>>6WYG:HELIX    1 AA1 HIS A   13  ASP A   42  1                                  30    
HQDSEAAINRQINLELYASYVYLSMSYYFD
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 AA1 HIS A 13 ASP A 42 1 30 ATOM 70 N HIS A 13 54.484 13.172 -23.444 1.00 53.39 N ANISOU 70 N HIS A 13 4122 6084 10080 -684 2183 2015 N ATOM 71 CA HIS A 13 55.927 13.265 -23.325 1.00 55.98 C ANISOU 71 CA HIS A 13 4290 6504 10476 -700 2191 2092 C ATOM 72 C HIS A 13 56.441 12.261 -22.307 1.00 57.67 C ANISOU 72 C HIS A 13 4439 6660 10811 -566 2205 1981 C ATOM 73 O HIS A 13 55.735 11.914 -21.352 1.00 52.71 O ANISOU 73 O HIS A 13 3892 5873 10262 -501 2127 1885 O ATOM 74 CB HIS A 13 56.323 14.683 -22.914 1.00 55.58 C ANISOU 74 CB HIS A 13 4224 6380 10514 -841 1991 2253 C ATOM 75 CG HIS A 13 57.758 15.010 -23.185 1.00 64.72 C ANISOU 75 CG HIS A 13 5220 7678 11693 -904 2010 2373 C ATOM 76 ND1 HIS A 13 58.788 14.533 -22.406 1.00 58.19 N ANISOU 76 ND1 HIS A 13 4273 6854 10984 -840 2006 2356 N ATOM 77 CD2 HIS A 13 58.334 15.767 -24.150 1.00 59.62 C ANISOU 77 CD2 HIS A 13 4510 7180 10962 -1030 2031 2517 C ATOM 78 CE1 HIS A 13 59.936 14.986 -22.878 1.00 62.85 C ANISOU 78 CE1 HIS A 13 4730 7590 11562 -921 2025 2483 C ATOM 79 NE2 HIS A 13 59.686 15.735 -23.936 1.00 61.17 N ANISOU 79 NE2 HIS A 13 4548 7470 11226 -1039 2042 2582 N ATOM 80 N GLN A 14 57.677 11.776 -22.543 1.00 56.09 N ANISOU 80 N GLN A 14 4092 6600 10619 -525 2306 1996 N ATOM 81 CA GLN A 14 58.316 10.816 -21.636 1.00 55.89 C ANISOU 81 CA GLN A 14 3995 6532 10710 -398 2316 1905 C ATOM 82 C GLN A 14 58.511 11.403 -20.242 1.00 55.05 C ANISOU 82 C GLN A 14 3885 6256 10778 -434 2107 1955 C ATOM 83 O GLN A 14 58.426 10.677 -19.241 1.00 56.12 O ANISOU 83 O GLN A 14 4034 6281 11009 -335 2065 1857 O ATOM 84 CB GLN A 14 59.682 10.363 -22.187 1.00 72.77 C ANISOU 84 CB GLN A 14 5965 8860 12825 -361 2446 1934 C ATOM 85 CG GLN A 14 59.673 9.834 -23.606 1.00 72.80 C ANISOU 85 CG GLN A 14 5955 9062 12646 -328 2654 1887 C ATOM 86 CD GLN A 14 59.601 8.328 -23.660 1.00 70.83 C ANISOU 86 CD GLN A 14 5720 8827 12367 -145 2794 1700 C ATOM 87 OE1 GLN A 14 60.538 7.643 -23.256 1.00 84.79 O ANISOU 87 OE1 GLN A 14 7382 10623 14211 -50 2824 1661 O ATOM 88 NE2 GLN A 14 58.490 7.801 -24.158 1.00 63.06 N ANISOU 88 NE2 GLN A 14 4872 7817 11271 -96 2872 1584 N ATOM 89 N ASP A 15 58.826 12.706 -20.164 1.00 55.71 N ANISOU 89 N ASP A 15 3949 6318 10898 -578 1968 2107 N ATOM 90 CA ASP A 15 58.950 13.373 -18.871 1.00 55.01 C ANISOU 90 CA ASP A 15 3878 6064 10960 -621 1755 2150 C ATOM 91 C ASP A 15 57.640 13.303 -18.109 1.00 52.80 C ANISOU 91 C ASP A 15 3752 5602 10708 -581 1659 2044 C ATOM 92 O ASP A 15 57.631 13.102 -16.890 1.00 51.85 O ANISOU 92 O ASP A 15 3644 5354 10702 -536 1546 1990 O ATOM 93 CB ASP A 15 59.357 14.843 -19.049 1.00 56.17 C ANISOU 93 CB ASP A 15 4010 6210 11121 -786 1614 2322 C ATOM 94 CG ASP A 15 60.723 15.016 -19.704 1.00 60.78 C ANISOU 94 CG ASP A 15 4430 6980 11685 -845 1688 2444 C ATOM 95 OD1 ASP A 15 61.358 13.990 -20.021 1.00 65.27 O1- ANISOU 95 OD1 ASP A 15 4893 7679 12227 -748 1852 2389 O1- ATOM 96 OD2 ASP A 15 61.155 16.182 -19.908 1.00 60.66 O ANISOU 96 OD2 ASP A 15 4392 6978 11676 -987 1577 2594 O ATOM 97 N SER A 16 56.518 13.480 -18.816 1.00 52.40 N ANISOU 97 N SER A 16 3818 5545 10548 -603 1700 2015 N ATOM 98 CA SER A 16 55.198 13.401 -18.177 1.00 50.05 C ANISOU 98 CA SER A 16 3666 5091 10260 -565 1620 1913 C ATOM 99 C SER A 16 54.922 11.998 -17.650 1.00 48.95 C ANISOU 99 C SER A 16 3529 4928 10141 -420 1708 1757 C ATOM 100 O SER A 16 54.475 11.841 -16.512 1.00 47.64 O ANISOU 100 O SER A 16 3437 4632 10034 -371 1581 1677 O ATOM 101 CB SER A 16 54.102 13.821 -19.157 1.00 49.70 C ANISOU 101 CB SER A 16 3738 5062 10082 -617 1658 1924 C ATOM 102 OG SER A 16 54.290 15.147 -19.622 1.00 57.28 O ANISOU 102 OG SER A 16 4710 6030 11023 -753 1555 2071 O ATOM 103 N GLU A 17 55.190 10.972 -18.468 1.00 53.33 N ANISOU 103 N GLU A 17 4034 5615 10612 -339 1903 1696 N ATOM 104 CA GLU A 17 55.059 9.578 -18.033 1.00 48.85 C ANISOU 104 CA GLU A 17 3478 5029 10054 -191 1977 1544 C ATOM 105 C GLU A 17 55.860 9.321 -16.760 1.00 57.05 C ANISOU 105 C GLU A 17 4431 5990 11254 -150 1874 1544 C ATOM 106 O GLU A 17 55.351 8.730 -15.792 1.00 47.49 O ANISOU 106 O GLU A 17 3282 4670 10091 -79 1802 1445 O ATOM 107 CB GLU A 17 55.520 8.658 -19.165 1.00 50.11 C ANISOU 107 CB GLU A 17 3577 5350 10112 -118 2193 1496 C ATOM 108 CG GLU A 17 55.450 7.155 -18.874 1.00 53.92 C ANISOU 108 CG GLU A 17 4075 5811 10599 41 2277 1336 C ATOM 109 CD GLU A 17 56.037 6.321 -20.015 1.00 59.16 C ANISOU 109 CD GLU A 17 4689 6636 11155 118 2474 1282 C ATOM 110 OE1 GLU A 17 56.369 6.923 -21.056 1.00 59.80 O ANISOU 110 OE1 GLU A 17 4724 6856 11141 42 2554 1367 O ATOM 111 OE2 GLU A 17 56.153 5.077 -19.892 1.00 60.30 O1- ANISOU 111 OE2 GLU A 17 4844 6769 11300 252 2542 1153 O1- ATOM 112 N ALA A 18 57.117 9.791 -16.735 1.00 50.32 N ANISOU 112 N ALA A 18 3456 5201 10464 -200 1846 1656 N ATOM 113 CA ALA A 18 57.966 9.558 -15.572 1.00 50.48 C ANISOU 113 CA ALA A 18 3398 5160 10624 -166 1744 1666 C ATOM 114 C ALA A 18 57.441 10.292 -14.344 1.00 49.20 C ANISOU 114 C ALA A 18 3307 4832 10554 -223 1534 1678 C ATOM 115 O ALA A 18 57.421 9.731 -13.240 1.00 51.26 O ANISOU 115 O ALA A 18 3576 5003 10898 -160 1456 1612 O ATOM 116 CB ALA A 18 59.412 9.975 -15.883 1.00 52.54 C ANISOU 116 CB ALA A 18 3507 5537 10919 -219 1760 1794 C ATOM 117 N ALA A 19 57.048 11.558 -14.508 1.00 49.15 N ANISOU 117 N ALA A 19 3359 4784 10530 -342 1431 1762 N ATOM 118 CA ALA A 19 56.445 12.302 -13.406 1.00 54.30 C ANISOU 118 CA ALA A 19 4103 5277 11250 -388 1228 1754 C ATOM 119 C ALA A 19 55.180 11.616 -12.904 1.00 46.17 C ANISOU 119 C ALA A 19 3200 4164 10179 -304 1220 1607 C ATOM 120 O ALA A 19 54.935 11.570 -11.697 1.00 45.27 O ANISOU 120 O ALA A 19 3135 3945 10121 -278 1082 1550 O ATOM 121 CB ALA A 19 56.136 13.739 -13.836 1.00 48.42 C ANISOU 121 CB ALA A 19 3427 4500 10470 -515 1123 1853 C ATOM 122 N ILE A 20 54.377 11.058 -13.809 1.00 45.68 N ANISOU 122 N ILE A 20 3225 4162 9969 -249 1349 1528 N ATOM 123 CA ILE A 20 53.161 10.350 -13.383 1.00 44.02 C ANISOU 123 CA ILE A 20 3169 3893 9665 -157 1326 1378 C ATOM 124 C ILE A 20 53.510 9.136 -12.524 1.00 43.66 C ANISOU 124 C ILE A 20 3074 3826 9689 -55 1339 1296 C ATOM 125 O ILE A 20 52.867 8.883 -11.502 1.00 48.60 O ANISOU 125 O ILE A 20 3785 4364 10315 -15 1227 1218 O ATOM 126 CB ILE A 20 52.304 9.968 -14.602 1.00 43.77 C ANISOU 126 CB ILE A 20 3232 3937 9461 -129 1462 1322 C ATOM 127 CG1 ILE A 20 51.743 11.230 -15.256 1.00 43.90 C ANISOU 127 CG1 ILE A 20 3324 3949 9408 -232 1407 1400 C ATOM 128 CG2 ILE A 20 51.164 9.024 -14.194 1.00 50.66 C ANISOU 128 CG2 ILE A 20 4240 4764 10242 -33 1454 1172 C ATOM 129 CD1 ILE A 20 50.816 12.005 -14.359 1.00 42.74 C ANISOU 129 CD1 ILE A 20 3304 3673 9264 -249 1217 1370 C ATOM 130 N ASN A 21 54.562 8.396 -12.890 1.00 45.42 N ANISOU 130 N ASN A 21 3152 4130 9977 -11 1468 1320 N ATOM 131 CA ASN A 21 55.013 7.302 -12.024 1.00 44.69 C ANISOU 131 CA ASN A 21 2999 4005 9977 83 1463 1260 C ATOM 132 C ASN A 21 55.493 7.805 -10.661 1.00 44.55 C ANISOU 132 C ASN A 21 2932 3898 10099 38 1282 1313 C ATOM 133 O ASN A 21 55.189 7.207 -9.620 1.00 43.67 O ANISOU 133 O ASN A 21 2863 3713 10016 92 1195 1242 O ATOM 134 CB ASN A 21 56.126 6.514 -12.719 1.00 50.56 C ANISOU 134 CB ASN A 21 3611 4854 10746 146 1621 1275 C ATOM 135 CG ASN A 21 55.608 5.675 -13.861 1.00 50.07 C ANISOU 135 CG ASN A 21 3603 4866 10556 221 1799 1182 C ATOM 136 OD1 ASN A 21 54.510 5.105 -13.787 1.00 45.07 O ANISOU 136 OD1 ASN A 21 3106 4181 9837 271 1794 1073 O ATOM 137 ND2 ASN A 21 56.373 5.616 -14.935 1.00 47.87 N ANISOU 137 ND2 ASN A 21 3249 4715 10223 226 1937 1219 N ATOM 138 N ARG A 22 56.286 8.876 -10.645 1.00 45.56 N ANISOU 138 N ARG A 22 2974 4033 10302 -64 1216 1440 N ATOM 139 CA ARG A 22 56.709 9.436 -9.360 1.00 45.71 C ANISOU 139 CA ARG A 22 2976 3963 10428 -112 1026 1483 C ATOM 140 C ARG A 22 55.503 9.821 -8.502 1.00 46.30 C ANISOU 140 C ARG A 22 3203 3927 10463 -123 880 1405 C ATOM 141 O ARG A 22 55.492 9.583 -7.288 1.00 50.80 O ANISOU 141 O ARG A 22 3785 4428 11088 -102 759 1367 O ATOM 142 CB ARG A 22 57.623 10.642 -9.580 1.00 46.89 C ANISOU 142 CB ARG A 22 3062 4136 10616 -222 955 1623 C ATOM 143 CG ARG A 22 58.978 10.282 -10.183 1.00 56.43 C ANISOU 143 CG ARG A 22 4128 5466 11847 -207 1065 1702 C ATOM 144 CD ARG A 22 59.927 11.504 -10.266 1.00 61.11 C ANISOU 144 CD ARG A 22 4650 6085 12484 -328 970 1853 C ATOM 145 NE ARG A 22 60.285 11.787 -11.659 1.00 59.10 N ANISOU 145 NE ARG A 22 4340 5966 12150 -369 1109 1928 N ATOM 146 CZ ARG A 22 59.845 12.836 -12.344 1.00 56.67 C ANISOU 146 CZ ARG A 22 4089 5663 11779 -468 1082 1991 C ATOM 147 NH1 ARG A 22 59.055 13.738 -11.758 1.00 61.33 N ANISOU 147 NH1 ARG A 22 4798 6122 12382 -529 916 1983 N ATOM 148 NH2 ARG A 22 60.205 12.996 -13.608 1.00 62.55 N ANISOU 148 NH2 ARG A 22 4776 6548 12442 -505 1215 2061 N ATOM 149 N GLN A 23 54.465 10.391 -9.121 1.00 44.93 N ANISOU 149 N GLN A 23 3165 3746 10162 -145 884 1373 N ATOM 150 CA GLN A 23 53.303 10.828 -8.352 1.00 42.34 C ANISOU 150 CA GLN A 23 2997 3327 9764 -140 741 1291 C ATOM 151 C GLN A 23 52.498 9.638 -7.848 1.00 40.75 C ANISOU 151 C GLN A 23 2873 3123 9488 -35 765 1162 C ATOM 152 O GLN A 23 51.969 9.674 -6.734 1.00 39.92 O ANISOU 152 O GLN A 23 2837 2956 9376 -19 634 1103 O ATOM 153 CB GLN A 23 52.423 11.752 -9.189 1.00 41.77 C ANISOU 153 CB GLN A 23 3038 3250 9583 -186 738 1300 C ATOM 154 CG GLN A 23 51.315 12.457 -8.377 1.00 40.74 C ANISOU 154 CG GLN A 23 3058 3023 9397 -185 574 1228 C ATOM 155 CD GLN A 23 51.874 13.570 -7.501 1.00 57.82 C ANISOU 155 CD GLN A 23 5200 5093 11677 -262 392 1290 C ATOM 156 OE1 GLN A 23 52.850 14.246 -7.869 1.00 50.86 O ANISOU 156 OE1 GLN A 23 4223 4210 10891 -353 380 1413 O ATOM 157 NE2 GLN A 23 51.269 13.762 -6.330 1.00 52.01 N ANISOU 157 NE2 GLN A 23 4551 4282 10927 -232 248 1205 N ATOM 158 N ILE A 24 52.383 8.584 -8.663 1.00 40.72 N ANISOU 158 N ILE A 24 2860 3189 9422 33 928 1118 N ATOM 159 CA ILE A 24 51.801 7.321 -8.206 1.00 39.81 C ANISOU 159 CA ILE A 24 2800 3068 9258 126 950 1011 C ATOM 160 C ILE A 24 52.480 6.853 -6.922 1.00 47.16 C ANISOU 160 C ILE A 24 3653 3953 10314 146 853 1018 C ATOM 161 O ILE A 24 51.819 6.574 -5.905 1.00 38.97 O ANISOU 161 O ILE A 24 2690 2871 9246 169 746 955 O ATOM 162 CB ILE A 24 51.907 6.262 -9.316 1.00 42.11 C ANISOU 162 CB ILE A 24 3069 3433 9499 192 1138 975 C ATOM 163 CG1 ILE A 24 50.863 6.528 -10.403 1.00 39.76 C ANISOU 163 CG1 ILE A 24 2892 3175 9039 180 1212 939 C ATOM 164 CG2 ILE A 24 51.705 4.851 -8.744 1.00 40.90 C ANISOU 164 CG2 ILE A 24 2934 3255 9349 285 1150 888 C ATOM 165 CD1 ILE A 24 51.160 5.814 -11.706 1.00 40.59 C ANISOU 165 CD1 ILE A 24 2962 3367 9092 221 1403 924 C ATOM 166 N ASN A 25 53.820 6.794 -6.941 1.00 41.17 N ANISOU 166 N ASN A 25 2734 3215 9694 133 885 1103 N ATOM 167 CA ASN A 25 54.543 6.374 -5.743 1.00 48.69 C ANISOU 167 CA ASN A 25 3600 4126 10773 145 787 1124 C ATOM 168 C ASN A 25 54.293 7.322 -4.580 1.00 40.96 C ANISOU 168 C ASN A 25 2673 3076 9812 76 591 1135 C ATOM 169 O ASN A 25 54.157 6.890 -3.428 1.00 40.56 O ANISOU 169 O ASN A 25 2640 2987 9783 97 485 1099 O ATOM 170 CB ASN A 25 56.048 6.264 -6.010 1.00 45.05 C ANISOU 170 CB ASN A 25 2974 3708 10435 137 845 1221 C ATOM 171 CG ASN A 25 56.769 5.649 -4.842 1.00 43.75 C ANISOU 171 CG ASN A 25 2774 3505 10345 157 745 1231 C ATOM 172 OD1 ASN A 25 57.420 6.343 -4.068 1.00 44.35 O ANISOU 172 OD1 ASN A 25 2798 3550 10505 91 618 1305 O ATOM 173 ND2 ASN A 25 56.574 4.350 -4.649 1.00 44.05 N ANISOU 173 ND2 ASN A 25 2857 3538 10341 236 786 1156 N ATOM 174 N LEU A 26 54.204 8.623 -4.864 1.00 43.68 N ANISOU 174 N LEU A 26 3051 3403 10143 -6 535 1183 N ATOM 175 CA LEU A 26 53.952 9.601 -3.811 1.00 40.91 C ANISOU 175 CA LEU A 26 2763 2977 9806 -66 344 1181 C ATOM 176 C LEU A 26 52.578 9.403 -3.158 1.00 44.29 C ANISOU 176 C LEU A 26 3348 3380 10102 -16 276 1060 C ATOM 177 O LEU A 26 52.445 9.472 -1.927 1.00 39.21 O ANISOU 177 O LEU A 26 2731 2697 9470 -20 137 1026 O ATOM 178 CB LEU A 26 54.081 11.005 -4.396 1.00 49.42 C ANISOU 178 CB LEU A 26 3855 4029 10894 -159 303 1255 C ATOM 179 CG LEU A 26 54.123 12.113 -3.350 1.00 49.46 C ANISOU 179 CG LEU A 26 3904 3941 10947 -229 96 1267 C ATOM 180 CD1 LEU A 26 55.148 11.755 -2.289 1.00 45.37 C ANISOU 180 CD1 LEU A 26 3275 3411 10552 -244 12 1308 C ATOM 181 CD2 LEU A 26 54.427 13.467 -4.010 1.00 42.73 C ANISOU 181 CD2 LEU A 26 3059 3066 10110 -320 49 1355 C ATOM 182 N GLU A 27 51.546 9.153 -3.962 1.00 38.73 N ANISOU 182 N GLU A 27 2741 2709 9264 27 371 996 N ATOM 183 CA GLU A 27 50.218 8.939 -3.395 1.00 43.56 C ANISOU 183 CA GLU A 27 3488 3316 9745 72 314 889 C ATOM 184 C GLU A 27 50.175 7.642 -2.593 1.00 47.65 C ANISOU 184 C GLU A 27 3988 3853 10266 130 310 844 C ATOM 185 O GLU A 27 49.512 7.565 -1.547 1.00 42.68 O ANISOU 185 O GLU A 27 3422 3214 9579 143 202 785 O ATOM 186 CB GLU A 27 49.157 8.919 -4.496 1.00 37.90 C ANISOU 186 CB GLU A 27 2870 2639 8890 99 417 844 C ATOM 187 CG GLU A 27 49.041 10.169 -5.320 1.00 46.22 C ANISOU 187 CG GLU A 27 3958 3676 9928 43 413 892 C ATOM 188 CD GLU A 27 48.546 11.364 -4.527 1.00 59.39 C ANISOU 188 CD GLU A 27 5704 5275 11585 14 243 869 C ATOM 189 OE1 GLU A 27 48.000 11.158 -3.422 1.00 67.34 O ANISOU 189 OE1 GLU A 27 6762 6272 12554 51 147 793 O ATOM 190 OE2 GLU A 27 48.718 12.509 -5.013 1.00 60.32 O1- ANISOU 190 OE2 GLU A 27 5835 5352 11734 -46 203 927 O1- ATOM 191 N LEU A 28 50.874 6.607 -3.063 1.00 40.71 N ANISOU 191 N LEU A 28 3018 2999 9449 166 425 870 N ATOM 192 CA LEU A 28 50.904 5.367 -2.293 1.00 37.25 C ANISOU 192 CA LEU A 28 2560 2562 9031 217 408 838 C ATOM 193 C LEU A 28 51.634 5.578 -0.975 1.00 40.83 C ANISOU 193 C LEU A 28 2943 2979 9592 181 261 881 C ATOM 194 O LEU A 28 51.228 5.053 0.066 1.00 37.18 O ANISOU 194 O LEU A 28 2522 2526 9080 186 171 840 O ATOM 195 CB LEU A 28 51.558 4.269 -3.117 1.00 37.88 C ANISOU 195 CB LEU A 28 2560 2664 9167 272 557 853 C ATOM 196 CG LEU A 28 50.734 3.800 -4.316 1.00 37.44 C ANISOU 196 CG LEU A 28 2590 2646 8990 316 696 792 C ATOM 197 CD1 LEU A 28 51.583 2.955 -5.258 1.00 38.44 C ANISOU 197 CD1 LEU A 28 2638 2803 9163 361 848 805 C ATOM 198 CD2 LEU A 28 49.505 3.019 -3.859 1.00 36.35 C ANISOU 198 CD2 LEU A 28 2584 2522 8704 335 655 705 C ATOM 199 N TYR A 29 52.685 6.403 -0.988 1.00 38.65 N ANISOU 199 N TYR A 29 2570 2682 9434 124 226 964 N ATOM 200 CA TYR A 29 53.385 6.703 0.253 1.00 46.14 C ANISOU 200 CA TYR A 29 3456 3594 10480 78 74 1008 C ATOM 201 C TYR A 29 52.463 7.431 1.226 1.00 42.58 C ANISOU 201 C TYR A 29 3128 3122 9930 51 -77 942 C ATOM 202 O TYR A 29 52.394 7.075 2.407 1.00 45.30 O ANISOU 202 O TYR A 29 3478 3464 10271 50 -186 921 O ATOM 203 CB TYR A 29 54.656 7.510 -0.052 1.00 40.44 C ANISOU 203 CB TYR A 29 2610 2857 9899 9 64 1119 C ATOM 204 CG TYR A 29 55.358 8.101 1.161 1.00 41.08 C ANISOU 204 CG TYR A 29 2640 2894 10075 -61 -112 1169 C ATOM 205 CD1 TYR A 29 56.077 7.295 2.030 1.00 51.78 C ANISOU 205 CD1 TYR A 29 3910 4251 11514 -48 -164 1203 C ATOM 206 CD2 TYR A 29 55.303 9.466 1.430 1.00 41.35 C ANISOU 206 CD2 TYR A 29 2727 2879 10106 -141 -235 1182 C ATOM 207 CE1 TYR A 29 56.735 7.824 3.142 1.00 45.89 C ANISOU 207 CE1 TYR A 29 3144 3472 10819 -107 -330 1248 C ATOM 208 CE2 TYR A 29 55.955 10.009 2.552 1.00 42.05 C ANISOU 208 CE2 TYR A 29 2788 2935 10255 -199 -406 1217 C ATOM 209 CZ TYR A 29 56.672 9.177 3.399 1.00 46.21 C ANISOU 209 CZ TYR A 29 3233 3477 10846 -181 -450 1252 C ATOM 210 OH TYR A 29 57.308 9.666 4.512 1.00 43.19 O ANISOU 210 OH TYR A 29 2841 3073 10497 -232 -619 1285 O ATOM 211 N ALA A 30 51.742 8.446 0.743 1.00 39.20 N ANISOU 211 N ALA A 30 2797 2681 9417 32 -84 907 N ATOM 212 CA ALA A 30 50.766 9.149 1.583 1.00 37.53 C ANISOU 212 CA ALA A 30 2707 2454 9100 27 -215 827 C ATOM 213 C ALA A 30 49.723 8.188 2.156 1.00 39.99 C ANISOU 213 C ALA A 30 3089 2821 9286 88 -213 742 C ATOM 214 O ALA A 30 49.373 8.258 3.349 1.00 38.75 O ANISOU 214 O ALA A 30 2969 2673 9081 84 -338 697 O ATOM 215 CB ALA A 30 50.083 10.252 0.773 1.00 37.58 C ANISOU 215 CB ALA A 30 2805 2438 9036 16 -202 803 C ATOM 216 N SER A 31 49.209 7.288 1.321 1.00 35.95 N ANISOU 216 N SER A 31 2596 2350 8712 138 -78 722 N ATOM 217 CA SER A 31 48.319 6.247 1.822 1.00 41.39 C ANISOU 217 CA SER A 31 3339 3093 9296 182 -76 662 C ATOM 218 C SER A 31 48.962 5.504 2.997 1.00 35.50 C ANISOU 218 C SER A 31 2522 2349 8617 169 -163 692 C ATOM 219 O SER A 31 48.333 5.304 4.052 1.00 41.68 O ANISOU 219 O SER A 31 3349 3163 9322 171 -261 651 O ATOM 220 CB SER A 31 47.966 5.302 0.670 1.00 34.78 C ANISOU 220 CB SER A 31 2521 2296 8400 220 82 649 C ATOM 221 OG SER A 31 47.162 4.221 1.104 1.00 39.69 O ANISOU 221 OG SER A 31 3193 2967 8919 246 79 603 O ATOM 222 N TYR A 32 50.241 5.141 2.852 1.00 36.35 N ANISOU 222 N TYR A 32 2512 2431 8866 151 -133 768 N ATOM 223 CA TYR A 32 50.941 4.373 3.888 1.00 36.81 C ANISOU 223 CA TYR A 32 2498 2492 8998 134 -212 809 C ATOM 224 C TYR A 32 51.101 5.168 5.175 1.00 37.10 C ANISOU 224 C TYR A 32 2526 2499 9072 95 -388 818 C ATOM 225 O TYR A 32 50.916 4.639 6.282 1.00 37.50 O ANISOU 225 O TYR A 32 2581 2577 9089 87 -485 810 O ATOM 226 CB TYR A 32 52.319 3.953 3.369 1.00 43.13 C ANISOU 226 CB TYR A 32 3174 3270 9944 126 -138 891 C ATOM 227 CG TYR A 32 52.897 2.723 4.001 1.00 41.22 C ANISOU 227 CG TYR A 32 2884 3036 9742 127 -159 922 C ATOM 228 CD1 TYR A 32 52.105 1.864 4.739 1.00 37.66 C ANISOU 228 CD1 TYR A 32 2497 2615 9197 139 -212 881 C ATOM 229 CD2 TYR A 32 54.250 2.401 3.839 1.00 42.39 C ANISOU 229 CD2 TYR A 32 2925 3158 10025 118 -126 1001 C ATOM 230 CE1 TYR A 32 52.631 0.694 5.306 1.00 38.16 C ANISOU 230 CE1 TYR A 32 2519 2674 9306 139 -240 919 C ATOM 231 CE2 TYR A 32 54.782 1.261 4.405 1.00 53.72 C ANISOU 231 CE2 TYR A 32 4325 4588 11496 125 -150 1030 C ATOM 232 CZ TYR A 32 53.964 0.404 5.138 1.00 48.10 C ANISOU 232 CZ TYR A 32 3680 3899 10697 134 -210 989 C ATOM 233 OH TYR A 32 54.493 -0.731 5.710 1.00 39.88 O ANISOU 233 OH TYR A 32 2602 2845 9705 138 -246 1027 O ATOM 234 N VAL A 33 51.508 6.424 5.042 1.00 37.59 N ANISOU 234 N VAL A 33 2583 2522 9176 50 -434 834 N ATOM 235 CA VAL A 33 51.638 7.305 6.192 1.00 38.32 C ANISOU 235 CA VAL A 33 2698 2597 9264 -5 -604 821 C ATOM 236 C VAL A 33 50.335 7.360 6.960 1.00 37.21 C ANISOU 236 C VAL A 33 2680 2513 8947 20 -672 717 C ATOM 237 O VAL A 33 50.308 7.175 8.184 1.00 48.71 O ANISOU 237 O VAL A 33 4137 4000 10370 -1 -791 703 O ATOM 238 CB VAL A 33 52.078 8.716 5.745 1.00 46.19 C ANISOU 238 CB VAL A 33 3701 3531 10320 -56 -641 844 C ATOM 239 CG1 VAL A 33 51.797 9.733 6.846 1.00 38.90 C ANISOU 239 CG1 VAL A 33 2854 2584 9342 -94 -817 786 C ATOM 240 CG2 VAL A 33 53.544 8.721 5.372 1.00 39.71 C ANISOU 240 CG2 VAL A 33 2733 2673 9682 -103 -618 965 C ATOM 241 N TYR A 34 49.234 7.642 6.252 1.00 39.01 N ANISOU 241 N TYR A 34 3005 2764 9054 63 -599 646 N ATOM 242 CA TYR A 34 47.926 7.701 6.913 1.00 40.35 C ANISOU 242 CA TYR A 34 3279 3005 9046 95 -651 548 C ATOM 243 C TYR A 34 47.570 6.377 7.589 1.00 35.40 C ANISOU 243 C TYR A 34 2636 2455 8359 108 -653 551 C ATOM 244 O TYR A 34 46.977 6.374 8.671 1.00 38.06 O ANISOU 244 O TYR A 34 3013 2860 8586 105 -750 503 O ATOM 245 CB TYR A 34 46.839 8.093 5.914 1.00 35.07 C ANISOU 245 CB TYR A 34 2702 2354 8270 142 -559 488 C ATOM 246 CG TYR A 34 46.846 9.543 5.548 1.00 37.42 C ANISOU 246 CG TYR A 34 3048 2585 8584 130 -602 464 C ATOM 247 CD1 TYR A 34 46.850 10.516 6.525 1.00 55.42 C ANISOU 247 CD1 TYR A 34 5370 4841 10848 113 -752 414 C ATOM 248 CD2 TYR A 34 46.851 9.944 4.215 1.00 36.30 C ANISOU 248 CD2 TYR A 34 2916 2402 8473 134 -499 492 C ATOM 249 CE1 TYR A 34 46.839 11.870 6.192 1.00 62.75 C ANISOU 249 CE1 TYR A 34 6353 5688 11799 103 -807 390 C ATOM 250 CE2 TYR A 34 46.844 11.277 3.863 1.00 39.00 C ANISOU 250 CE2 TYR A 34 3307 2675 8837 116 -550 481 C ATOM 251 CZ TYR A 34 46.839 12.243 4.857 1.00 59.19 C ANISOU 251 CZ TYR A 34 5910 5192 11387 102 -708 430 C ATOM 252 OH TYR A 34 46.837 13.583 4.532 1.00 58.77 O ANISOU 252 OH TYR A 34 5914 5050 11364 85 -776 418 O ATOM 253 N LEU A 35 47.919 5.241 6.974 1.00 35.26 N ANISOU 253 N LEU A 35 2561 2429 8408 124 -551 609 N ATOM 254 CA LEU A 35 47.623 3.957 7.623 1.00 35.05 C ANISOU 254 CA LEU A 35 2521 2458 8339 129 -569 624 C ATOM 255 C LEU A 35 48.441 3.774 8.898 1.00 53.13 C ANISOU 255 C LEU A 35 4740 4747 10700 81 -704 676 C ATOM 256 O LEU A 35 47.925 3.278 9.919 1.00 38.52 O ANISOU 256 O LEU A 35 2910 2970 8754 65 -787 664 O ATOM 257 CB LEU A 35 47.879 2.804 6.652 1.00 34.94 C ANISOU 257 CB LEU A 35 2468 2412 8394 163 -439 667 C ATOM 258 CG LEU A 35 47.794 1.383 7.197 1.00 44.02 C ANISOU 258 CG LEU A 35 3595 3586 9544 165 -462 703 C ATOM 259 CD1 LEU A 35 46.360 1.008 7.537 1.00 37.98 C ANISOU 259 CD1 LEU A 35 2926 2915 8590 167 -480 648 C ATOM 260 CD2 LEU A 35 48.343 0.418 6.179 1.00 45.13 C ANISOU 260 CD2 LEU A 35 3704 3686 9759 190 -336 733 C ATOM 261 N SER A 36 49.716 4.182 8.863 1.00 36.62 N ANISOU 261 N SER A 36 2561 2583 8772 51 -731 741 N ATOM 262 CA SER A 36 50.510 4.185 10.082 1.00 37.44 C ANISOU 262 CA SER A 36 2599 2684 8941 -4 -873 791 C ATOM 263 C SER A 36 49.868 5.032 11.170 1.00 37.46 C ANISOU 263 C SER A 36 2683 2744 8808 -33 -1006 716 C ATOM 264 O SER A 36 49.734 4.587 12.313 1.00 37.69 O ANISOU 264 O SER A 36 2708 2836 8777 -62 -1109 722 O ATOM 265 CB SER A 36 51.917 4.704 9.811 1.00 51.43 C ANISOU 265 CB SER A 36 4266 4374 10900 -39 -886 871 C ATOM 266 OG SER A 36 52.578 4.790 11.048 1.00 39.18 O ANISOU 266 OG SER A 36 2665 2827 9396 -99 -1039 914 O ATOM 267 N MET A 37 49.474 6.266 10.838 1.00 37.36 N ANISOU 267 N MET A 37 2744 2710 8742 -25 -1011 644 N ATOM 268 CA MET A 37 48.883 7.128 11.864 1.00 40.81 C ANISOU 268 CA MET A 37 3261 3195 9051 -38 -1140 556 C ATOM 269 C MET A 37 47.576 6.548 12.390 1.00 36.92 C ANISOU 269 C MET A 37 2835 2830 8364 -2 -1136 488 C ATOM 270 O MET A 37 47.283 6.617 13.597 1.00 42.64 O ANISOU 270 O MET A 37 3581 3634 8985 -24 -1249 450 O ATOM 271 CB MET A 37 48.642 8.534 11.315 1.00 46.33 C ANISOU 271 CB MET A 37 4034 3832 9737 -22 -1144 488 C ATOM 272 CG MET A 37 49.821 9.128 10.565 1.00 49.95 C ANISOU 272 CG MET A 37 4427 4172 10378 -64 -1129 566 C ATOM 273 SD MET A 37 49.341 10.634 9.670 1.00 55.27 S ANISOU 273 SD MET A 37 5199 4771 11029 -43 -1115 500 S ATOM 274 CE MET A 37 49.055 11.672 11.025 1.00 47.46 C ANISOU 274 CE MET A 37 4297 3782 9953 -58 -1308 397 C ATOM 275 N SER A 38 46.782 5.951 11.507 1.00 38.10 N ANISOU 275 N SER A 38 3012 3008 8455 46 -1008 476 N ATOM 276 CA SER A 38 45.509 5.415 11.955 1.00 36.45 C ANISOU 276 CA SER A 38 2860 2930 8060 71 -1004 423 C ATOM 277 C SER A 38 45.750 4.362 13.016 1.00 41.76 C ANISOU 277 C SER A 38 3478 3668 8721 24 -1080 486 C ATOM 278 O SER A 38 45.216 4.437 14.128 1.00 36.12 O ANISOU 278 O SER A 38 2789 3064 7870 6 -1175 446 O ATOM 279 CB SER A 38 44.738 4.833 10.775 1.00 39.01 C ANISOU 279 CB SER A 38 3216 3264 8344 117 -858 419 C ATOM 280 OG SER A 38 43.668 4.049 11.237 1.00 34.19 O ANISOU 280 OG SER A 38 2635 2780 7577 122 -860 402 O ATOM 281 N TYR A 39 46.614 3.407 12.718 1.00 44.80 N ANISOU 281 N TYR A 39 3782 3987 9252 3 -1047 588 N ATOM 282 CA TYR A 39 46.783 2.368 13.716 1.00 48.95 C ANISOU 282 CA TYR A 39 4261 4571 9768 -43 -1129 656 C ATOM 283 C TYR A 39 47.591 2.844 14.922 1.00 45.13 C ANISOU 283 C TYR A 39 3734 4092 9320 -102 -1280 680 C ATOM 284 O TYR A 39 47.445 2.274 16.010 1.00 37.73 O ANISOU 284 O TYR A 39 2782 3245 8310 -147 -1376 712 O ATOM 285 CB TYR A 39 47.343 1.122 13.040 1.00 42.42 C ANISOU 285 CB TYR A 39 3369 3668 9079 -34 -1053 749 C ATOM 286 CG TYR A 39 46.175 0.379 12.429 1.00 40.04 C ANISOU 286 CG TYR A 39 3131 3419 8661 -1 -960 722 C ATOM 287 CD1 TYR A 39 45.384 -0.466 13.198 1.00 40.38 C ANISOU 287 CD1 TYR A 39 3195 3571 8578 -34 -1017 743 C ATOM 288 CD2 TYR A 39 45.802 0.599 11.113 1.00 42.89 C ANISOU 288 CD2 TYR A 39 3536 3736 9025 53 -825 678 C ATOM 289 CE1 TYR A 39 44.267 -1.104 12.653 1.00 34.80 C ANISOU 289 CE1 TYR A 39 2547 2918 7757 -16 -943 724 C ATOM 290 CE2 TYR A 39 44.704 -0.043 10.562 1.00 34.19 C ANISOU 290 CE2 TYR A 39 2495 2685 7809 75 -750 653 C ATOM 291 CZ TYR A 39 43.942 -0.891 11.337 1.00 34.16 C ANISOU 291 CZ TYR A 39 2509 2782 7687 40 -812 676 C ATOM 292 OH TYR A 39 42.846 -1.521 10.782 1.00 36.10 O ANISOU 292 OH TYR A 39 2815 3080 7822 50 -745 660 O ATOM 293 N TYR A 40 48.363 3.926 14.796 1.00 37.82 N ANISOU 293 N TYR A 40 2796 3083 8489 -111 -1313 663 N ATOM 294 CA TYR A 40 48.902 4.531 16.007 1.00 44.74 C ANISOU 294 CA TYR A 40 3660 3980 9359 -170 -1471 660 C ATOM 295 C TYR A 40 47.782 4.963 16.949 1.00 45.96 C ANISOU 295 C TYR A 40 3903 4273 9288 -165 -1543 554 C ATOM 296 O TYR A 40 47.878 4.770 18.168 1.00 39.46 O ANISOU 296 O TYR A 40 3065 3532 8395 -217 -1664 568 O ATOM 297 CB TYR A 40 49.797 5.718 15.678 1.00 42.10 C ANISOU 297 CB TYR A 40 3314 3532 9152 -186 -1503 653 C ATOM 298 CG TYR A 40 50.136 6.522 16.894 1.00 40.92 C ANISOU 298 CG TYR A 40 3182 3402 8961 -243 -1672 618 C ATOM 299 CD1 TYR A 40 51.144 6.115 17.766 1.00 47.10 C ANISOU 299 CD1 TYR A 40 3880 4181 9835 -317 -1785 713 C ATOM 300 CD2 TYR A 40 49.448 7.691 17.178 1.00 40.45 C ANISOU 300 CD2 TYR A 40 3231 3367 8773 -219 -1723 488 C ATOM 301 CE1 TYR A 40 51.463 6.864 18.902 1.00 44.14 C ANISOU 301 CE1 TYR A 40 3530 3828 9415 -377 -1949 678 C ATOM 302 CE2 TYR A 40 49.756 8.446 18.287 1.00 43.89 C ANISOU 302 CE2 TYR A 40 3695 3816 9166 -268 -1883 442 C ATOM 303 CZ TYR A 40 50.755 8.033 19.154 1.00 45.42 C ANISOU 303 CZ TYR A 40 3808 4010 9440 -351 -1996 536 C ATOM 304 OH TYR A 40 51.023 8.813 20.264 1.00 47.53 O ANISOU 304 OH TYR A 40 4114 4295 9649 -404 -2161 482 O ATOM 305 N PHE A 41 46.706 5.550 16.409 1.00 49.72 N ANISOU 305 N PHE A 41 4466 4784 9640 -100 -1470 448 N ATOM 306 CA PHE A 41 45.627 5.984 17.298 1.00 38.29 C ANISOU 306 CA PHE A 41 3093 3482 7973 -80 -1532 339 C ATOM 307 C PHE A 41 44.741 4.839 17.806 1.00 43.30 C ANISOU 307 C PHE A 41 3717 4275 8459 -92 -1517 368 C ATOM 308 O PHE A 41 43.888 5.077 18.676 1.00 43.06 O ANISOU 308 O PHE A 41 3729 4397 8235 -84 -1572 292 O ATOM 309 CB PHE A 41 44.809 7.075 16.603 1.00 38.39 C ANISOU 309 CB PHE A 41 3195 3477 7913 -1 -1473 217 C ATOM 310 CG PHE A 41 45.568 8.368 16.488 1.00 38.66 C ANISOU 310 CG PHE A 41 3256 3378 8053 -6 -1540 175 C ATOM 311 CD1 PHE A 41 45.819 9.132 17.618 1.00 44.34 C ANISOU 311 CD1 PHE A 41 4007 4119 8720 -32 -1687 110 C ATOM 312 CD2 PHE A 41 46.104 8.773 15.287 1.00 38.78 C ANISOU 312 CD2 PHE A 41 3262 3250 8224 5 -1464 211 C ATOM 313 CE1 PHE A 41 46.576 10.315 17.546 1.00 47.01 C ANISOU 313 CE1 PHE A 41 4375 4321 9167 -50 -1768 79 C ATOM 314 CE2 PHE A 41 46.861 9.953 15.201 1.00 44.42 C ANISOU 314 CE2 PHE A 41 3996 3837 9044 -17 -1540 192 C ATOM 315 CZ PHE A 41 47.095 10.723 16.336 1.00 40.08 C ANISOU 315 CZ PHE A 41 3485 3296 8450 -46 -1697 126 C ATOM 316 N ASP A 42 44.952 3.608 17.327 1.00 44.21 N ATOM 317 CA ASP A 42 44.271 2.405 17.801 1.00 39.86 C ATOM 318 C ASP A 42 45.021 1.716 18.938 1.00 47.36 C ATOM 319 O ASP A 42 44.488 0.776 19.537 1.00 50.49 O ATOM 320 CB ASP A 42 44.071 1.436 16.620 1.00 38.65 C ATOM 321 CG ASP A 42 43.371 0.102 17.014 1.00 44.99 C ATOM 322 OD1 ASP A 42 42.237 0.142 17.559 1.00 42.10 O ATOM 323 OD2 ASP A 42 43.957 -0.991 16.743 1.00 41.64 O1-