>>6WZ5:HELIX   34 AD7 SER H   52  ASN H   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 AD7 SER H 52 ASN H 81 1 30 ATOM 5633 N SER H 52 239.937 227.901 257.223 1.00 38.62 N ATOM 5634 CA SER H 52 241.181 227.176 257.368 1.00 38.62 C ATOM 5635 C SER H 52 242.124 227.935 258.292 1.00 38.62 C ATOM 5636 O SER H 52 241.917 229.108 258.608 1.00 38.62 O ATOM 5637 CB SER H 52 241.833 226.956 256.011 1.00 38.62 C ATOM 5638 OG SER H 52 242.256 228.183 255.461 1.00 38.62 O ATOM 5639 N SER H 53 243.176 227.249 258.727 1.00 37.72 N ATOM 5640 CA SER H 53 244.084 227.871 259.679 1.00 37.72 C ATOM 5641 C SER H 53 244.916 228.967 259.030 1.00 37.72 C ATOM 5642 O SER H 53 245.277 229.935 259.700 1.00 37.72 O ATOM 5643 CB SER H 53 244.987 226.823 260.317 1.00 37.72 C ATOM 5644 OG SER H 53 245.919 226.320 259.386 1.00 37.72 O ATOM 5645 N LYS H 54 245.219 228.849 257.737 1.00 36.70 N ATOM 5646 CA LYS H 54 245.938 229.921 257.056 1.00 36.70 C ATOM 5647 C LYS H 54 245.091 231.179 256.960 1.00 36.70 C ATOM 5648 O LYS H 54 245.567 232.281 257.256 1.00 36.70 O ATOM 5649 CB LYS H 54 246.371 229.471 255.665 1.00 36.70 C ATOM 5650 CG LYS H 54 247.650 228.672 255.638 1.00 36.70 C ATOM 5651 CD LYS H 54 248.831 229.484 256.143 1.00 36.70 C ATOM 5652 CE LYS H 54 249.056 230.726 255.298 1.00 36.70 C ATOM 5653 NZ LYS H 54 250.453 231.233 255.404 1.00 36.70 N ATOM 5654 N ALA H 55 243.836 231.036 256.539 1.00 35.41 N ATOM 5655 CA ALA H 55 242.931 232.175 256.533 1.00 35.41 C ATOM 5656 C ALA H 55 242.740 232.744 257.932 1.00 35.41 C ATOM 5657 O ALA H 55 242.627 233.961 258.089 1.00 35.41 O ATOM 5658 CB ALA H 55 241.592 231.778 255.925 1.00 35.41 C ATOM 5659 N MET H 56 242.736 231.895 258.958 1.00 35.48 N ATOM 5660 CA MET H 56 242.593 232.398 260.319 1.00 35.48 C ATOM 5661 C MET H 56 243.832 233.168 260.754 1.00 35.48 C ATOM 5662 O MET H 56 243.731 234.171 261.463 1.00 35.48 O ATOM 5663 CB MET H 56 242.311 231.249 261.279 1.00 35.48 C ATOM 5664 CG MET H 56 242.127 231.699 262.707 1.00 35.48 C ATOM 5665 SD MET H 56 240.822 232.920 262.880 1.00 35.48 S ATOM 5666 CE MET H 56 239.386 231.871 262.880 1.00 35.48 C ATOM 5667 N SER H 57 245.007 232.712 260.337 1.00 34.74 N ATOM 5668 CA SER H 57 246.233 233.453 260.598 1.00 34.74 C ATOM 5669 C SER H 57 246.199 234.818 259.925 1.00 34.74 C ATOM 5670 O SER H 57 246.615 235.822 260.514 1.00 34.74 O ATOM 5671 CB SER H 57 247.427 232.638 260.113 1.00 34.74 C ATOM 5672 OG SER H 57 248.647 233.243 260.473 1.00 34.74 O ATOM 5673 N ILE H 58 245.704 234.873 258.690 1.00 33.72 N ATOM 5674 CA ILE H 58 245.570 236.154 258.002 1.00 33.72 C ATOM 5675 C ILE H 58 244.602 237.064 258.741 1.00 33.72 C ATOM 5676 O ILE H 58 244.860 238.260 258.905 1.00 33.72 O ATOM 5677 CB ILE H 58 245.133 235.937 256.546 1.00 33.72 C ATOM 5678 CG1 ILE H 58 246.273 235.313 255.760 1.00 33.72 C ATOM 5679 CG2 ILE H 58 244.723 237.246 255.913 1.00 33.72 C ATOM 5680 CD1 ILE H 58 245.860 234.743 254.480 1.00 33.72 C ATOM 5681 N MET H 59 243.478 236.515 259.201 1.00 34.48 N ATOM 5682 CA MET H 59 242.500 237.317 259.932 1.00 34.48 C ATOM 5683 C MET H 59 243.063 237.811 261.252 1.00 34.48 C ATOM 5684 O MET H 59 242.771 238.929 261.684 1.00 34.48 O ATOM 5685 CB MET H 59 241.230 236.508 260.174 1.00 34.48 C ATOM 5686 CG MET H 59 240.370 236.353 258.957 1.00 34.48 C ATOM 5687 SD MET H 59 239.890 237.925 258.239 1.00 34.48 S ATOM 5688 CE MET H 59 239.082 238.699 259.627 1.00 34.48 C ATOM 5689 N ASN H 60 243.875 236.990 261.903 1.00 34.25 N ATOM 5690 CA ASN H 60 244.519 237.395 263.140 1.00 34.25 C ATOM 5691 C ASN H 60 245.491 238.541 262.904 1.00 34.25 C ATOM 5692 O ASN H 60 245.488 239.532 263.647 1.00 34.25 O ATOM 5693 CB ASN H 60 245.229 236.192 263.749 1.00 34.25 C ATOM 5694 CG ASN H 60 245.683 236.437 265.151 1.00 34.25 C ATOM 5695 OD1 ASN H 60 244.872 236.555 266.061 1.00 34.25 O ATOM 5696 ND2 ASN H 60 246.987 236.505 265.345 1.00 34.25 N ATOM 5697 N SER H 61 246.319 238.438 261.867 1.00 33.40 N ATOM 5698 CA SER H 61 247.240 239.532 261.598 1.00 33.40 C ATOM 5699 C SER H 61 246.505 240.774 261.119 1.00 33.40 C ATOM 5700 O SER H 61 246.979 241.883 261.348 1.00 33.40 O ATOM 5701 CB SER H 61 248.312 239.109 260.598 1.00 33.40 C ATOM 5702 OG SER H 61 247.760 238.491 259.465 1.00 33.40 O ATOM 5703 N PHE H 62 245.330 240.617 260.512 1.00 33.40 N ATOM 5704 CA PHE H 62 244.527 241.777 260.138 1.00 33.40 C ATOM 5705 C PHE H 62 243.960 242.482 261.364 1.00 33.40 C ATOM 5706 O PHE H 62 243.987 243.715 261.452 1.00 33.40 O ATOM 5707 CB PHE H 62 243.398 241.360 259.200 1.00 33.40 C ATOM 5708 CG PHE H 62 242.314 242.382 259.074 1.00 33.40 C ATOM 5709 CD1 PHE H 62 242.513 243.530 258.340 1.00 33.40 C ATOM 5710 CD2 PHE H 62 241.098 242.198 259.700 1.00 33.40 C ATOM 5711 CE1 PHE H 62 241.525 244.472 258.225 1.00 33.40 C ATOM 5712 CE2 PHE H 62 240.103 243.138 259.591 1.00 33.40 C ATOM 5713 CZ PHE H 62 240.317 244.280 258.852 1.00 33.40 C ATOM 5714 N VAL H 63 243.420 241.718 262.313 1.00 33.73 N ATOM 5715 CA VAL H 63 242.925 242.329 263.542 1.00 33.73 C ATOM 5716 C VAL H 63 244.057 243.042 264.263 1.00 33.73 C ATOM 5717 O VAL H 63 243.890 244.163 264.751 1.00 33.73 O ATOM 5718 CB VAL H 63 242.253 241.279 264.446 1.00 33.73 C ATOM 5719 CG1 VAL H 63 241.793 241.918 265.737 1.00 33.73 C ATOM 5720 CG2 VAL H 63 241.081 240.649 263.747 1.00 33.73 C ATOM 5721 N ASN H 64 245.233 242.417 264.318 1.00 34.65 N ATOM 5722 CA ASN H 64 246.363 243.037 265.000 1.00 34.65 C ATOM 5723 C ASN H 64 246.835 244.289 264.277 1.00 34.65 C ATOM 5724 O ASN H 64 247.116 245.310 264.910 1.00 34.65 O ATOM 5725 CB ASN H 64 247.502 242.036 265.134 1.00 34.65 C ATOM 5726 CG ASN H 64 247.289 241.081 266.270 1.00 34.65 C ATOM 5727 OD1 ASN H 64 246.979 241.492 267.379 1.00 34.65 O ATOM 5728 ND2 ASN H 64 247.445 239.796 266.004 1.00 34.65 N ATOM 5729 N ASP H 65 246.908 244.233 262.950 1.00 34.71 N ATOM 5730 CA ASP H 65 247.306 245.381 262.150 1.00 34.71 C ATOM 5731 C ASP H 65 246.381 246.564 262.383 1.00 34.71 C ATOM 5732 O ASP H 65 246.840 247.684 262.628 1.00 34.71 O ATOM 5733 CB ASP H 65 247.316 244.977 260.679 1.00 34.71 C ATOM 5734 CG ASP H 65 247.779 246.083 259.767 1.00 34.71 C ATOM 5735 OD1 ASP H 65 248.525 246.968 260.223 1.00 34.71 O ATOM 5736 OD2 ASP H 65 247.386 246.070 258.585 1.00 34.71 O ATOM 5737 N VAL H 66 245.070 246.333 262.312 1.00 34.21 N ATOM 5738 CA VAL H 66 244.118 247.426 262.472 1.00 34.21 C ATOM 5739 C VAL H 66 244.120 247.943 263.904 1.00 34.21 C ATOM 5740 O VAL H 66 244.011 249.154 264.137 1.00 34.21 O ATOM 5741 CB VAL H 66 242.717 246.980 262.026 1.00 34.21 C ATOM 5742 CG1 VAL H 66 241.679 247.958 262.507 1.00 34.21 C ATOM 5743 CG2 VAL H 66 242.671 246.888 260.529 1.00 34.21 C ATOM 5744 N PHE H 67 244.240 247.043 264.885 1.00 34.45 N ATOM 5745 CA PHE H 67 244.404 247.482 266.265 1.00 34.45 C ATOM 5746 C PHE H 67 245.579 248.434 266.386 1.00 34.45 C ATOM 5747 O PHE H 67 245.466 249.494 267.002 1.00 34.45 O ATOM 5748 CB PHE H 67 244.601 246.282 267.196 1.00 34.45 C ATOM 5749 CG PHE H 67 244.832 246.658 268.637 1.00 34.45 C ATOM 5750 CD1 PHE H 67 246.073 247.079 269.081 1.00 34.45 C ATOM 5751 CD2 PHE H 67 243.808 246.574 269.553 1.00 34.45 C ATOM 5752 CE1 PHE H 67 246.273 247.427 270.395 1.00 34.45 C ATOM 5753 CE2 PHE H 67 244.013 246.911 270.870 1.00 34.45 C ATOM 5754 CZ PHE H 67 245.242 247.338 271.289 1.00 34.45 C ATOM 5755 N GLU H 68 246.727 248.056 265.830 1.00 35.97 N ATOM 5756 CA GLU H 68 247.908 248.900 265.948 1.00 35.97 C ATOM 5757 C GLU H 68 247.725 250.225 265.222 1.00 35.97 C ATOM 5758 O GLU H 68 248.136 251.268 265.729 1.00 35.97 O ATOM 5759 CB GLU H 68 249.137 248.168 265.428 1.00 35.97 C ATOM 5760 CG GLU H 68 249.846 247.359 266.488 1.00 35.97 C ATOM 5761 CD GLU H 68 249.694 245.867 266.291 1.00 35.97 C ATOM 5762 OE1 GLU H 68 250.160 245.350 265.251 1.00 35.97 O ATOM 5763 OE2 GLU H 68 249.101 245.209 267.172 1.00 35.97 O ATOM 5764 N ARG H 69 247.088 250.215 264.051 1.00 34.55 N ATOM 5765 CA ARG H 69 246.865 251.471 263.341 1.00 34.55 C ATOM 5766 C ARG H 69 246.004 252.422 264.161 1.00 34.55 C ATOM 5767 O ARG H 69 246.369 253.585 264.372 1.00 34.55 O ATOM 5768 CB ARG H 69 246.215 251.220 261.985 1.00 34.55 C ATOM 5769 CG ARG H 69 247.108 250.568 260.970 1.00 34.55 C ATOM 5770 CD ARG H 69 246.528 250.734 259.590 1.00 34.55 C ATOM 5771 NE ARG H 69 246.583 249.504 258.819 1.00 34.55 N ATOM 5772 CZ ARG H 69 246.124 249.386 257.580 1.00 34.55 C ATOM 5773 NH1 ARG H 69 245.584 250.427 256.974 1.00 34.55 N ATOM 5774 NH2 ARG H 69 246.209 248.228 256.949 1.00 34.55 N ATOM 5775 N ILE H 70 244.864 251.937 264.652 1.00 33.68 N ATOM 5776 CA ILE H 70 243.959 252.805 265.394 1.00 33.68 C ATOM 5777 C ILE H 70 244.586 253.232 266.711 1.00 33.68 C ATOM 5778 O ILE H 70 244.472 254.390 267.120 1.00 33.68 O ATOM 5779 CB ILE H 70 242.601 252.114 265.601 1.00 33.68 C ATOM 5780 CG1 ILE H 70 241.950 251.841 264.251 1.00 33.68 C ATOM 5781 CG2 ILE H 70 241.687 252.974 266.442 1.00 33.68 C ATOM 5782 CD1 ILE H 70 240.674 251.089 264.342 1.00 33.68 C ATOM 5783 N ALA H 71 245.264 252.314 267.393 1.00 34.25 N ATOM 5784 CA ALA H 71 245.859 252.655 268.674 1.00 34.25 C ATOM 5785 C ALA H 71 246.984 253.663 268.509 1.00 34.25 C ATOM 5786 O ALA H 71 247.101 254.591 269.309 1.00 34.25 O ATOM 5787 CB ALA H 71 246.350 251.394 269.374 1.00 34.25 C ATOM 5788 N GLY H 72 247.810 253.517 267.472 1.00 34.21 N ATOM 5789 CA GLY H 72 248.857 254.494 267.232 1.00 34.21 C ATOM 5790 C GLY H 72 248.313 255.860 266.871 1.00 34.21 C ATOM 5791 O GLY H 72 248.838 256.885 267.316 1.00 34.21 O ATOM 5792 N GLU H 73 247.255 255.900 266.060 1.00 34.88 N ATOM 5793 CA GLU H 73 246.677 257.194 265.723 1.00 34.88 C ATOM 5794 C GLU H 73 246.032 257.847 266.938 1.00 34.88 C ATOM 5795 O GLU H 73 246.145 259.059 267.120 1.00 34.88 O ATOM 5796 CB GLU H 73 245.673 257.052 264.587 1.00 34.88 C ATOM 5797 CG GLU H 73 245.108 258.379 264.120 1.00 34.88 C ATOM 5798 CD GLU H 73 246.191 259.408 263.832 1.00 34.88 C ATOM 5799 OE1 GLU H 73 247.100 259.110 263.032 1.00 34.88 O ATOM 5800 OE2 GLU H 73 246.140 260.513 264.411 1.00 34.88 O ATOM 5801 N ALA H 74 245.371 257.065 267.789 1.00 34.17 N ATOM 5802 CA ALA H 74 244.817 257.623 269.016 1.00 34.17 C ATOM 5803 C ALA H 74 245.923 258.108 269.947 1.00 34.17 C ATOM 5804 O ALA H 74 245.786 259.147 270.599 1.00 34.17 O ATOM 5805 CB ALA H 74 243.935 256.588 269.707 1.00 34.17 C ATOM 5806 N SER H 75 247.034 257.377 270.000 1.00 34.14 N ATOM 5807 CA SER H 75 248.168 257.781 270.819 1.00 34.14 C ATOM 5808 C SER H 75 248.715 259.131 270.375 1.00 34.14 C ATOM 5809 O SER H 75 248.932 260.031 271.197 1.00 34.14 O ATOM 5810 CB SER H 75 249.250 256.707 270.751 1.00 34.14 C ATOM 5811 OG SER H 75 250.445 257.143 271.360 1.00 34.14 O ATOM 5812 N ARG H 76 248.938 259.300 269.074 1.00 34.87 N ATOM 5813 CA ARG H 76 249.478 260.582 268.649 1.00 34.87 C ATOM 5814 C ARG H 76 248.428 261.685 268.662 1.00 34.87 C ATOM 5815 O ARG H 76 248.793 262.846 268.812 1.00 34.87 O ATOM 5816 CB ARG H 76 250.160 260.467 267.286 1.00 34.87 C ATOM 5817 CG ARG H 76 249.281 260.233 266.104 1.00 34.87 C ATOM 5818 CD ARG H 76 250.154 260.001 264.878 1.00 34.87 C ATOM 5819 NE ARG H 76 250.919 258.769 265.000 1.00 34.87 N ATOM 5820 CZ ARG H 76 250.544 257.611 264.471 1.00 34.87 C ATOM 5821 NH1 ARG H 76 249.422 257.535 263.776 1.00 34.87 N ATOM 5822 NH2 ARG H 76 251.290 256.531 264.638 1.00 34.87 N ATOM 5823 N LEU H 77 247.138 261.359 268.580 1.00 34.89 N ATOM 5824 CA LEU H 77 246.106 262.364 268.823 1.00 34.89 C ATOM 5825 C LEU H 77 246.181 262.896 270.244 1.00 34.89 C ATOM 5826 O LEU H 77 246.178 264.113 270.470 1.00 34.89 O ATOM 5827 CB LEU H 77 244.726 261.774 268.574 1.00 34.89 C ATOM 5828 CG LEU H 77 244.168 261.820 267.168 1.00 34.89 C ATOM 5829 CD1 LEU H 77 242.986 260.892 267.092 1.00 34.89 C ATOM 5830 CD2 LEU H 77 243.774 263.234 266.837 1.00 34.89 C ATOM 5831 N ALA H 78 246.226 261.988 271.219 1.00 35.94 N ATOM 5832 CA ALA H 78 246.359 262.399 272.609 1.00 35.94 C ATOM 5833 C ALA H 78 247.623 263.217 272.822 1.00 35.94 C ATOM 5834 O ALA H 78 247.620 264.185 273.584 1.00 35.94 O ATOM 5835 CB ALA H 78 246.352 261.176 273.520 1.00 35.94 C ATOM 5836 N HIS H 79 248.713 262.849 272.153 1.00 37.56 N ATOM 5837 CA HIS H 79 249.938 263.629 272.289 1.00 37.56 C ATOM 5838 C HIS H 79 249.799 265.011 271.657 1.00 37.56 C ATOM 5839 O HIS H 79 250.261 266.003 272.227 1.00 37.56 O ATOM 5840 CB HIS H 79 251.111 262.877 271.673 1.00 37.56 C ATOM 5841 CG HIS H 79 252.401 263.627 271.738 1.00 37.56 C ATOM 5842 ND1 HIS H 79 253.192 263.649 272.866 1.00 37.56 N ATOM 5843 CD2 HIS H 79 253.033 264.393 270.820 1.00 37.56 C ATOM 5844 CE1 HIS H 79 254.259 264.392 272.637 1.00 37.56 C ATOM 5845 NE2 HIS H 79 254.186 264.857 271.404 1.00 37.56 N ATOM 5846 N TYR H 80 249.169 265.097 270.482 1.00 36.02 N ATOM 5847 CA TYR H 80 248.978 266.386 269.827 1.00 36.02 C ATOM 5848 C TYR H 80 248.174 267.324 270.703 1.00 36.02 C ATOM 5849 O TYR H 80 248.462 268.522 270.774 1.00 36.02 O ATOM 5850 CB TYR H 80 248.257 266.220 268.490 1.00 36.02 C ATOM 5851 CG TYR H 80 248.998 265.465 267.420 1.00 36.02 C ATOM 5852 CD1 TYR H 80 250.361 265.276 267.490 1.00 36.02 C ATOM 5853 CD2 TYR H 80 248.320 264.943 266.333 1.00 36.02 C ATOM 5854 CE1 TYR H 80 251.028 264.587 266.510 1.00 36.02 C ATOM 5855 CE2 TYR H 80 248.978 264.251 265.351 1.00 36.02 C ATOM 5856 CZ TYR H 80 250.332 264.075 265.444 1.00 36.02 C ATOM 5857 OH TYR H 80 251.000 263.387 264.465 1.00 36.02 O ATOM 5858 N ASN H 81 247.150 266.805 271.363 1.00 37.00 N ATOM 5859 CA ASN H 81 246.294 267.629 272.195 1.00 37.00 C ATOM 5860 C ASN H 81 246.765 267.690 273.637 1.00 37.00 C ATOM 5861 O ASN H 81 246.034 268.193 274.492 1.00 37.00 O ATOM 5862 CB ASN H 81 244.862 267.120 272.109 1.00 37.00 C ATOM 5863 CG ASN H 81 244.314 267.208 270.708 1.00 37.00 C ATOM 5864 OD1 ASN H 81 243.799 268.240 270.301 1.00 37.00 O ATOM 5865 ND2 ASN H 81 244.444 266.132 269.953 1.00 37.00 N