>>7CRQ:HELIX   30  30 THR H   87  ALA H  121  1                                  35    
TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 30 30 THR H 87 ALA H 121 1 35 ATOM 5922 N THR H 87 125.700 136.066 139.936 1.00 36.30 N ANISOU 5922 N THR H 87 4597 4597 4597 0 0 0 N ATOM 5923 CA THR H 87 126.117 137.244 139.198 1.00 36.30 C ANISOU 5923 CA THR H 87 4597 4597 4597 0 0 0 C ATOM 5924 C THR H 87 125.808 137.060 137.718 1.00 36.30 C ANISOU 5924 C THR H 87 4597 4597 4597 0 0 0 C ATOM 5925 O THR H 87 125.213 136.066 137.305 1.00 36.30 O ANISOU 5925 O THR H 87 4597 4597 4597 0 0 0 O ATOM 5926 CB THR H 87 127.602 137.508 139.421 1.00 36.30 C ANISOU 5926 CB THR H 87 4597 4597 4597 0 0 0 C ATOM 5927 OG1 THR H 87 128.318 136.271 139.353 1.00 36.30 O ANISOU 5927 OG1 THR H 87 4597 4597 4597 0 0 0 O ATOM 5928 CG2 THR H 87 127.820 138.119 140.781 1.00 36.30 C ANISOU 5928 CG2 THR H 87 4597 4597 4597 0 0 0 C ATOM 5929 N SER H 88 126.222 138.032 136.911 1.00 36.30 N ANISOU 5929 N SER H 88 4597 4597 4597 0 0 0 N ATOM 5930 CA SER H 88 126.011 137.946 135.473 1.00 36.30 C ANISOU 5930 CA SER H 88 4597 4597 4597 0 0 0 C ATOM 5931 C SER H 88 126.973 136.986 134.797 1.00 36.30 C ANISOU 5931 C SER H 88 4597 4597 4597 0 0 0 C ATOM 5932 O SER H 88 126.965 136.891 133.567 1.00 36.30 O ANISOU 5932 O SER H 88 4597 4597 4597 0 0 0 O ATOM 5933 CB SER H 88 126.133 139.328 134.835 1.00 36.30 C ANISOU 5933 CB SER H 88 4597 4597 4597 0 0 0 C ATOM 5934 OG SER H 88 127.429 139.862 135.006 1.00 36.30 O ANISOU 5934 OG SER H 88 4597 4597 4597 0 0 0 O ATOM 5935 N ARG H 89 127.794 136.275 135.566 1.00 36.30 N ANISOU 5935 N ARG H 89 4597 4597 4597 0 0 0 N ATOM 5936 CA ARG H 89 128.753 135.331 135.021 1.00 36.30 C ANISOU 5936 CA ARG H 89 4597 4597 4597 0 0 0 C ATOM 5937 C ARG H 89 128.312 133.883 135.157 1.00 36.30 C ANISOU 5937 C ARG H 89 4597 4597 4597 0 0 0 C ATOM 5938 O ARG H 89 128.810 133.034 134.415 1.00 36.30 O ANISOU 5938 O ARG H 89 4597 4597 4597 0 0 0 O ATOM 5939 CB ARG H 89 130.107 135.515 135.705 1.00 36.30 C ANISOU 5939 CB ARG H 89 4597 4597 4597 0 0 0 C ATOM 5940 CG ARG H 89 131.271 135.001 134.907 1.00 36.30 C ANISOU 5940 CG ARG H 89 4597 4597 4597 0 0 0 C ATOM 5941 CD ARG H 89 132.578 135.171 135.656 1.00 36.30 C ANISOU 5941 CD ARG H 89 4597 4597 4597 0 0 0 C ATOM 5942 NE ARG H 89 133.648 134.423 135.009 1.00 36.30 N ANISOU 5942 NE ARG H 89 4597 4597 4597 0 0 0 N ATOM 5943 CZ ARG H 89 134.196 133.321 135.505 1.00 36.30 C ANISOU 5943 CZ ARG H 89 4597 4597 4597 0 0 0 C ATOM 5944 NH1 ARG H 89 133.791 132.840 136.671 1.00 36.30 N ANISOU 5944 NH1 ARG H 89 4597 4597 4597 0 0 0 N ATOM 5945 NH2 ARG H 89 135.157 132.706 134.838 1.00 36.30 N ANISOU 5945 NH2 ARG H 89 4597 4597 4597 0 0 0 N ATOM 5946 N GLU H 90 127.403 133.577 136.086 1.00 36.30 N ANISOU 5946 N GLU H 90 4597 4597 4597 0 0 0 N ATOM 5947 CA GLU H 90 126.751 132.272 136.092 1.00 36.30 C ANISOU 5947 CA GLU H 90 4597 4597 4597 0 0 0 C ATOM 5948 C GLU H 90 125.632 132.196 135.064 1.00 36.30 C ANISOU 5948 C GLU H 90 4597 4597 4597 0 0 0 C ATOM 5949 O GLU H 90 125.406 131.137 134.471 1.00 36.30 O ANISOU 5949 O GLU H 90 4597 4597 4597 0 0 0 O ATOM 5950 CB GLU H 90 126.201 131.940 137.480 1.00 36.30 C ANISOU 5950 CB GLU H 90 4597 4597 4597 0 0 0 C ATOM 5951 CG GLU H 90 127.198 131.382 138.474 1.00 36.30 C ANISOU 5951 CG GLU H 90 4597 4597 4597 0 0 0 C ATOM 5952 CD GLU H 90 127.980 132.439 139.202 1.00 36.30 C ANISOU 5952 CD GLU H 90 4597 4597 4597 0 0 0 C ATOM 5953 OE1 GLU H 90 127.735 133.632 138.955 1.00 36.30 O ANISOU 5953 OE1 GLU H 90 4597 4597 4597 0 0 0 O ATOM 5954 OE2 GLU H 90 128.840 132.080 140.032 1.00 36.30 O ANISOU 5954 OE2 GLU H 90 4597 4597 4597 0 0 0 O ATOM 5955 N ILE H 91 124.903 133.293 134.860 1.00 36.30 N ANISOU 5955 N ILE H 91 4597 4597 4597 0 0 0 N ATOM 5956 CA ILE H 91 123.835 133.300 133.866 1.00 36.30 C ANISOU 5956 CA ILE H 91 4597 4597 4597 0 0 0 C ATOM 5957 C ILE H 91 124.393 133.016 132.482 1.00 36.30 C ANISOU 5957 C ILE H 91 4597 4597 4597 0 0 0 C ATOM 5958 O ILE H 91 123.799 132.258 131.704 1.00 36.30 O ANISOU 5958 O ILE H 91 4597 4597 4597 0 0 0 O ATOM 5959 CB ILE H 91 123.079 134.641 133.903 1.00 36.30 C ANISOU 5959 CB ILE H 91 4597 4597 4597 0 0 0 C ATOM 5960 CG1 ILE H 91 122.502 134.905 135.290 1.00 36.30 C ANISOU 5960 CG1 ILE H 91 4597 4597 4597 0 0 0 C ATOM 5961 CG2 ILE H 91 121.970 134.646 132.887 1.00 36.30 C ANISOU 5961 CG2 ILE H 91 4597 4597 4597 0 0 0 C ATOM 5962 CD1 ILE H 91 121.314 134.055 135.622 1.00 36.30 C ANISOU 5962 CD1 ILE H 91 4597 4597 4597 0 0 0 C ATOM 5963 N GLN H 92 125.544 133.600 132.157 1.00 36.30 N ANISOU 5963 N GLN H 92 4597 4597 4597 0 0 0 N ATOM 5964 CA GLN H 92 126.143 133.392 130.847 1.00 36.30 C ANISOU 5964 CA GLN H 92 4597 4597 4597 0 0 0 C ATOM 5965 C GLN H 92 126.537 131.941 130.626 1.00 36.30 C ANISOU 5965 C GLN H 92 4597 4597 4597 0 0 0 C ATOM 5966 O GLN H 92 126.369 131.422 129.521 1.00 36.30 O ANISOU 5966 O GLN H 92 4597 4597 4597 0 0 0 O ATOM 5967 CB GLN H 92 127.353 134.300 130.681 1.00 36.30 C ANISOU 5967 CB GLN H 92 4597 4597 4597 0 0 0 C ATOM 5968 CG GLN H 92 128.130 134.041 129.428 1.00 36.30 C ANISOU 5968 CG GLN H 92 4597 4597 4597 0 0 0 C ATOM 5969 CD GLN H 92 129.090 135.152 129.104 1.00 36.30 C ANISOU 5969 CD GLN H 92 4597 4597 4597 0 0 0 C ATOM 5970 OE1 GLN H 92 129.271 136.079 129.885 1.00 36.30 O ANISOU 5970 OE1 GLN H 92 4597 4597 4597 0 0 0 O ATOM 5971 NE2 GLN H 92 129.711 135.069 127.943 1.00 36.30 N ANISOU 5971 NE2 GLN H 92 4597 4597 4597 0 0 0 N ATOM 5972 N THR H 93 127.057 131.270 131.653 1.00 36.30 N ANISOU 5972 N THR H 93 4597 4597 4597 0 0 0 N ATOM 5973 CA THR H 93 127.441 129.871 131.511 1.00 36.30 C ANISOU 5973 CA THR H 93 4597 4597 4597 0 0 0 C ATOM 5974 C THR H 93 126.224 128.957 131.445 1.00 36.30 C ANISOU 5974 C THR H 93 4597 4597 4597 0 0 0 C ATOM 5975 O THR H 93 126.230 127.961 130.711 1.00 36.30 O ANISOU 5975 O THR H 93 4597 4597 4597 0 0 0 O ATOM 5976 CB THR H 93 128.352 129.464 132.664 1.00 36.30 C ANISOU 5976 CB THR H 93 4597 4597 4597 0 0 0 C ATOM 5977 OG1 THR H 93 129.429 130.396 132.766 1.00 36.30 O ANISOU 5977 OG1 THR H 93 4597 4597 4597 0 0 0 O ATOM 5978 CG2 THR H 93 128.924 128.094 132.427 1.00 36.30 C ANISOU 5978 CG2 THR H 93 4597 4597 4597 0 0 0 C ATOM 5979 N ALA H 94 125.171 129.278 132.199 1.00 36.30 N ANISOU 5979 N ALA H 94 4597 4597 4597 0 0 0 N ATOM 5980 CA ALA H 94 123.954 128.482 132.125 1.00 36.30 C ANISOU 5980 CA ALA H 94 4597 4597 4597 0 0 0 C ATOM 5981 C ALA H 94 123.308 128.578 130.753 1.00 36.30 C ANISOU 5981 C ALA H 94 4597 4597 4597 0 0 0 C ATOM 5982 O ALA H 94 122.771 127.585 130.248 1.00 36.30 O ANISOU 5982 O ALA H 94 4597 4597 4597 0 0 0 O ATOM 5983 CB ALA H 94 122.976 128.925 133.204 1.00 36.30 C ANISOU 5983 CB ALA H 94 4597 4597 4597 0 0 0 C ATOM 5984 N VAL H 95 123.361 129.755 130.128 1.00 36.30 N ANISOU 5984 N VAL H 95 4597 4597 4597 0 0 0 N ATOM 5985 CA VAL H 95 122.818 129.902 128.783 1.00 36.30 C ANISOU 5985 CA VAL H 95 4597 4597 4597 0 0 0 C ATOM 5986 C VAL H 95 123.557 129.003 127.800 1.00 36.30 C ANISOU 5986 C VAL H 95 4597 4597 4597 0 0 0 C ATOM 5987 O VAL H 95 122.945 128.383 126.926 1.00 36.30 O ANISOU 5987 O VAL H 95 4597 4597 4597 0 0 0 O ATOM 5988 CB VAL H 95 122.870 131.378 128.359 1.00 36.30 C ANISOU 5988 CB VAL H 95 4597 4597 4597 0 0 0 C ATOM 5989 CG1 VAL H 95 122.694 131.512 126.876 1.00 36.30 C ANISOU 5989 CG1 VAL H 95 4597 4597 4597 0 0 0 C ATOM 5990 CG2 VAL H 95 121.808 132.150 129.077 1.00 36.30 C ANISOU 5990 CG2 VAL H 95 4597 4597 4597 0 0 0 C ATOM 5991 N ARG H 96 124.876 128.889 127.946 1.00 36.30 N ANISOU 5991 N ARG H 96 4597 4597 4597 0 0 0 N ATOM 5992 CA ARG H 96 125.657 128.037 127.055 1.00 36.30 C ANISOU 5992 CA ARG H 96 4597 4597 4597 0 0 0 C ATOM 5993 C ARG H 96 125.394 126.560 127.297 1.00 36.30 C ANISOU 5993 C ARG H 96 4597 4597 4597 0 0 0 C ATOM 5994 O ARG H 96 125.316 125.788 126.338 1.00 36.30 O ANISOU 5994 O ARG H 96 4597 4597 4597 0 0 0 O ATOM 5995 CB ARG H 96 127.142 128.327 127.221 1.00 36.30 C ANISOU 5995 CB ARG H 96 4597 4597 4597 0 0 0 C ATOM 5996 CG ARG H 96 127.594 129.599 126.567 1.00 36.30 C ANISOU 5996 CG ARG H 96 4597 4597 4597 0 0 0 C ATOM 5997 CD ARG H 96 129.092 129.621 126.489 1.00 36.30 C ANISOU 5997 CD ARG H 96 4597 4597 4597 0 0 0 C ATOM 5998 NE ARG H 96 129.592 130.800 125.797 1.00 36.30 N ANISOU 5998 NE ARG H 96 4597 4597 4597 0 0 0 N ATOM 5999 CZ ARG H 96 130.384 131.707 126.355 1.00 36.30 C ANISOU 5999 CZ ARG H 96 4597 4597 4597 0 0 0 C ATOM 6000 NH1 ARG H 96 130.756 131.569 127.619 1.00 36.30 N ANISOU 6000 NH1 ARG H 96 4597 4597 4597 0 0 0 N ATOM 6001 NH2 ARG H 96 130.799 132.752 125.653 1.00 36.30 N ANISOU 6001 NH2 ARG H 96 4597 4597 4597 0 0 0 N ATOM 6002 N LEU H 97 125.272 126.139 128.556 1.00 36.30 N ANISOU 6002 N LEU H 97 4597 4597 4597 0 0 0 N ATOM 6003 CA LEU H 97 124.969 124.735 128.811 1.00 36.30 C ANISOU 6003 CA LEU H 97 4597 4597 4597 0 0 0 C ATOM 6004 C LEU H 97 123.570 124.355 128.339 1.00 36.30 C ANISOU 6004 C LEU H 97 4597 4597 4597 0 0 0 C ATOM 6005 O LEU H 97 123.356 123.216 127.918 1.00 36.30 O ANISOU 6005 O LEU H 97 4597 4597 4597 0 0 0 O ATOM 6006 CB LEU H 97 125.121 124.404 130.294 1.00 36.30 C ANISOU 6006 CB LEU H 97 4597 4597 4597 0 0 0 C ATOM 6007 CG LEU H 97 126.518 124.302 130.903 1.00 36.30 C ANISOU 6007 CG LEU H 97 4597 4597 4597 0 0 0 C ATOM 6008 CD1 LEU H 97 126.420 124.259 132.404 1.00 36.30 C ANISOU 6008 CD1 LEU H 97 4597 4597 4597 0 0 0 C ATOM 6009 CD2 LEU H 97 127.241 123.089 130.400 1.00 36.30 C ANISOU 6009 CD2 LEU H 97 4597 4597 4597 0 0 0 C ATOM 6010 N LEU H 98 122.609 125.283 128.385 1.00 36.30 N ANISOU 6010 N LEU H 98 4597 4597 4597 0 0 0 N ATOM 6011 CA LEU H 98 121.225 124.955 128.050 1.00 36.30 C ANISOU 6011 CA LEU H 98 4597 4597 4597 0 0 0 C ATOM 6012 C LEU H 98 120.883 125.093 126.569 1.00 36.30 C ANISOU 6012 C LEU H 98 4597 4597 4597 0 0 0 C ATOM 6013 O LEU H 98 120.140 124.262 126.040 1.00 36.30 O ANISOU 6013 O LEU H 98 4597 4597 4597 0 0 0 O ATOM 6014 CB LEU H 98 120.267 125.824 128.867 1.00 36.30 C ANISOU 6014 CB LEU H 98 4597 4597 4597 0 0 0 C ATOM 6015 CG LEU H 98 119.740 125.308 130.205 1.00 36.30 C ANISOU 6015 CG LEU H 98 4597 4597 4597 0 0 0 C ATOM 6016 CD1 LEU H 98 118.829 124.135 129.966 1.00 36.30 C ANISOU 6016 CD1 LEU H 98 4597 4597 4597 0 0 0 C ATOM 6017 CD2 LEU H 98 120.857 124.910 131.127 1.00 36.30 C ANISOU 6017 CD2 LEU H 98 4597 4597 4597 0 0 0 C ATOM 6018 N LEU H 99 121.393 126.129 125.865 1.00 36.30 N ANISOU 6018 N LEU H 99 4597 4597 4597 0 0 0 N ATOM 6019 CA LEU H 99 120.843 126.339 124.532 1.00 36.30 C ANISOU 6019 CA LEU H 99 4597 4597 4597 0 0 0 C ATOM 6020 C LEU H 99 121.637 125.587 123.467 1.00 36.30 C ANISOU 6020 C LEU H 99 4597 4597 4597 0 0 0 C ATOM 6021 O LEU H 99 122.817 125.286 123.660 1.00 36.30 O ANISOU 6021 O LEU H 99 4597 4597 4597 0 0 0 O ATOM 6022 CB LEU H 99 120.834 127.824 124.192 1.00 36.30 C ANISOU 6022 CB LEU H 99 4597 4597 4597 0 0 0 C ATOM 6023 CG LEU H 99 119.787 128.703 124.871 1.00 36.30 C ANISOU 6023 CG LEU H 99 4597 4597 4597 0 0 0 C ATOM 6024 CD1 LEU H 99 119.878 130.121 124.357 1.00 36.30 C ANISOU 6024 CD1 LEU H 99 4597 4597 4597 0 0 0 C ATOM 6025 CD2 LEU H 99 118.413 128.150 124.639 1.00 36.30 C ANISOU 6025 CD2 LEU H 99 4597 4597 4597 0 0 0 C ATOM 6026 N PRO H 100 121.009 125.272 122.325 1.00 36.30 N ANISOU 6026 N PRO H 100 4597 4597 4597 0 0 0 N ATOM 6027 CA PRO H 100 121.745 124.630 121.228 1.00 36.30 C ANISOU 6027 CA PRO H 100 4597 4597 4597 0 0 0 C ATOM 6028 C PRO H 100 122.727 125.552 120.523 1.00 36.30 C ANISOU 6028 C PRO H 100 4597 4597 4597 0 0 0 C ATOM 6029 O PRO H 100 122.889 126.720 120.891 1.00 36.30 O ANISOU 6029 O PRO H 100 4597 4597 4597 0 0 0 O ATOM 6030 CB PRO H 100 120.629 124.187 120.278 1.00 36.30 C ANISOU 6030 CB PRO H 100 4597 4597 4597 0 0 0 C ATOM 6031 CG PRO H 100 119.462 124.009 121.148 1.00 36.30 C ANISOU 6031 CG PRO H 100 4597 4597 4597 0 0 0 C ATOM 6032 CD PRO H 100 119.557 125.110 122.158 1.00 36.30 C ANISOU 6032 CD PRO H 100 4597 4597 4597 0 0 0 C ATOM 6033 N GLY H 101 123.372 125.020 119.489 1.00 36.30 N ANISOU 6033 N GLY H 101 4597 4597 4597 0 0 0 N ATOM 6034 CA GLY H 101 124.549 125.613 118.886 1.00 36.30 C ANISOU 6034 CA GLY H 101 4597 4597 4597 0 0 0 C ATOM 6035 C GLY H 101 124.453 127.043 118.404 1.00 36.30 C ANISOU 6035 C GLY H 101 4597 4597 4597 0 0 0 C ATOM 6036 O GLY H 101 125.181 127.912 118.889 1.00 36.30 O ANISOU 6036 O GLY H 101 4597 4597 4597 0 0 0 O ATOM 6037 N GLU H 102 123.585 127.301 117.434 1.00 36.30 N ANISOU 6037 N GLU H 102 4597 4597 4597 0 0 0 N ATOM 6038 CA GLU H 102 123.492 128.623 116.835 1.00 36.30 C ANISOU 6038 CA GLU H 102 4597 4597 4597 0 0 0 C ATOM 6039 C GLU H 102 122.522 129.531 117.578 1.00 36.30 C ANISOU 6039 C GLU H 102 4597 4597 4597 0 0 0 C ATOM 6040 O GLU H 102 122.542 130.746 117.365 1.00 36.30 O ANISOU 6040 O GLU H 102 4597 4597 4597 0 0 0 O ATOM 6041 CB GLU H 102 123.080 128.484 115.367 1.00 36.30 C ANISOU 6041 CB GLU H 102 4597 4597 4597 0 0 0 C ATOM 6042 CG GLU H 102 123.170 129.746 114.542 1.00 36.30 C ANISOU 6042 CG GLU H 102 4597 4597 4597 0 0 0 C ATOM 6043 CD GLU H 102 124.597 130.203 114.341 1.00 36.30 C ANISOU 6043 CD GLU H 102 4597 4597 4597 0 0 0 C ATOM 6044 OE1 GLU H 102 125.511 129.356 114.416 1.00 36.30 O ANISOU 6044 OE1 GLU H 102 4597 4597 4597 0 0 0 O ATOM 6045 OE2 GLU H 102 124.806 131.410 114.098 1.00 36.30 O ANISOU 6045 OE2 GLU H 102 4597 4597 4597 0 0 0 O ATOM 6046 N LEU H 103 121.689 128.972 118.456 1.00 36.30 N ANISOU 6046 N LEU H 103 4597 4597 4597 0 0 0 N ATOM 6047 CA LEU H 103 120.856 129.797 119.321 1.00 36.30 C ANISOU 6047 CA LEU H 103 4597 4597 4597 0 0 0 C ATOM 6048 C LEU H 103 121.668 130.394 120.461 1.00 36.30 C ANISOU 6048 C LEU H 103 4597 4597 4597 0 0 0 C ATOM 6049 O LEU H 103 121.383 131.508 120.909 1.00 36.30 O ANISOU 6049 O LEU H 103 4597 4597 4597 0 0 0 O ATOM 6050 CB LEU H 103 119.698 128.974 119.880 1.00 36.30 C ANISOU 6050 CB LEU H 103 4597 4597 4597 0 0 0 C ATOM 6051 CG LEU H 103 118.385 128.899 119.109 1.00 36.30 C ANISOU 6051 CG LEU H 103 4597 4597 4597 0 0 0 C ATOM 6052 CD1 LEU H 103 117.342 128.173 119.929 1.00 36.30 C ANISOU 6052 CD1 LEU H 103 4597 4597 4597 0 0 0 C ATOM 6053 CD2 LEU H 103 117.911 130.286 118.771 1.00 36.30 C ANISOU 6053 CD2 LEU H 103 4597 4597 4597 0 0 0 C ATOM 6054 N ALA H 104 122.676 129.675 120.951 1.00 36.30 N ANISOU 6054 N ALA H 104 4597 4597 4597 0 0 0 N ATOM 6055 CA ALA H 104 123.416 130.147 122.111 1.00 36.30 C ANISOU 6055 CA ALA H 104 4597 4597 4597 0 0 0 C ATOM 6056 C ALA H 104 124.412 131.246 121.788 1.00 36.30 C ANISOU 6056 C ALA H 104 4597 4597 4597 0 0 0 C ATOM 6057 O ALA H 104 125.082 131.732 122.702 1.00 36.30 O ANISOU 6057 O ALA H 104 4597 4597 4597 0 0 0 O ATOM 6058 CB ALA H 104 124.151 128.983 122.772 1.00 36.30 C ANISOU 6058 CB ALA H 104 4597 4597 4597 0 0 0 C ATOM 6059 N LYS H 105 124.526 131.653 120.529 1.00 36.30 N ANISOU 6059 N LYS H 105 4597 4597 4597 0 0 0 N ATOM 6060 CA LYS H 105 125.519 132.635 120.119 1.00 36.30 C ANISOU 6060 CA LYS H 105 4597 4597 4597 0 0 0 C ATOM 6061 C LYS H 105 124.939 134.019 119.884 1.00 36.30 C ANISOU 6061 C LYS H 105 4597 4597 4597 0 0 0 C ATOM 6062 O LYS H 105 125.689 134.993 119.880 1.00 36.30 O ANISOU 6062 O LYS H 105 4597 4597 4597 0 0 0 O ATOM 6063 CB LYS H 105 126.228 132.157 118.848 1.00 36.30 C ANISOU 6063 CB LYS H 105 4597 4597 4597 0 0 0 C ATOM 6064 CG LYS H 105 127.494 132.901 118.499 1.00 36.30 C ANISOU 6064 CG LYS H 105 4597 4597 4597 0 0 0 C ATOM 6065 CD LYS H 105 128.001 132.484 117.132 1.00 36.30 C ANISOU 6065 CD LYS H 105 4597 4597 4597 0 0 0 C ATOM 6066 CE LYS H 105 126.983 132.797 116.056 1.00 36.30 C ANISOU 6066 CE LYS H 105 4597 4597 4597 0 0 0 C ATOM 6067 NZ LYS H 105 127.192 131.954 114.851 1.00 36.30 N ANISOU 6067 NZ LYS H 105 4597 4597 4597 0 0 0 N ATOM 6068 N HIS H 106 123.626 134.130 119.701 1.00 36.30 N ANISOU 6068 N HIS H 106 4597 4597 4597 0 0 0 N ATOM 6069 CA HIS H 106 122.963 135.422 119.599 1.00 36.30 C ANISOU 6069 CA HIS H 106 4597 4597 4597 0 0 0 C ATOM 6070 C HIS H 106 122.449 135.920 120.941 1.00 36.30 C ANISOU 6070 C HIS H 106 4597 4597 4597 0 0 0 C ATOM 6071 O HIS H 106 122.431 137.135 121.186 1.00 36.30 O ANISOU 6071 O HIS H 106 4597 4597 4597 0 0 0 O ATOM 6072 CB HIS H 106 121.799 135.332 118.615 1.00 36.30 C ANISOU 6072 CB HIS H 106 4597 4597 4597 0 0 0 C ATOM 6073 CG HIS H 106 122.222 135.112 117.197 1.00 36.30 C ANISOU 6073 CG HIS H 106 4597 4597 4597 0 0 0 C ATOM 6074 ND1 HIS H 106 123.281 135.782 116.624 1.00 36.30 N ANISOU 6074 ND1 HIS H 106 4597 4597 4597 0 0 0 N ATOM 6075 CD2 HIS H 106 121.722 134.305 116.232 1.00 36.30 C ANISOU 6075 CD2 HIS H 106 4597 4597 4597 0 0 0 C ATOM 6076 CE1 HIS H 106 123.420 135.391 115.370 1.00 36.30 C ANISOU 6076 CE1 HIS H 106 4597 4597 4597 0 0 0 C ATOM 6077 NE2 HIS H 106 122.486 134.497 115.108 1.00 36.30 N ANISOU 6077 NE2 HIS H 106 4597 4597 4597 0 0 0 N ATOM 6078 N ALA H 107 122.040 135.001 121.817 1.00 36.30 N ANISOU 6078 N ALA H 107 4597 4597 4597 0 0 0 N ATOM 6079 CA ALA H 107 121.553 135.387 123.134 1.00 36.30 C ANISOU 6079 CA ALA H 107 4597 4597 4597 0 0 0 C ATOM 6080 C ALA H 107 122.660 136.011 123.971 1.00 36.30 C ANISOU 6080 C ALA H 107 4597 4597 4597 0 0 0 C ATOM 6081 O ALA H 107 122.415 136.949 124.741 1.00 36.30 O ANISOU 6081 O ALA H 107 4597 4597 4597 0 0 0 O ATOM 6082 CB ALA H 107 120.964 134.172 123.839 1.00 36.30 C ANISOU 6082 CB ALA H 107 4597 4597 4597 0 0 0 C ATOM 6083 N VAL H 108 123.888 135.512 123.823 1.00 36.30 N ANISOU 6083 N VAL H 108 4597 4597 4597 0 0 0 N ATOM 6084 CA VAL H 108 125.019 136.087 124.540 1.00 36.30 C ANISOU 6084 CA VAL H 108 4597 4597 4597 0 0 0 C ATOM 6085 C VAL H 108 125.250 137.526 124.104 1.00 36.30 C ANISOU 6085 C VAL H 108 4597 4597 4597 0 0 0 C ATOM 6086 O VAL H 108 125.493 138.409 124.935 1.00 36.30 O ANISOU 6086 O VAL H 108 4597 4597 4597 0 0 0 O ATOM 6087 CB VAL H 108 126.272 135.218 124.339 1.00 36.30 C ANISOU 6087 CB VAL H 108 4597 4597 4597 0 0 0 C ATOM 6088 CG1 VAL H 108 127.498 135.935 124.842 1.00 36.30 C ANISOU 6088 CG1 VAL H 108 4597 4597 4597 0 0 0 C ATOM 6089 CG2 VAL H 108 126.114 133.903 125.064 1.00 36.30 C ANISOU 6089 CG2 VAL H 108 4597 4597 4597 0 0 0 C ATOM 6090 N SER H 109 125.148 137.793 122.801 1.00 36.30 N ANISOU 6090 N SER H 109 4597 4597 4597 0 0 0 N ATOM 6091 CA SER H 109 125.306 139.156 122.303 1.00 36.30 C ANISOU 6091 CA SER H 109 4597 4597 4597 0 0 0 C ATOM 6092 C SER H 109 124.222 140.073 122.851 1.00 36.30 C ANISOU 6092 C SER H 109 4597 4597 4597 0 0 0 C ATOM 6093 O SER H 109 124.505 141.193 123.295 1.00 36.30 O ANISOU 6093 O SER H 109 4597 4597 4597 0 0 0 O ATOM 6094 CB SER H 109 125.282 139.157 120.780 1.00 36.30 C ANISOU 6094 CB SER H 109 4597 4597 4597 0 0 0 C ATOM 6095 OG SER H 109 126.188 138.205 120.266 1.00 36.30 O ANISOU 6095 OG SER H 109 4597 4597 4597 0 0 0 O ATOM 6096 N GLU H 110 122.971 139.614 122.824 1.00 36.30 N ANISOU 6096 N GLU H 110 4597 4597 4597 0 0 0 N ATOM 6097 CA GLU H 110 121.881 140.419 123.370 1.00 36.30 C ANISOU 6097 CA GLU H 110 4597 4597 4597 0 0 0 C ATOM 6098 C GLU H 110 122.136 140.784 124.829 1.00 36.30 C ANISOU 6098 C GLU H 110 4597 4597 4597 0 0 0 C ATOM 6099 O GLU H 110 122.068 141.962 125.212 1.00 36.30 O ANISOU 6099 O GLU H 110 4597 4597 4597 0 0 0 O ATOM 6100 CB GLU H 110 120.560 139.672 123.233 1.00 36.30 C ANISOU 6100 CB GLU H 110 4597 4597 4597 0 0 0 C ATOM 6101 CG GLU H 110 120.225 139.276 121.819 1.00 36.30 C ANISOU 6101 CG GLU H 110 4597 4597 4597 0 0 0 C ATOM 6102 CD GLU H 110 119.662 140.421 121.013 1.00 36.30 C ANISOU 6102 CD GLU H 110 4597 4597 4597 0 0 0 C ATOM 6103 OE1 GLU H 110 119.000 141.294 121.607 1.00 36.30 O ANISOU 6103 OE1 GLU H 110 4597 4597 4597 0 0 0 O ATOM 6104 OE2 GLU H 110 119.880 140.449 119.786 1.00 36.30 O ANISOU 6104 OE2 GLU H 110 4597 4597 4597 0 0 0 O ATOM 6105 N GLY H 111 122.433 139.782 125.660 1.00 36.30 N ANISOU 6105 N GLY H 111 4597 4597 4597 0 0 0 N ATOM 6106 CA GLY H 111 122.631 140.047 127.075 1.00 36.30 C ANISOU 6106 CA GLY H 111 4597 4597 4597 0 0 0 C ATOM 6107 C GLY H 111 123.819 140.948 127.354 1.00 36.30 C ANISOU 6107 C GLY H 111 4597 4597 4597 0 0 0 C ATOM 6108 O GLY H 111 123.740 141.857 128.188 1.00 36.30 O ANISOU 6108 O GLY H 111 4597 4597 4597 0 0 0 O ATOM 6109 N THR H 112 124.933 140.720 126.657 1.00 36.30 N ANISOU 6109 N THR H 112 4597 4597 4597 0 0 0 N ATOM 6110 CA THR H 112 126.133 141.495 126.929 1.00 36.30 C ANISOU 6110 CA THR H 112 4597 4597 4597 0 0 0 C ATOM 6111 C THR H 112 126.068 142.898 126.352 1.00 36.30 C ANISOU 6111 C THR H 112 4597 4597 4597 0 0 0 C ATOM 6112 O THR H 112 126.868 143.749 126.746 1.00 36.30 O ANISOU 6112 O THR H 112 4597 4597 4597 0 0 0 O ATOM 6113 CB THR H 112 127.369 140.781 126.385 1.00 36.30 C ANISOU 6113 CB THR H 112 4597 4597 4597 0 0 0 C ATOM 6114 OG1 THR H 112 128.543 141.408 126.907 1.00 36.30 O ANISOU 6114 OG1 THR H 112 4597 4597 4597 0 0 0 O ATOM 6115 CG2 THR H 112 127.411 140.874 124.885 1.00 36.30 C ANISOU 6115 CG2 THR H 112 4597 4597 4597 0 0 0 C ATOM 6116 N LYS H 113 125.144 143.163 125.429 1.00 36.30 N ANISOU 6116 N LYS H 113 4597 4597 4597 0 0 0 N ATOM 6117 CA LYS H 113 124.918 144.540 125.014 1.00 36.30 C ANISOU 6117 CA LYS H 113 4597 4597 4597 0 0 0 C ATOM 6118 C LYS H 113 124.004 145.265 125.992 1.00 36.30 C ANISOU 6118 C LYS H 113 4597 4597 4597 0 0 0 C ATOM 6119 O LYS H 113 124.239 146.438 126.319 1.00 36.30 O ANISOU 6119 O LYS H 113 4597 4597 4597 0 0 0 O ATOM 6120 CB LYS H 113 124.330 144.565 123.607 1.00 36.30 C ANISOU 6120 CB LYS H 113 4597 4597 4597 0 0 0 C ATOM 6121 CG LYS H 113 123.811 145.909 123.168 1.00 36.30 C ANISOU 6121 CG LYS H 113 4597 4597 4597 0 0 0 C ATOM 6122 CD LYS H 113 123.222 145.824 121.776 1.00 36.30 C ANISOU 6122 CD LYS H 113 4597 4597 4597 0 0 0 C ATOM 6123 CE LYS H 113 122.351 144.593 121.623 1.00 36.30 C ANISOU 6123 CE LYS H 113 4597 4597 4597 0 0 0 C ATOM 6124 NZ LYS H 113 122.295 144.111 120.219 1.00 36.30 N ANISOU 6124 NZ LYS H 113 4597 4597 4597 0 0 0 N ATOM 6125 N ALA H 114 122.963 144.580 126.475 1.00 36.30 N ANISOU 6125 N ALA H 114 4597 4597 4597 0 0 0 N ATOM 6126 CA ALA H 114 122.087 145.191 127.470 1.00 36.30 C ANISOU 6126 CA ALA H 114 4597 4597 4597 0 0 0 C ATOM 6127 C ALA H 114 122.843 145.572 128.737 1.00 36.30 C ANISOU 6127 C ALA H 114 4597 4597 4597 0 0 0 C ATOM 6128 O ALA H 114 122.642 146.670 129.268 1.00 36.30 O ANISOU 6128 O ALA H 114 4597 4597 4597 0 0 0 O ATOM 6129 CB ALA H 114 120.938 144.247 127.805 1.00 36.30 C ANISOU 6129 CB ALA H 114 4597 4597 4597 0 0 0 C ATOM 6130 N VAL H 115 123.713 144.693 129.237 1.00 36.30 N ANISOU 6130 N VAL H 115 4597 4597 4597 0 0 0 N ATOM 6131 CA VAL H 115 124.420 144.995 130.481 1.00 36.30 C ANISOU 6131 CA VAL H 115 4597 4597 4597 0 0 0 C ATOM 6132 C VAL H 115 125.334 146.206 130.318 1.00 36.30 C ANISOU 6132 C VAL H 115 4597 4597 4597 0 0 0 C ATOM 6133 O VAL H 115 125.417 147.064 131.208 1.00 36.30 O ANISOU 6133 O VAL H 115 4597 4597 4597 0 0 0 O ATOM 6134 CB VAL H 115 125.199 143.762 130.966 1.00 36.30 C ANISOU 6134 CB VAL H 115 4597 4597 4597 0 0 0 C ATOM 6135 CG1 VAL H 115 126.225 144.163 131.993 1.00 36.30 C ANISOU 6135 CG1 VAL H 115 4597 4597 4597 0 0 0 C ATOM 6136 CG2 VAL H 115 124.252 142.747 131.552 1.00 36.30 C ANISOU 6136 CG2 VAL H 115 4597 4597 4597 0 0 0 C ATOM 6137 N THR H 116 126.034 146.299 129.187 1.00 36.30 N ANISOU 6137 N THR H 116 4597 4597 4597 0 0 0 N ATOM 6138 CA THR H 116 126.904 147.446 128.953 1.00 36.30 C ANISOU 6138 CA THR H 116 4597 4597 4597 0 0 0 C ATOM 6139 C THR H 116 126.107 148.736 128.865 1.00 36.30 C ANISOU 6139 C THR H 116 4597 4597 4597 0 0 0 C ATOM 6140 O THR H 116 126.470 149.738 129.488 1.00 36.30 O ANISOU 6140 O THR H 116 4597 4597 4597 0 0 0 O ATOM 6141 CB THR H 116 127.719 147.250 127.680 1.00 36.30 C ANISOU 6141 CB THR H 116 4597 4597 4597 0 0 0 C ATOM 6142 OG1 THR H 116 128.571 146.111 127.828 1.00 36.30 O ANISOU 6142 OG1 THR H 116 4597 4597 4597 0 0 0 O ATOM 6143 CG2 THR H 116 128.560 148.469 127.409 1.00 36.30 C ANISOU 6143 CG2 THR H 116 4597 4597 4597 0 0 0 C ATOM 6144 N LYS H 117 125.017 148.738 128.094 1.00 36.30 N ANISOU 6144 N LYS H 117 4597 4597 4597 0 0 0 N ATOM 6145 CA LYS H 117 124.210 149.949 128.005 1.00 36.30 C ANISOU 6145 CA LYS H 117 4597 4597 4597 0 0 0 C ATOM 6146 C LYS H 117 123.643 150.345 129.359 1.00 36.30 C ANISOU 6146 C LYS H 117 4597 4597 4597 0 0 0 C ATOM 6147 O LYS H 117 123.492 151.537 129.642 1.00 36.30 O ANISOU 6147 O LYS H 117 4597 4597 4597 0 0 0 O ATOM 6148 CB LYS H 117 123.084 149.764 126.997 1.00 36.30 C ANISOU 6148 CB LYS H 117 4597 4597 4597 0 0 0 C ATOM 6149 CG LYS H 117 122.226 150.991 126.828 1.00 36.30 C ANISOU 6149 CG LYS H 117 4597 4597 4597 0 0 0 C ATOM 6150 CD LYS H 117 121.400 150.920 125.569 1.00 36.30 C ANISOU 6150 CD LYS H 117 4597 4597 4597 0 0 0 C ATOM 6151 CE LYS H 117 120.862 152.287 125.216 1.00 36.30 C ANISOU 6151 CE LYS H 117 4597 4597 4597 0 0 0 C ATOM 6152 NZ LYS H 117 120.344 152.992 126.420 1.00 36.30 N ANISOU 6152 NZ LYS H 117 4597 4597 4597 0 0 0 N ATOM 6153 N TYR H 118 123.335 149.368 130.211 1.00 36.30 N ANISOU 6153 N TYR H 118 4597 4597 4597 0 0 0 N ATOM 6154 CA TYR H 118 122.786 149.679 131.526 1.00 36.30 C ANISOU 6154 CA TYR H 118 4597 4597 4597 0 0 0 C ATOM 6155 C TYR H 118 123.824 150.304 132.442 1.00 36.30 C ANISOU 6155 C TYR H 118 4597 4597 4597 0 0 0 C ATOM 6156 O TYR H 118 123.545 151.310 133.100 1.00 36.30 O ANISOU 6156 O TYR H 118 4597 4597 4597 0 0 0 O ATOM 6157 CB TYR H 118 122.218 148.416 132.165 1.00 36.30 C ANISOU 6157 CB TYR H 118 4597 4597 4597 0 0 0 C ATOM 6158 CG TYR H 118 121.793 148.576 133.604 1.00 36.30 C ANISOU 6158 CG TYR H 118 4597 4597 4597 0 0 0 C ATOM 6159 CD1 TYR H 118 120.540 149.055 133.923 1.00 36.30 C ANISOU 6159 CD1 TYR H 118 4597 4597 4597 0 0 0 C ATOM 6160 CD2 TYR H 118 122.634 148.217 134.641 1.00 36.30 C ANISOU 6160 CD2 TYR H 118 4597 4597 4597 0 0 0 C ATOM 6161 CE1 TYR H 118 120.143 149.190 135.225 1.00 36.30 C ANISOU 6161 CE1 TYR H 118 4597 4597 4597 0 0 0 C ATOM 6162 CE2 TYR H 118 122.244 148.353 135.949 1.00 36.30 C ANISOU 6162 CE2 TYR H 118 4597 4597 4597 0 0 0 C ATOM 6163 CZ TYR H 118 120.997 148.841 136.233 1.00 36.30 C ANISOU 6163 CZ TYR H 118 4597 4597 4597 0 0 0 C ATOM 6164 OH TYR H 118 120.599 148.978 137.536 1.00 36.30 O ANISOU 6164 OH TYR H 118 4597 4597 4597 0 0 0 O ATOM 6165 N THR H 119 125.022 149.730 132.501 1.00 36.30 N ANISOU 6165 N THR H 119 4597 4597 4597 0 0 0 N ATOM 6166 CA THR H 119 126.002 150.186 133.481 1.00 36.30 C ANISOU 6166 CA THR H 119 4597 4597 4597 0 0 0 C ATOM 6167 C THR H 119 126.711 151.471 133.075 1.00 36.30 C ANISOU 6167 C THR H 119 4597 4597 4597 0 0 0 C ATOM 6168 O THR H 119 127.608 151.914 133.797 1.00 36.30 O ANISOU 6168 O THR H 119 4597 4597 4597 0 0 0 O ATOM 6169 CB THR H 119 127.045 149.100 133.741 1.00 36.30 C ANISOU 6169 CB THR H 119 4597 4597 4597 0 0 0 C ATOM 6170 OG1 THR H 119 127.828 149.463 134.881 1.00 36.30 O ANISOU 6170 OG1 THR H 119 4597 4597 4597 0 0 0 O ATOM 6171 CG2 THR H 119 127.968 148.961 132.551 1.00 36.30 C ANISOU 6171 CG2 THR H 119 4597 4597 4597 0 0 0 C ATOM 6172 N SER H 120 126.341 152.082 131.951 1.00 36.30 N ANISOU 6172 N SER H 120 4597 4597 4597 0 0 0 N ATOM 6173 CA SER H 120 126.961 153.330 131.519 1.00 36.30 C ANISOU 6173 CA SER H 120 4597 4597 4597 0 0 0 C ATOM 6174 C SER H 120 126.166 154.540 131.999 1.00 36.30 C ANISOU 6174 C SER H 120 4597 4597 4597 0 0 0 C ATOM 6175 O SER H 120 126.742 155.583 132.319 1.00 36.30 O ANISOU 6175 O SER H 120 4597 4597 4597 0 0 0 O ATOM 6176 CB SER H 120 127.097 153.357 129.995 1.00 36.30 C ANISOU 6176 CB SER H 120 4597 4597 4597 0 0 0 C ATOM 6177 OG SER H 120 125.938 153.905 129.399 1.00 36.30 O ANISOU 6177 OG SER H 120 4597 4597 4597 0 0 0 O ATOM 6178 N ALA H 121 124.844 154.418 132.039 1.00 40.58 N ATOM 6179 CA ALA H 121 123.983 155.494 132.513 1.00 40.58 C ATOM 6180 C ALA H 121 124.215 155.762 133.994 1.00 40.58 C ATOM 6181 O ALA H 121 123.340 155.517 134.823 1.00 40.58 O ATOM 6182 CB ALA H 121 122.523 155.155 132.258 1.00 40.58 C