>>6WZ5:HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 GLN A 85 ALA A 114 1 30 ATOM 421 N GLN A 85 264.410 229.993 259.419 1.00 37.69 N ATOM 422 CA GLN A 85 263.196 229.212 259.561 1.00 37.69 C ATOM 423 C GLN A 85 262.573 228.989 258.191 1.00 37.69 C ATOM 424 O GLN A 85 262.628 229.859 257.310 1.00 37.69 O ATOM 425 CB GLN A 85 262.211 229.914 260.490 1.00 37.69 C ATOM 426 CG GLN A 85 262.691 230.020 261.911 1.00 37.69 C ATOM 427 CD GLN A 85 261.618 230.501 262.856 1.00 37.69 C ATOM 428 OE1 GLN A 85 260.618 231.077 262.438 1.00 37.69 O ATOM 429 NE2 GLN A 85 261.818 230.264 264.141 1.00 37.69 N ATOM 430 N SER A 86 261.994 227.802 258.007 1.00 37.27 N ATOM 431 CA SER A 86 261.291 227.505 256.768 1.00 37.27 C ATOM 432 C SER A 86 260.211 228.539 256.504 1.00 37.27 C ATOM 433 O SER A 86 260.013 228.972 255.365 1.00 37.27 O ATOM 434 CB SER A 86 260.689 226.105 256.832 1.00 37.27 C ATOM 435 OG SER A 86 261.656 225.163 257.241 1.00 37.27 O ATOM 436 N SER A 87 259.513 228.958 257.555 1.00 36.47 N ATOM 437 CA SER A 87 258.480 229.965 257.391 1.00 36.47 C ATOM 438 C SER A 87 259.073 231.319 257.032 1.00 36.47 C ATOM 439 O SER A 87 258.432 232.097 256.328 1.00 36.47 O ATOM 440 CB SER A 87 257.636 230.054 258.655 1.00 36.47 C ATOM 441 OG SER A 87 258.459 230.186 259.794 1.00 36.47 O ATOM 442 N ALA A 88 260.294 231.614 257.475 1.00 35.58 N ATOM 443 CA ALA A 88 260.945 232.845 257.040 1.00 35.58 C ATOM 444 C ALA A 88 261.227 232.810 255.546 1.00 35.58 C ATOM 445 O ALA A 88 260.948 233.775 254.824 1.00 35.58 O ATOM 446 CB ALA A 88 262.235 233.072 257.819 1.00 35.58 C ATOM 447 N VAL A 89 261.786 231.699 255.064 1.00 35.83 N ATOM 448 CA VAL A 89 262.041 231.572 253.632 1.00 35.83 C ATOM 449 C VAL A 89 260.742 231.682 252.839 1.00 35.83 C ATOM 450 O VAL A 89 260.692 232.331 251.788 1.00 35.83 O ATOM 451 CB VAL A 89 262.777 230.254 253.337 1.00 35.83 C ATOM 452 CG1 VAL A 89 262.925 230.056 251.848 1.00 35.83 C ATOM 453 CG2 VAL A 89 264.128 230.246 254.003 1.00 35.83 C ATOM 454 N MET A 90 259.666 231.080 253.341 1.00 36.52 N ATOM 455 CA MET A 90 258.395 231.141 252.626 1.00 36.52 C ATOM 456 C MET A 90 257.803 232.546 252.639 1.00 36.52 C ATOM 457 O MET A 90 257.221 232.986 251.642 1.00 36.52 O ATOM 458 CB MET A 90 257.407 230.141 253.217 1.00 36.52 C ATOM 459 CG MET A 90 257.848 228.696 253.122 1.00 36.52 C ATOM 460 SD MET A 90 258.779 228.299 251.630 1.00 36.52 S ATOM 461 CE MET A 90 257.547 228.539 250.363 1.00 36.52 C ATOM 462 N ALA A 91 257.920 233.260 253.757 1.00 34.53 N ATOM 463 CA ALA A 91 257.450 234.637 253.803 1.00 34.53 C ATOM 464 C ALA A 91 258.212 235.504 252.818 1.00 34.53 C ATOM 465 O ALA A 91 257.621 236.349 252.137 1.00 34.53 O ATOM 466 CB ALA A 91 257.580 235.194 255.218 1.00 34.53 C ATOM 467 N LEU A 92 259.526 235.309 252.734 1.00 34.42 N ATOM 468 CA LEU A 92 260.315 236.023 251.742 1.00 34.42 C ATOM 469 C LEU A 92 259.839 235.714 250.332 1.00 34.42 C ATOM 470 O LEU A 92 259.730 236.617 249.500 1.00 34.42 O ATOM 471 CB LEU A 92 261.790 235.676 251.896 1.00 34.42 C ATOM 472 CG LEU A 92 262.526 236.442 252.987 1.00 34.42 C ATOM 473 CD1 LEU A 92 263.904 235.869 253.199 1.00 34.42 C ATOM 474 CD2 LEU A 92 262.608 237.896 252.606 1.00 34.42 C ATOM 475 N GLN A 93 259.552 234.448 250.041 1.00 35.58 N ATOM 476 CA GLN A 93 259.121 234.113 248.688 1.00 35.58 C ATOM 477 C GLN A 93 257.762 234.723 248.364 1.00 35.58 C ATOM 478 O GLN A 93 257.559 235.236 247.260 1.00 35.58 O ATOM 479 CB GLN A 93 259.097 232.601 248.494 1.00 35.58 C ATOM 480 CG GLN A 93 259.183 232.195 247.040 1.00 35.58 C ATOM 481 CD GLN A 93 259.369 230.715 246.854 1.00 35.58 C ATOM 482 OE1 GLN A 93 259.699 229.999 247.791 1.00 35.58 O ATOM 483 NE2 GLN A 93 259.152 230.244 245.639 1.00 35.58 N ATOM 484 N GLU A 94 256.824 234.684 249.311 1.00 35.69 N ATOM 485 CA GLU A 94 255.524 235.319 249.100 1.00 35.69 C ATOM 486 C GLU A 94 255.675 236.810 248.842 1.00 35.69 C ATOM 487 O GLU A 94 255.075 237.353 247.907 1.00 35.69 O ATOM 488 CB GLU A 94 254.614 235.085 250.301 1.00 35.69 C ATOM 489 CG GLU A 94 254.209 233.653 250.511 1.00 35.69 C ATOM 490 CD GLU A 94 252.973 233.267 249.732 1.00 35.69 C ATOM 491 OE1 GLU A 94 252.539 232.103 249.849 1.00 35.69 O ATOM 492 OE2 GLU A 94 252.427 234.123 249.005 1.00 35.69 O ATOM 493 N ALA A 95 256.477 237.491 249.662 1.00 33.91 N ATOM 494 CA ALA A 95 256.694 238.916 249.454 1.00 33.91 C ATOM 495 C ALA A 95 257.321 239.189 248.096 1.00 33.91 C ATOM 496 O ALA A 95 256.882 240.088 247.374 1.00 33.91 O ATOM 497 CB ALA A 95 257.570 239.484 250.565 1.00 33.91 C ATOM 498 N SER A 96 258.344 238.417 247.729 1.00 34.37 N ATOM 499 CA SER A 96 259.047 238.640 246.472 1.00 34.37 C ATOM 500 C SER A 96 258.128 238.447 245.278 1.00 34.37 C ATOM 501 O SER A 96 258.138 239.252 244.344 1.00 34.37 O ATOM 502 CB SER A 96 260.237 237.696 246.369 1.00 34.37 C ATOM 503 OG SER A 96 260.888 237.576 247.611 1.00 34.37 O ATOM 504 N GLU A 97 257.336 237.380 245.287 1.00 35.89 N ATOM 505 CA GLU A 97 256.464 237.117 244.153 1.00 35.89 C ATOM 506 C GLU A 97 255.339 238.134 244.071 1.00 35.89 C ATOM 507 O GLU A 97 254.976 238.564 242.974 1.00 35.89 O ATOM 508 CB GLU A 97 255.919 235.699 244.228 1.00 35.89 C ATOM 509 CG GLU A 97 256.990 234.661 243.989 1.00 35.89 C ATOM 510 CD GLU A 97 256.431 233.281 243.774 1.00 35.89 C ATOM 511 OE1 GLU A 97 255.203 233.165 243.576 1.00 35.89 O ATOM 512 OE2 GLU A 97 257.216 232.313 243.799 1.00 35.89 O ATOM 513 N ALA A 98 254.779 238.543 245.211 1.00 33.62 N ATOM 514 CA ALA A 98 253.787 239.610 245.187 1.00 33.62 C ATOM 515 C ALA A 98 254.375 240.895 244.620 1.00 33.62 C ATOM 516 O ALA A 98 253.742 241.575 243.800 1.00 33.62 O ATOM 517 CB ALA A 98 253.244 239.842 246.592 1.00 33.62 C ATOM 518 N TYR A 99 255.596 241.231 245.035 1.00 33.57 N ATOM 519 CA TYR A 99 256.262 242.425 244.538 1.00 33.57 C ATOM 520 C TYR A 99 256.470 242.351 243.033 1.00 33.57 C ATOM 521 O TYR A 99 256.178 243.307 242.308 1.00 33.57 O ATOM 522 CB TYR A 99 257.592 242.604 245.263 1.00 33.57 C ATOM 523 CG TYR A 99 258.429 243.731 244.738 1.00 33.57 C ATOM 524 CD1 TYR A 99 258.115 245.039 245.036 1.00 33.57 C ATOM 525 CD2 TYR A 99 259.533 243.487 243.941 1.00 33.57 C ATOM 526 CE1 TYR A 99 258.869 246.068 244.563 1.00 33.57 C ATOM 527 CE2 TYR A 99 260.294 244.513 243.463 1.00 33.57 C ATOM 528 CZ TYR A 99 259.958 245.803 243.777 1.00 33.57 C ATOM 529 OH TYR A 99 260.719 246.838 243.298 1.00 33.57 O ATOM 530 N LEU A 100 256.952 241.213 242.542 1.00 32.48 N ATOM 531 CA LEU A 100 257.216 241.090 241.114 1.00 32.48 C ATOM 532 C LEU A 100 255.929 241.105 240.303 1.00 32.48 C ATOM 533 O LEU A 100 255.892 241.680 239.215 1.00 32.48 O ATOM 534 CB LEU A 100 258.019 239.828 240.827 1.00 32.48 C ATOM 535 CG LEU A 100 259.488 239.906 241.235 1.00 32.48 C ATOM 536 CD1 LEU A 100 260.229 238.650 240.844 1.00 32.48 C ATOM 537 CD2 LEU A 100 260.139 241.122 240.620 1.00 32.48 C ATOM 538 N VAL A 101 254.859 240.499 240.814 1.00 32.68 N ATOM 539 CA VAL A 101 253.603 240.484 240.074 1.00 32.68 C ATOM 540 C VAL A 101 253.022 241.887 239.980 1.00 32.68 C ATOM 541 O VAL A 101 252.549 242.307 238.915 1.00 32.68 O ATOM 542 CB VAL A 101 252.615 239.492 240.712 1.00 32.68 C ATOM 543 CG1 VAL A 101 251.246 239.622 240.094 1.00 32.68 C ATOM 544 CG2 VAL A 101 253.115 238.083 240.544 1.00 32.68 C ATOM 545 N ALA A 102 253.055 242.645 241.077 1.00 33.18 N ATOM 546 CA ALA A 102 252.574 244.021 241.008 1.00 33.18 C ATOM 547 C ALA A 102 253.449 244.861 240.085 1.00 33.18 C ATOM 548 O ALA A 102 252.949 245.720 239.344 1.00 33.18 O ATOM 549 CB ALA A 102 252.517 244.631 242.404 1.00 33.18 C ATOM 550 N LEU A 103 254.759 244.620 240.110 1.00 33.06 N ATOM 551 CA LEU A 103 255.657 245.340 239.222 1.00 33.06 C ATOM 552 C LEU A 103 255.367 245.028 237.762 1.00 33.06 C ATOM 553 O LEU A 103 255.447 245.911 236.907 1.00 33.06 O ATOM 554 CB LEU A 103 257.104 245.003 239.560 1.00 33.06 C ATOM 555 CG LEU A 103 258.123 245.745 238.706 1.00 33.06 C ATOM 556 CD1 LEU A 103 257.866 247.232 238.765 1.00 33.06 C ATOM 557 CD2 LEU A 103 259.510 245.431 239.179 1.00 33.06 C ATOM 558 N PHE A 104 255.021 243.779 237.456 1.00 33.04 N ATOM 559 CA PHE A 104 254.688 243.427 236.083 1.00 33.04 C ATOM 560 C PHE A 104 253.355 244.012 235.657 1.00 33.04 C ATOM 561 O PHE A 104 253.191 244.360 234.490 1.00 33.04 O ATOM 562 CB PHE A 104 254.684 241.914 235.901 1.00 33.04 C ATOM 563 CG PHE A 104 256.040 241.338 235.670 1.00 33.04 C ATOM 564 CD1 PHE A 104 256.859 241.840 234.685 1.00 33.04 C ATOM 565 CD2 PHE A 104 256.506 240.308 236.456 1.00 33.04 C ATOM 566 CE1 PHE A 104 258.107 241.317 234.482 1.00 33.04 C ATOM 567 CE2 PHE A 104 257.749 239.782 236.257 1.00 33.04 C ATOM 568 CZ PHE A 104 258.553 240.286 235.269 1.00 33.04 C ATOM 569 N GLU A 105 252.402 244.146 236.578 1.00 34.84 N ATOM 570 CA GLU A 105 251.175 244.873 236.257 1.00 34.84 C ATOM 571 C GLU A 105 251.472 246.318 235.866 1.00 34.84 C ATOM 572 O GLU A 105 250.989 246.816 234.838 1.00 34.84 O ATOM 573 CB GLU A 105 250.212 244.821 237.438 1.00 34.84 C ATOM 574 CG GLU A 105 249.367 243.579 237.460 1.00 34.84 C ATOM 575 CD GLU A 105 248.691 243.354 238.794 1.00 34.84 C ATOM 576 OE1 GLU A 105 248.882 242.271 239.384 1.00 34.84 O ATOM 577 OE2 GLU A 105 247.972 244.263 239.258 1.00 34.84 O ATOM 578 N ASP A 106 252.280 247.008 236.673 1.00 35.64 N ATOM 579 CA ASP A 106 252.616 248.392 236.344 1.00 35.64 C ATOM 580 C ASP A 106 253.418 248.480 235.049 1.00 35.64 C ATOM 581 O ASP A 106 253.244 249.415 234.258 1.00 35.64 O ATOM 582 CB ASP A 106 253.381 249.035 237.495 1.00 35.64 C ATOM 583 CG ASP A 106 252.523 249.229 238.723 1.00 35.64 C ATOM 584 OD1 ASP A 106 251.288 249.100 238.607 1.00 35.64 O ATOM 585 OD2 ASP A 106 253.077 249.512 239.804 1.00 35.64 O ATOM 586 N THR A 107 254.300 247.512 234.814 1.00 34.30 N ATOM 587 CA THR A 107 255.080 247.480 233.586 1.00 34.30 C ATOM 588 C THR A 107 254.192 247.259 232.369 1.00 34.30 C ATOM 589 O THR A 107 254.407 247.863 231.315 1.00 34.30 O ATOM 590 CB THR A 107 256.136 246.384 233.700 1.00 34.30 C ATOM 591 OG1 THR A 107 257.041 246.717 234.754 1.00 34.30 O ATOM 592 CG2 THR A 107 256.900 246.221 232.415 1.00 34.30 C ATOM 593 N ASN A 108 253.184 246.401 232.502 1.00 33.64 N ATOM 594 CA ASN A 108 252.232 246.180 231.424 1.00 33.64 C ATOM 595 C ASN A 108 251.464 247.454 231.108 1.00 33.64 C ATOM 596 O ASN A 108 251.220 247.770 229.939 1.00 33.64 O ATOM 597 CB ASN A 108 251.281 245.054 231.818 1.00 33.64 C ATOM 598 CG ASN A 108 250.655 244.373 230.633 1.00 33.64 C ATOM 599 OD1 ASN A 108 251.220 244.339 229.550 1.00 33.64 O ATOM 600 ND2 ASN A 108 249.480 243.808 230.841 1.00 33.64 N ATOM 601 N LEU A 109 251.084 248.208 232.140 1.00 33.76 N ATOM 602 CA LEU A 109 250.430 249.489 231.887 1.00 33.76 C ATOM 603 C LEU A 109 251.361 250.451 231.162 1.00 33.76 C ATOM 604 O LEU A 109 250.937 251.173 230.253 1.00 33.76 O ATOM 605 CB LEU A 109 249.940 250.106 233.191 1.00 33.76 C ATOM 606 CG LEU A 109 248.774 249.364 233.825 1.00 33.76 C ATOM 607 CD1 LEU A 109 248.222 250.160 234.971 1.00 33.76 C ATOM 608 CD2 LEU A 109 247.705 249.101 232.796 1.00 33.76 C ATOM 609 N CYS A 110 252.633 250.481 231.554 1.00 35.18 N ATOM 610 CA CYS A 110 253.590 251.345 230.871 1.00 35.18 C ATOM 611 C CYS A 110 253.752 250.950 229.411 1.00 35.18 C ATOM 612 O CYS A 110 253.870 251.812 228.537 1.00 35.18 O ATOM 613 CB CYS A 110 254.941 251.305 231.578 1.00 35.18 C ATOM 614 SG CYS A 110 254.944 252.061 233.199 1.00 35.18 S ATOM 615 N ALA A 111 253.783 249.649 229.131 1.00 34.71 N ATOM 616 CA ALA A 111 253.967 249.196 227.758 1.00 34.71 C ATOM 617 C ALA A 111 252.749 249.519 226.907 1.00 34.71 C ATOM 618 O ALA A 111 252.885 250.001 225.780 1.00 34.71 O ATOM 619 CB ALA A 111 254.266 247.701 227.733 1.00 34.71 C ATOM 620 N ILE A 112 251.550 249.286 227.441 1.00 34.89 N ATOM 621 CA ILE A 112 250.333 249.630 226.714 1.00 34.89 C ATOM 622 C ILE A 112 250.250 251.133 226.479 1.00 34.89 C ATOM 623 O ILE A 112 249.765 251.586 225.437 1.00 34.89 O ATOM 624 CB ILE A 112 249.102 249.099 227.464 1.00 34.89 C ATOM 625 CG1 ILE A 112 249.103 247.575 227.455 1.00 34.89 C ATOM 626 CG2 ILE A 112 247.837 249.613 226.840 1.00 34.89 C ATOM 627 CD1 ILE A 112 248.080 246.980 228.355 1.00 34.89 C ATOM 628 N HIS A 113 250.739 251.930 227.431 1.00 34.89 N ATOM 629 CA HIS A 113 250.767 253.378 227.247 1.00 34.89 C ATOM 630 C HIS A 113 251.588 253.777 226.029 1.00 34.89 C ATOM 631 O HIS A 113 251.218 254.709 225.313 1.00 34.89 O ATOM 632 CB HIS A 113 251.327 254.049 228.500 1.00 34.89 C ATOM 633 CG HIS A 113 251.220 255.540 228.492 1.00 34.89 C ATOM 634 ND1 HIS A 113 250.068 256.203 228.852 1.00 34.89 N ATOM 635 CD2 HIS A 113 252.122 256.497 228.180 1.00 34.89 C ATOM 636 CE1 HIS A 113 250.263 257.504 228.757 1.00 34.89 C ATOM 637 NE2 HIS A 113 251.501 257.709 228.351 1.00 34.89 N ATOM 638 N ALA A 114 252.699 253.091 225.780 1.00 35.42 N ATOM 639 CA ALA A 114 253.530 253.341 224.614 1.00 35.42 C ATOM 640 C ALA A 114 253.070 252.566 223.388 1.00 35.42 C ATOM 641 O ALA A 114 253.874 252.332 222.482 1.00 35.42 O ATOM 642 CB ALA A 114 254.987 253.008 224.924 1.00 35.42 C