ATOM 5317 CG2 THR D 153 27.590 13.188 42.648 1.00 54.93 C ANISOU 5317 CG2 THR D 153 8222 7972 4676 208 -2982 -1143 C ATOM 5318 N ASN D 154 26.699 15.641 40.372 1.00 49.61 N ANISOU 5318 N ASN D 154 7329 7084 4436 131 -2950 -1304 N ATOM 5319 CA ASN D 154 27.383 15.858 39.104 1.00 48.37 C ANISOU 5319 CA ASN D 154 7055 6839 4485 118 -2972 -1241 C ATOM 5320 C ASN D 154 27.918 17.279 39.004 1.00 57.66 C ANISOU 5320 C ASN D 154 8133 7961 5815 104 -3035 -1332 C ATOM 5321 O ASN D 154 29.105 17.481 38.727 1.00 54.71 O ANISOU 5321 O ASN D 154 7686 7555 5546 109 -3102 -1289 O ATOM 5322 CB ASN D 154 26.459 15.552 37.939 1.00 46.80 C ANISOU 5322 CB ASN D 154 6833 6590 4361 99 -2887 -1200 C ATOM 5323 CG ASN D 154 26.307 14.084 37.706 1.00 55.87 C ANISOU 5323 CG ASN D 154 8049 7765 5415 113 -2839 -1080 C ATOM 5324 OD1 ASN D 154 27.266 13.390 37.374 1.00 49.81 O ANISOU 5324 OD1 ASN D 154 7258 6987 4680 128 -2871 -974 O ATOM 5325 ND2 ASN D 154 25.089 13.590 37.875 1.00 65.65 N ANISOU 5325 ND2 ASN D 154 9374 9034 6538 109 -2758 -1094 N ATOM 5326 N LEU D 155 27.053 18.281 39.234 1.00 60.20 N ANISOU 5326 N LEU D 155 8451 8270 6154 86 -3012 -1457 N ATOM 5327 CA LEU D 155 27.498 19.670 39.123 1.00 51.85 C ANISOU 5327 CA LEU D 155 7297 7151 5252 74 -3067 -1546 C ATOM 5328 C LEU D 155 28.669 19.951 40.056 1.00 60.44 C ANISOU 5328 C LEU D 155 8388 8274 6302 88 -3166 -1575 C ATOM 5329 O LEU D 155 29.649 20.589 39.658 1.00 72.73 O ANISOU 5329 O LEU D 155 9852 9774 8010 86 -3229 -1568 O ATOM 5330 CB LEU D 155 26.340 20.627 39.405 1.00 58.74 C ANISOU 5330 CB LEU D 155 8180 8012 6124 57 -3023 -1682 C ATOM 5331 CG LEU D 155 25.182 20.647 38.391 1.00 59.52 C ANISOU 5331 CG LEU D 155 8251 8066 6298 38 -2930 -1671 C ATOM 5332 CD1 LEU D 155 23.836 20.911 39.066 1.00 55.00 C ANISOU 5332 CD1 LEU D 155 7758 7532 5608 31 -2861 -1780 C ATOM 5333 CD2 LEU D 155 25.428 21.675 37.298 1.00 62.83 C ANISOU 5333 CD2 LEU D 155 8529 8385 6957 22 -2943 -1678 C ATOM 5334 N ARG D 156 28.610 19.455 41.290 1.00 61.59 N ANISOU 5334 N ARG D 156 8638 8516 6247 105 -3180 -1601 N ATOM 5335 CA ARG D 156 29.750 19.594 42.191 1.00 59.52 C ANISOU 5335 CA ARG D 156 8380 8300 5934 119 -3275 -1619 C ATOM 5336 C ARG D 156 31.005 18.936 41.618 1.00 61.70 C ANISOU 5336 C ARG D 156 8604 8556 6282 131 -3322 -1485 C ATOM 5337 O ARG D 156 32.044 19.588 41.465 1.00 64.09 O ANISOU 5337 O ARG D 156 8827 8817 6708 129 -3395 -1495 O ATOM 5338 CB ARG D 156 29.393 19.008 43.550 1.00 58.64 C ANISOU 5338 CB ARG D 156 8393 8308 5581 137 -3269 -1649 C ATOM 5339 CG ARG D 156 28.629 19.986 44.402 1.00 60.41 C ANISOU 5339 CG ARG D 156 8650 8556 5745 127 -3260 -1809 C ATOM 5340 CD ARG D 156 28.940 19.754 45.837 1.00 80.43 C ANISOU 5340 CD ARG D 156 11269 11206 8085 146 -3305 -1849 C ATOM 5341 NE ARG D 156 28.079 18.710 46.375 1.00 84.21 N ANISOU 5341 NE ARG D 156 11862 11771 8363 165 -3228 -1803 N ATOM 5342 CZ ARG D 156 27.029 18.949 47.152 1.00 84.00 C ANISOU 5342 CZ ARG D 156 11913 11798 8206 167 -3171 -1897 C ATOM 5343 NH1 ARG D 156 26.718 20.201 47.489 1.00 87.41 N ANISOU 5343 NH1 ARG D 156 12318 12204 8688 150 -3186 -2046 N ATOM 5344 NH2 ARG D 156 26.298 17.939 47.601 1.00 79.90 N ANISOU 5344 NH2 ARG D 156 11495 11356 7508 187 -3097 -1840 N ATOM 5345 N CYS D 157 30.920 17.645 41.280 1.00 68.62 N ANISOU 5345 N CYS D 157 9526 9458 7088 145 -3276 -1360 N ATOM 5346 CA CYS D 157 32.065 16.925 40.723 1.00 65.46 C ANISOU 5346 CA CYS D 157 9081 9040 6751 159 -3308 -1228 C ATOM 5347 C CYS D 157 32.639 17.614 39.492 1.00 65.49 C ANISOU 5347 C CYS D 157 8957 8936 6988 145 -3320 -1203 C ATOM 5348 O CYS D 157 33.833 17.467 39.206 1.00 67.33 O ANISOU 5348 O CYS D 157 9136 9150 7298 155 -3370 -1131 O ATOM 5349 CB CYS D 157 31.663 15.495 40.353 1.00 71.27 C ANISOU 5349 CB CYS D 157 9878 9800 7400 174 -3239 -1105 C ATOM 5350 SG CYS D 157 31.384 14.395 41.728 1.00 88.75 S ANISOU 5350 SG CYS D 157 12234 12142 9345 203 -3229 -1078 S ATOM 5351 N MET D 158 31.811 18.341 38.734 1.00 70.07 N ATOM 5352 CA MET D 158 32.282 18.950 37.496 1.00 64.37 C ATOM 5353 C MET D 158 33.042 20.249 37.712 1.00 72.06 C ATOM 5354 O MET D 158 33.607 20.779 36.751 1.00 70.78 O ATOM 5355 CB MET D 158 31.115 19.209 36.552 1.00 55.07 C ATOM 5356 CG MET D 158 30.520 17.949 35.985 1.00 55.30 C ATOM 5357 SD MET D 158 28.953 18.208 35.146 1.00 55.47 S ATOM 5358 CE MET D 158 29.485 18.857 33.562 1.00 47.08 C