>>6YOV:HELIX   33 AD6 SER H   56  ASN H   85  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 33 AD6 SER H 56 ASN H 85 1 30 ATOM 5466 N SER H 56 125.387 104.793 133.099 1.00113.37 N ATOM 5467 CA SER H 56 124.230 104.740 133.986 1.00110.83 C ATOM 5468 C SER H 56 123.157 103.817 133.447 1.00102.51 C ATOM 5469 O SER H 56 123.072 103.591 132.241 1.00102.44 O ATOM 5470 CB SER H 56 123.638 106.121 134.174 1.00110.68 C ATOM 5471 OG SER H 56 123.006 106.567 133.005 1.00102.62 O ATOM 5472 N SER H 57 122.259 103.384 134.328 1.00100.96 N ATOM 5473 CA SER H 57 121.165 102.512 133.924 1.00104.65 C ATOM 5474 C SER H 57 120.214 103.214 132.972 1.00 99.70 C ATOM 5475 O SER H 57 119.641 102.589 132.077 1.00102.01 O ATOM 5476 CB SER H 57 120.401 102.051 135.145 1.00108.23 C ATOM 5477 OG SER H 57 119.773 103.132 135.776 1.00108.85 O ATOM 5478 N LYS H 58 120.107 104.524 133.110 1.00 94.93 N ATOM 5479 CA LYS H 58 119.257 105.288 132.221 1.00 96.51 C ATOM 5480 C LYS H 58 119.867 105.362 130.839 1.00 95.27 C ATOM 5481 O LYS H 58 119.179 105.168 129.836 1.00 93.67 O ATOM 5482 CB LYS H 58 119.052 106.681 132.773 1.00 97.60 C ATOM 5483 CG LYS H 58 118.176 106.748 134.006 1.00103.61 C ATOM 5484 CD LYS H 58 116.700 106.563 133.660 1.00108.90 C ATOM 5485 CE LYS H 58 115.802 106.851 134.863 1.00115.56 C ATOM 5486 NZ LYS H 58 114.354 106.717 134.529 1.00110.94 N ATOM 5487 N ALA H 59 121.175 105.567 130.788 1.00 95.73 N ATOM 5488 CA ALA H 59 121.872 105.607 129.517 1.00 95.30 C ATOM 5489 C ALA H 59 121.736 104.269 128.813 1.00 95.90 C ATOM 5490 O ALA H 59 121.635 104.211 127.587 1.00 92.46 O ATOM 5491 CB ALA H 59 123.326 105.954 129.730 1.00 98.17 C ATOM 5492 N MET H 60 121.730 103.188 129.587 1.00 96.23 N ATOM 5493 CA MET H 60 121.558 101.870 129.002 1.00 95.02 C ATOM 5494 C MET H 60 120.175 101.777 128.381 1.00 92.16 C ATOM 5495 O MET H 60 120.018 101.291 127.261 1.00 90.04 O ATOM 5496 CB MET H 60 121.740 100.784 130.057 1.00 99.09 C ATOM 5497 CG MET H 60 123.143 100.704 130.632 1.00107.58 C ATOM 5498 SD MET H 60 124.397 100.423 129.404 1.00122.64 S ATOM 5499 CE MET H 60 124.188 98.705 129.118 1.00111.62 C ATOM 5500 N GLY H 61 119.187 102.344 129.070 1.00 91.51 N ATOM 5501 CA GLY H 61 117.826 102.388 128.558 1.00 94.63 C ATOM 5502 C GLY H 61 117.763 103.154 127.244 1.00 91.36 C ATOM 5503 O GLY H 61 117.057 102.752 126.315 1.00 90.94 O ATOM 5504 N ILE H 62 118.552 104.217 127.140 1.00 88.30 N ATOM 5505 CA ILE H 62 118.593 104.986 125.908 1.00 91.26 C ATOM 5506 C ILE H 62 119.171 104.124 124.800 1.00 89.68 C ATOM 5507 O ILE H 62 118.651 104.098 123.683 1.00 87.78 O ATOM 5508 CB ILE H 62 119.471 106.250 126.046 1.00 90.94 C ATOM 5509 CG1 ILE H 62 118.929 107.227 127.112 1.00 93.00 C ATOM 5510 CG2 ILE H 62 119.609 106.952 124.701 1.00 92.40 C ATOM 5511 CD1 ILE H 62 117.547 107.760 126.860 1.00 91.84 C ATOM 5512 N MET H 63 120.244 103.407 125.116 1.00 86.90 N ATOM 5513 CA MET H 63 120.901 102.566 124.131 1.00 84.99 C ATOM 5514 C MET H 63 120.037 101.380 123.724 1.00 87.35 C ATOM 5515 O MET H 63 120.092 100.938 122.577 1.00 86.57 O ATOM 5516 CB MET H 63 122.254 102.100 124.648 1.00 86.25 C ATOM 5517 CG MET H 63 123.287 103.214 124.784 1.00 89.03 C ATOM 5518 SD MET H 63 123.516 104.161 123.268 1.00 92.65 S ATOM 5519 CE MET H 63 124.268 102.963 122.179 1.00 95.12 C ATOM 5520 N ASN H 64 119.196 100.900 124.633 1.00 86.74 N ATOM 5521 CA ASN H 64 118.297 99.810 124.286 1.00 87.12 C ATOM 5522 C ASN H 64 117.242 100.293 123.309 1.00 89.89 C ATOM 5523 O ASN H 64 116.947 99.618 122.319 1.00 88.56 O ATOM 5524 CB ASN H 64 117.646 99.233 125.523 1.00 90.08 C ATOM 5525 CG ASN H 64 118.554 98.329 126.296 1.00 99.82 C ATOM 5526 OD1 ASN H 64 119.285 97.504 125.724 1.00100.83 O ATOM 5527 ND2 ASN H 64 118.534 98.474 127.594 1.00101.15 N ATOM 5528 N SER H 65 116.763 101.515 123.512 1.00 87.88 N ATOM 5529 CA SER H 65 115.792 102.082 122.593 1.00 90.71 C ATOM 5530 C SER H 65 116.439 102.263 121.233 1.00 87.83 C ATOM 5531 O SER H 65 115.848 101.944 120.199 1.00 87.75 O ATOM 5532 CB SER H 65 115.301 103.422 123.096 1.00 93.22 C ATOM 5533 OG SER H 65 114.584 103.294 124.294 1.00 96.53 O ATOM 5534 N PHE H 66 117.693 102.694 121.247 1.00 86.15 N ATOM 5535 CA PHE H 66 118.439 102.909 120.023 1.00 86.99 C ATOM 5536 C PHE H 66 118.567 101.652 119.187 1.00 86.20 C ATOM 5537 O PHE H 66 118.268 101.662 117.991 1.00 83.89 O ATOM 5538 CB PHE H 66 119.827 103.442 120.339 1.00 86.56 C ATOM 5539 CG PHE H 66 120.720 103.394 119.184 1.00 87.20 C ATOM 5540 CD1 PHE H 66 120.546 104.254 118.139 1.00 86.08 C ATOM 5541 CD2 PHE H 66 121.735 102.462 119.126 1.00 92.09 C ATOM 5542 CE1 PHE H 66 121.359 104.186 117.038 1.00 89.11 C ATOM 5543 CE2 PHE H 66 122.551 102.389 118.029 1.00 95.83 C ATOM 5544 CZ PHE H 66 122.356 103.252 116.980 1.00 93.78 C ATOM 5545 N VAL H 67 118.993 100.561 119.806 1.00 82.94 N ATOM 5546 CA VAL H 67 119.211 99.352 119.036 1.00 82.63 C ATOM 5547 C VAL H 67 117.906 98.852 118.451 1.00 84.60 C ATOM 5548 O VAL H 67 117.863 98.425 117.296 1.00 83.84 O ATOM 5549 CB VAL H 67 119.866 98.249 119.884 1.00 87.71 C ATOM 5550 CG1 VAL H 67 119.921 96.940 119.091 1.00 94.71 C ATOM 5551 CG2 VAL H 67 121.266 98.677 120.282 1.00 90.33 C ATOM 5552 N ASN H 68 116.840 98.892 119.241 1.00 84.79 N ATOM 5553 CA ASN H 68 115.554 98.419 118.760 1.00 86.75 C ATOM 5554 C ASN H 68 115.048 99.263 117.604 1.00 87.64 C ATOM 5555 O ASN H 68 114.526 98.731 116.624 1.00 89.49 O ATOM 5556 CB ASN H 68 114.542 98.412 119.883 1.00 89.31 C ATOM 5557 CG ASN H 68 114.745 97.277 120.816 1.00 97.61 C ATOM 5558 OD1 ASN H 68 115.203 96.204 120.412 1.00 95.24 O ATOM 5559 ND2 ASN H 68 114.441 97.490 122.066 1.00104.18 N ATOM 5560 N ASP H 69 115.295 100.565 117.667 1.00 85.80 N ATOM 5561 CA ASP H 69 114.837 101.464 116.621 1.00 87.65 C ATOM 5562 C ASP H 69 115.550 101.172 115.310 1.00 87.75 C ATOM 5563 O ASP H 69 114.912 100.981 114.273 1.00 87.27 O ATOM 5564 CB ASP H 69 115.061 102.920 117.044 1.00 92.14 C ATOM 5565 CG ASP H 69 114.427 103.949 116.100 1.00 97.79 C ATOM 5566 OD1 ASP H 69 113.768 103.557 115.171 1.00 97.33 O ATOM 5567 OD2 ASP H 69 114.589 105.127 116.341 1.00 97.61 O ATOM 5568 N ILE H 70 116.871 101.066 115.361 1.00 83.37 N ATOM 5569 CA ILE H 70 117.622 100.832 114.140 1.00 82.84 C ATOM 5570 C ILE H 70 117.288 99.471 113.567 1.00 84.18 C ATOM 5571 O ILE H 70 117.135 99.322 112.353 1.00 81.78 O ATOM 5572 CB ILE H 70 119.133 100.943 114.372 1.00 82.01 C ATOM 5573 CG1 ILE H 70 119.515 102.359 114.834 1.00 85.29 C ATOM 5574 CG2 ILE H 70 119.893 100.556 113.111 1.00 82.95 C ATOM 5575 CD1 ILE H 70 119.108 103.483 113.902 1.00 90.53 C ATOM 5576 N PHE H 71 117.183 98.471 114.433 1.00 82.73 N ATOM 5577 CA PHE H 71 116.840 97.138 113.981 1.00 84.21 C ATOM 5578 C PHE H 71 115.543 97.166 113.197 1.00 86.76 C ATOM 5579 O PHE H 71 115.470 96.642 112.084 1.00 84.75 O ATOM 5580 CB PHE H 71 116.683 96.189 115.164 1.00 84.46 C ATOM 5581 CG PHE H 71 116.171 94.851 114.765 1.00 85.54 C ATOM 5582 CD1 PHE H 71 117.031 93.866 114.338 1.00 87.76 C ATOM 5583 CD2 PHE H 71 114.812 94.591 114.762 1.00 90.09 C ATOM 5584 CE1 PHE H 71 116.548 92.649 113.920 1.00 95.05 C ATOM 5585 CE2 PHE H 71 114.331 93.380 114.336 1.00 96.62 C ATOM 5586 CZ PHE H 71 115.201 92.412 113.913 1.00 99.66 C ATOM 5587 N GLU H 72 114.519 97.793 113.769 1.00 86.18 N ATOM 5588 CA GLU H 72 113.225 97.845 113.115 1.00 90.11 C ATOM 5589 C GLU H 72 113.305 98.520 111.762 1.00 88.15 C ATOM 5590 O GLU H 72 112.683 98.068 110.800 1.00 88.90 O ATOM 5591 CB GLU H 72 112.208 98.588 113.977 1.00 96.31 C ATOM 5592 CG GLU H 72 110.824 98.696 113.336 1.00107.68 C ATOM 5593 CD GLU H 72 109.804 99.415 114.192 1.00120.63 C ATOM 5594 OE1 GLU H 72 109.861 99.307 115.391 1.00118.35 O ATOM 5595 OE2 GLU H 72 108.975 100.096 113.633 1.00116.60 O ATOM 5596 N ARG H 73 114.042 99.620 111.684 1.00 84.33 N ATOM 5597 CA ARG H 73 114.099 100.368 110.441 1.00 86.43 C ATOM 5598 C ARG H 73 114.739 99.565 109.334 1.00 85.14 C ATOM 5599 O ARG H 73 114.236 99.533 108.210 1.00 84.26 O ATOM 5600 CB ARG H 73 114.923 101.616 110.600 1.00 87.39 C ATOM 5601 CG ARG H 73 114.342 102.677 111.466 1.00 90.82 C ATOM 5602 CD ARG H 73 115.243 103.836 111.521 1.00 92.53 C ATOM 5603 NE ARG H 73 114.939 104.715 112.610 1.00 93.34 N ATOM 5604 CZ ARG H 73 115.537 105.898 112.817 1.00 94.45 C ATOM 5605 NH1 ARG H 73 116.407 106.372 111.953 1.00 91.09 N ATOM 5606 NH2 ARG H 73 115.273 106.581 113.905 1.00 96.71 N ATOM 5607 N ILE H 74 115.843 98.903 109.648 1.00 80.41 N ATOM 5608 CA ILE H 74 116.548 98.164 108.623 1.00 79.26 C ATOM 5609 C ILE H 74 115.715 96.987 108.183 1.00 84.05 C ATOM 5610 O ILE H 74 115.572 96.731 106.988 1.00 83.45 O ATOM 5611 CB ILE H 74 117.927 97.693 109.098 1.00 78.56 C ATOM 5612 CG1 ILE H 74 118.830 98.905 109.344 1.00 79.62 C ATOM 5613 CG2 ILE H 74 118.537 96.792 108.037 1.00 86.42 C ATOM 5614 CD1 ILE H 74 120.112 98.586 110.071 1.00 87.30 C ATOM 5615 N ALA H 75 115.164 96.266 109.148 1.00 81.73 N ATOM 5616 CA ALA H 75 114.320 95.129 108.842 1.00 86.40 C ATOM 5617 C ALA H 75 113.097 95.573 108.049 1.00 87.07 C ATOM 5618 O ALA H 75 112.639 94.868 107.148 1.00 87.77 O ATOM 5619 CB ALA H 75 113.910 94.439 110.127 1.00 91.96 C ATOM 5620 N GLY H 76 112.571 96.745 108.389 1.00 85.23 N ATOM 5621 CA GLY H 76 111.409 97.301 107.715 1.00 88.32 C ATOM 5622 C GLY H 76 111.707 97.606 106.256 1.00 86.97 C ATOM 5623 O GLY H 76 110.939 97.243 105.362 1.00 89.11 O ATOM 5624 N GLU H 77 112.821 98.278 106.011 1.00 84.00 N ATOM 5625 CA GLU H 77 113.175 98.625 104.649 1.00 86.58 C ATOM 5626 C GLU H 77 113.535 97.371 103.870 1.00 88.62 C ATOM 5627 O GLU H 77 113.156 97.219 102.707 1.00 86.21 O ATOM 5628 CB GLU H 77 114.332 99.612 104.633 1.00 88.94 C ATOM 5629 CG GLU H 77 114.681 100.138 103.255 1.00 95.57 C ATOM 5630 CD GLU H 77 113.571 100.954 102.644 1.00102.01 C ATOM 5631 OE1 GLU H 77 112.768 101.476 103.381 1.00 98.01 O ATOM 5632 OE2 GLU H 77 113.528 101.058 101.439 1.00100.09 O ATOM 5633 N ALA H 78 114.220 96.444 104.528 1.00 85.33 N ATOM 5634 CA ALA H 78 114.585 95.196 103.885 1.00 87.40 C ATOM 5635 C ALA H 78 113.330 94.447 103.465 1.00 86.47 C ATOM 5636 O ALA H 78 113.296 93.824 102.401 1.00 86.29 O ATOM 5637 CB ALA H 78 115.438 94.356 104.813 1.00 87.95 C ATOM 5638 N SER H 79 112.285 94.548 104.281 1.00 83.87 N ATOM 5639 CA SER H 79 111.010 93.936 103.958 1.00 86.22 C ATOM 5640 C SER H 79 110.458 94.529 102.677 1.00 87.03 C ATOM 5641 O SER H 79 110.007 93.797 101.794 1.00 87.90 O ATOM 5642 CB SER H 79 110.023 94.136 105.085 1.00 89.77 C ATOM 5643 OG SER H 79 108.798 93.537 104.786 1.00 92.90 O ATOM 5644 N ARG H 80 110.530 95.854 102.551 1.00 83.96 N ATOM 5645 CA ARG H 80 110.069 96.489 101.326 1.00 86.61 C ATOM 5646 C ARG H 80 110.851 96.034 100.120 1.00 85.68 C ATOM 5647 O ARG H 80 110.279 95.834 99.052 1.00 87.04 O ATOM 5648 CB ARG H 80 110.174 97.995 101.372 1.00 90.95 C ATOM 5649 CG ARG H 80 109.124 98.697 102.158 1.00 94.43 C ATOM 5650 CD ARG H 80 109.152 100.163 101.878 1.00 97.01 C ATOM 5651 NE ARG H 80 108.094 100.860 102.563 1.00 98.00 N ATOM 5652 CZ ARG H 80 106.819 100.895 102.152 1.00 95.90 C ATOM 5653 NH1 ARG H 80 106.466 100.279 101.052 1.00 96.24 N ATOM 5654 NH2 ARG H 80 105.915 101.515 102.876 1.00 95.91 N ATOM 5655 N LEU H 81 112.156 95.890 100.270 1.00 82.91 N ATOM 5656 CA LEU H 81 112.961 95.496 99.131 1.00 83.77 C ATOM 5657 C LEU H 81 112.556 94.113 98.669 1.00 87.53 C ATOM 5658 O LEU H 81 112.416 93.863 97.468 1.00 87.19 O ATOM 5659 CB LEU H 81 114.441 95.496 99.508 1.00 86.95 C ATOM 5660 CG LEU H 81 115.060 96.861 99.807 1.00 88.81 C ATOM 5661 CD1 LEU H 81 116.439 96.653 100.378 1.00 91.39 C ATOM 5662 CD2 LEU H 81 115.134 97.696 98.537 1.00 88.51 C ATOM 5663 N ALA H 82 112.324 93.220 99.624 1.00 83.52 N ATOM 5664 CA ALA H 82 111.894 91.877 99.287 1.00 89.79 C ATOM 5665 C ALA H 82 110.515 91.905 98.651 1.00 90.41 C ATOM 5666 O ALA H 82 110.269 91.228 97.656 1.00 91.13 O ATOM 5667 CB ALA H 82 111.888 90.997 100.526 1.00 96.35 C ATOM 5668 N HIS H 83 109.634 92.745 99.174 1.00 90.35 N ATOM 5669 CA HIS H 83 108.283 92.825 98.647 1.00 93.99 C ATOM 5670 C HIS H 83 108.293 93.381 97.234 1.00 93.03 C ATOM 5671 O HIS H 83 107.705 92.810 96.317 1.00 95.58 O ATOM 5672 CB HIS H 83 107.408 93.703 99.538 1.00 94.40 C ATOM 5673 CG HIS H 83 105.987 93.746 99.108 1.00103.93 C ATOM 5674 ND1 HIS H 83 105.117 92.697 99.317 1.00107.81 N ATOM 5675 CD2 HIS H 83 105.283 94.696 98.456 1.00108.53 C ATOM 5676 CE1 HIS H 83 103.936 93.005 98.813 1.00115.62 C ATOM 5677 NE2 HIS H 83 104.010 94.213 98.288 1.00114.45 N ATOM 5678 N TYR H 84 109.006 94.479 97.052 1.00 89.97 N ATOM 5679 CA TYR H 84 109.068 95.179 95.782 1.00 92.48 C ATOM 5680 C TYR H 84 109.592 94.295 94.666 1.00 91.71 C ATOM 5681 O TYR H 84 109.070 94.312 93.552 1.00 94.40 O ATOM 5682 CB TYR H 84 109.905 96.448 95.924 1.00 93.83 C ATOM 5683 CG TYR H 84 110.128 97.191 94.640 1.00 98.44 C ATOM 5684 CD1 TYR H 84 109.064 97.479 93.805 1.00101.97 C ATOM 5685 CD2 TYR H 84 111.392 97.652 94.330 1.00 99.66 C ATOM 5686 CE1 TYR H 84 109.272 98.192 92.648 1.00103.74 C ATOM 5687 CE2 TYR H 84 111.595 98.387 93.184 1.00102.21 C ATOM 5688 CZ TYR H 84 110.541 98.650 92.342 1.00105.37 C ATOM 5689 OH TYR H 84 110.733 99.400 91.208 1.00100.30 O ATOM 5690 N ASN H 85 110.597 93.489 94.972 1.00 90.13 N ATOM 5691 CA ASN H 85 111.201 92.636 93.966 1.00 89.31 C ATOM 5692 C ASN H 85 110.558 91.258 93.940 1.00 92.24 C ATOM 5693 O ASN H 85 111.017 90.368 93.222 1.00 93.08 O ATOM 5694 CB ASN H 85 112.689 92.543 94.197 1.00 92.39 C ATOM 5695 CG ASN H 85 113.367 93.838 93.899 1.00 92.86 C ATOM 5696 OD1 ASN H 85 113.718 94.129 92.750 1.00 94.78 O ATOM 5697 ND2 ASN H 85 113.515 94.650 94.907 1.00 93.95 N