>>7K63:HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 GLN A 85 ALA A 114 1 30 ATOM 421 N GLN A 85 150.435 187.811 186.433 1.00 50.92 N ANISOU 421 N GLN A 85 6449 6449 6449 0 0 0 N ATOM 422 CA GLN A 85 151.198 189.021 186.674 1.00 50.92 C ANISOU 422 CA GLN A 85 6449 6449 6449 0 0 0 C ATOM 423 C GLN A 85 151.611 189.654 185.352 1.00 50.92 C ANISOU 423 C GLN A 85 6449 6449 6449 0 0 0 C ATOM 424 O GLN A 85 151.892 188.966 184.362 1.00 50.92 O ANISOU 424 O GLN A 85 6449 6449 6449 0 0 0 O ATOM 425 CB GLN A 85 152.434 188.725 187.516 1.00 50.92 C ANISOU 425 CB GLN A 85 6449 6449 6449 0 0 0 C ATOM 426 CG GLN A 85 152.183 188.718 188.999 1.00 50.92 C ANISOU 426 CG GLN A 85 6449 6449 6449 0 0 0 C ATOM 427 CD GLN A 85 153.465 188.658 189.794 1.00 50.92 C ANISOU 427 CD GLN A 85 6449 6449 6449 0 0 0 C ATOM 428 OE1 GLN A 85 154.556 188.581 189.231 1.00 50.92 O ANISOU 428 OE1 GLN A 85 6449 6449 6449 0 0 0 O ATOM 429 NE2 GLN A 85 153.342 188.688 191.113 1.00 50.92 N ANISOU 429 NE2 GLN A 85 6449 6449 6449 0 0 0 N ATOM 430 N SER A 86 151.653 190.987 185.347 1.00 50.92 N ANISOU 430 N SER A 86 6449 6449 6449 0 0 0 N ATOM 431 CA SER A 86 152.221 191.699 184.213 1.00 50.92 C ANISOU 431 CA SER A 86 6449 6449 6449 0 0 0 C ATOM 432 C SER A 86 153.631 191.211 183.925 1.00 50.92 C ANISOU 432 C SER A 86 6449 6449 6449 0 0 0 C ATOM 433 O SER A 86 153.988 190.957 182.770 1.00 50.92 O ANISOU 433 O SER A 86 6449 6449 6449 0 0 0 O ATOM 434 CB SER A 86 152.220 193.201 184.482 1.00 50.92 C ANISOU 434 CB SER A 86 6449 6449 6449 0 0 0 C ATOM 435 OG SER A 86 152.804 193.485 185.743 1.00 50.92 O ANISOU 435 OG SER A 86 6449 6449 6449 0 0 0 O ATOM 436 N SER A 87 154.441 191.047 184.974 1.00 50.92 N ANISOU 436 N SER A 87 6449 6449 6449 0 0 0 N ATOM 437 CA SER A 87 155.792 190.538 184.793 1.00 50.92 C ANISOU 437 CA SER A 87 6449 6449 6449 0 0 0 C ATOM 438 C SER A 87 155.809 189.089 184.333 1.00 50.92 C ANISOU 438 C SER A 87 6449 6449 6449 0 0 0 C ATOM 439 O SER A 87 156.727 188.700 183.606 1.00 50.92 O ANISOU 439 O SER A 87 6449 6449 6449 0 0 0 O ATOM 440 CB SER A 87 156.587 190.683 186.090 1.00 50.92 C ANISOU 440 CB SER A 87 6449 6449 6449 0 0 0 C ATOM 441 OG SER A 87 155.909 190.069 187.169 1.00 50.92 O ANISOU 441 OG SER A 87 6449 6449 6449 0 0 0 O ATOM 442 N ALA A 88 154.808 188.288 184.702 1.00 50.92 N ANISOU 442 N ALA A 88 6449 6449 6449 0 0 0 N ATOM 443 CA ALA A 88 154.741 186.927 184.178 1.00 50.92 C ANISOU 443 CA ALA A 88 6449 6449 6449 0 0 0 C ATOM 444 C ALA A 88 154.501 186.930 182.675 1.00 50.92 C ANISOU 444 C ALA A 88 6449 6449 6449 0 0 0 C ATOM 445 O ALA A 88 155.157 186.188 181.933 1.00 50.92 O ANISOU 445 O ALA A 88 6449 6449 6449 0 0 0 O ATOM 446 CB ALA A 88 153.645 186.137 184.889 1.00 50.92 C ANISOU 446 CB ALA A 88 6449 6449 6449 0 0 0 C ATOM 447 N VAL A 89 153.585 187.778 182.204 1.00 50.92 N ANISOU 447 N VAL A 89 6449 6449 6449 0 0 0 N ATOM 448 CA VAL A 89 153.335 187.847 180.767 1.00 50.92 C ANISOU 448 CA VAL A 89 6449 6449 6449 0 0 0 C ATOM 449 C VAL A 89 154.548 188.413 180.037 1.00 50.92 C ANISOU 449 C VAL A 89 6449 6449 6449 0 0 0 C ATOM 450 O VAL A 89 154.890 187.966 178.936 1.00 50.92 O ANISOU 450 O VAL A 89 6449 6449 6449 0 0 0 O ATOM 451 CB VAL A 89 152.064 188.663 180.480 1.00 50.92 C ANISOU 451 CB VAL A 89 6449 6449 6449 0 0 0 C ATOM 452 CG1 VAL A 89 151.736 188.619 178.999 1.00 50.92 C ANISOU 452 CG1 VAL A 89 6449 6449 6449 0 0 0 C ATOM 453 CG2 VAL A 89 150.909 188.119 181.285 1.00 50.92 C ANISOU 453 CG2 VAL A 89 6449 6449 6449 0 0 0 C ATOM 454 N MET A 90 155.219 189.403 180.631 1.00 50.92 N ANISOU 454 N MET A 90 6449 6449 6449 0 0 0 N ATOM 455 CA MET A 90 156.433 189.934 180.020 1.00 50.92 C ANISOU 455 CA MET A 90 6449 6449 6449 0 0 0 C ATOM 456 C MET A 90 157.510 188.864 179.913 1.00 50.92 C ANISOU 456 C MET A 90 6449 6449 6449 0 0 0 C ATOM 457 O MET A 90 158.195 188.767 178.891 1.00 50.92 O ANISOU 457 O MET A 90 6449 6449 6449 0 0 0 O ATOM 458 CB MET A 90 156.953 191.134 180.815 1.00 50.92 C ANISOU 458 CB MET A 90 6449 6449 6449 0 0 0 C ATOM 459 CG MET A 90 155.989 192.305 180.921 1.00 50.92 C ANISOU 459 CG MET A 90 6449 6449 6449 0 0 0 C ATOM 460 SD MET A 90 155.514 193.098 179.371 1.00 50.92 S ANISOU 460 SD MET A 90 6449 6449 6449 0 0 0 S ATOM 461 CE MET A 90 157.031 192.988 178.428 1.00 50.92 C ANISOU 461 CE MET A 90 6449 6449 6449 0 0 0 C ATOM 462 N ALA A 91 157.684 188.058 180.963 1.00 50.92 N ANISOU 462 N ALA A 91 6449 6449 6449 0 0 0 N ATOM 463 CA ALA A 91 158.672 186.986 180.922 1.00 50.92 C ANISOU 463 CA ALA A 91 6449 6449 6449 0 0 0 C ATOM 464 C ALA A 91 158.325 185.961 179.853 1.00 50.92 C ANISOU 464 C ALA A 91 6449 6449 6449 0 0 0 C ATOM 465 O ALA A 91 159.211 185.462 179.148 1.00 50.92 O ANISOU 465 O ALA A 91 6449 6449 6449 0 0 0 O ATOM 466 CB ALA A 91 158.775 186.316 182.290 1.00 50.92 C ANISOU 466 CB ALA A 91 6449 6449 6449 0 0 0 C ATOM 467 N LEU A 92 157.040 185.631 179.719 1.00 50.92 N ANISOU 467 N LEU A 92 6449 6449 6449 0 0 0 N ATOM 468 CA LEU A 92 156.631 184.707 178.668 1.00 50.92 C ANISOU 468 CA LEU A 92 6449 6449 6449 0 0 0 C ATOM 469 C LEU A 92 156.926 185.274 177.288 1.00 50.92 C ANISOU 469 C LEU A 92 6449 6449 6449 0 0 0 C ATOM 470 O LEU A 92 157.380 184.546 176.399 1.00 50.92 O ANISOU 470 O LEU A 92 6449 6449 6449 0 0 0 O ATOM 471 CB LEU A 92 155.150 184.374 178.803 1.00 50.92 C ANISOU 471 CB LEU A 92 6449 6449 6449 0 0 0 C ATOM 472 CG LEU A 92 154.810 183.394 179.918 1.00 50.92 C ANISOU 472 CG LEU A 92 6449 6449 6449 0 0 0 C ATOM 473 CD1 LEU A 92 153.321 183.353 180.148 1.00 50.92 C ANISOU 473 CD1 LEU A 92 6449 6449 6449 0 0 0 C ATOM 474 CD2 LEU A 92 155.325 182.017 179.552 1.00 50.92 C ANISOU 474 CD2 LEU A 92 6449 6449 6449 0 0 0 C ATOM 475 N GLN A 93 156.676 186.568 177.087 1.00 50.92 N ANISOU 475 N GLN A 93 6449 6449 6449 0 0 0 N ATOM 476 CA GLN A 93 156.966 187.167 175.788 1.00 50.92 C ANISOU 476 CA GLN A 93 6449 6449 6449 0 0 0 C ATOM 477 C GLN A 93 158.462 187.183 175.508 1.00 50.92 C ANISOU 477 C GLN A 93 6449 6449 6449 0 0 0 C ATOM 478 O GLN A 93 158.888 186.896 174.385 1.00 50.92 O ANISOU 478 O GLN A 93 6449 6449 6449 0 0 0 O ATOM 479 CB GLN A 93 156.380 188.573 175.710 1.00 50.92 C ANISOU 479 CB GLN A 93 6449 6449 6449 0 0 0 C ATOM 480 CG GLN A 93 156.183 189.055 174.288 1.00 50.92 C ANISOU 480 CG GLN A 93 6449 6449 6449 0 0 0 C ATOM 481 CD GLN A 93 155.434 190.361 174.213 1.00 50.92 C ANISOU 481 CD GLN A 93 6449 6449 6449 0 0 0 C ATOM 482 OE1 GLN A 93 154.635 190.680 175.090 1.00 50.92 O ANISOU 482 OE1 GLN A 93 6449 6449 6449 0 0 0 O ATOM 483 NE2 GLN A 93 155.677 191.122 173.155 1.00 50.92 N ANISOU 483 NE2 GLN A 93 6449 6449 6449 0 0 0 N ATOM 484 N GLU A 94 159.275 187.503 176.517 1.00 50.92 N ANISOU 484 N GLU A 94 6449 6449 6449 0 0 0 N ATOM 485 CA GLU A 94 160.724 187.438 176.350 1.00 50.92 C ANISOU 485 CA GLU A 94 6449 6449 6449 0 0 0 C ATOM 486 C GLU A 94 161.161 186.043 175.931 1.00 50.92 C ANISOU 486 C GLU A 94 6449 6449 6449 0 0 0 C ATOM 487 O GLU A 94 161.919 185.881 174.966 1.00 50.92 O ANISOU 487 O GLU A 94 6449 6449 6449 0 0 0 O ATOM 488 CB GLU A 94 161.427 187.830 177.651 1.00 50.92 C ANISOU 488 CB GLU A 94 6449 6449 6449 0 0 0 C ATOM 489 CG GLU A 94 161.147 189.227 178.216 1.00 50.92 C ANISOU 489 CG GLU A 94 6449 6449 6449 0 0 0 C ATOM 490 CD GLU A 94 161.308 190.379 177.234 1.00 50.92 C ANISOU 490 CD GLU A 94 6449 6449 6449 0 0 0 C ATOM 491 OE1 GLU A 94 161.712 190.163 176.073 1.00 50.92 O ANISOU 491 OE1 GLU A 94 6449 6449 6449 0 0 0 O ATOM 492 OE2 GLU A 94 161.019 191.525 177.637 1.00 50.92 O ANISOU 492 OE2 GLU A 94 6449 6449 6449 0 0 0 O ATOM 493 N ALA A 95 160.671 185.022 176.636 1.00 50.92 N ANISOU 493 N ALA A 95 6449 6449 6449 0 0 0 N ATOM 494 CA ALA A 95 161.091 183.657 176.344 1.00 50.92 C ANISOU 494 CA ALA A 95 6449 6449 6449 0 0 0 C ATOM 495 C ALA A 95 160.651 183.229 174.953 1.00 50.92 C ANISOU 495 C ALA A 95 6449 6449 6449 0 0 0 C ATOM 496 O ALA A 95 161.438 182.641 174.204 1.00 50.92 O ANISOU 496 O ALA A 95 6449 6449 6449 0 0 0 O ATOM 497 CB ALA A 95 160.538 182.703 177.398 1.00 50.92 C ANISOU 497 CB ALA A 95 6449 6449 6449 0 0 0 C ATOM 498 N CYS A 96 159.404 183.523 174.584 1.00 50.92 N ANISOU 498 N CYS A 96 6449 6449 6449 0 0 0 N ATOM 499 CA CYS A 96 158.899 183.123 173.276 1.00 50.92 C ANISOU 499 CA CYS A 96 6449 6449 6449 0 0 0 C ATOM 500 C CYS A 96 159.647 183.821 172.151 1.00 50.92 C ANISOU 500 C CYS A 96 6449 6449 6449 0 0 0 C ATOM 501 O CYS A 96 160.017 183.190 171.156 1.00 50.92 O ANISOU 501 O CYS A 96 6449 6449 6449 0 0 0 O ATOM 502 CB CYS A 96 157.405 183.406 173.184 1.00 50.92 C ANISOU 502 CB CYS A 96 6449 6449 6449 0 0 0 C ATOM 503 SG CYS A 96 156.446 182.407 174.315 1.00 50.92 S ANISOU 503 SG CYS A 96 6449 6449 6449 0 0 0 S ATOM 504 N GLU A 97 159.856 185.132 172.274 1.00 50.92 N ANISOU 504 N GLU A 97 6449 6449 6449 0 0 0 N ATOM 505 CA GLU A 97 160.563 185.855 171.226 1.00 50.92 C ANISOU 505 CA GLU A 97 6449 6449 6449 0 0 0 C ATOM 506 C GLU A 97 161.991 185.350 171.078 1.00 50.92 C ANISOU 506 C GLU A 97 6449 6449 6449 0 0 0 C ATOM 507 O GLU A 97 162.469 185.135 169.959 1.00 50.92 O ANISOU 507 O GLU A 97 6449 6449 6449 0 0 0 O ATOM 508 CB GLU A 97 160.540 187.352 171.514 1.00 50.92 C ANISOU 508 CB GLU A 97 6449 6449 6449 0 0 0 C ATOM 509 CG GLU A 97 159.149 187.950 171.451 1.00 50.92 C ANISOU 509 CG GLU A 97 6449 6449 6449 0 0 0 C ATOM 510 CD GLU A 97 159.161 189.457 171.554 1.00 50.92 C ANISOU 510 CD GLU A 97 6449 6449 6449 0 0 0 C ATOM 511 OE1 GLU A 97 160.239 190.057 171.374 1.00 50.92 O ANISOU 511 OE1 GLU A 97 6449 6449 6449 0 0 0 O ATOM 512 OE2 GLU A 97 158.087 190.042 171.810 1.00 50.92 O ANISOU 512 OE2 GLU A 97 6449 6449 6449 0 0 0 O ATOM 513 N ALA A 98 162.691 185.149 172.197 1.00 50.92 N ANISOU 513 N ALA A 98 6449 6449 6449 0 0 0 N ATOM 514 CA ALA A 98 164.062 184.661 172.117 1.00 50.92 C ANISOU 514 CA ALA A 98 6449 6449 6449 0 0 0 C ATOM 515 C ALA A 98 164.116 183.251 171.544 1.00 50.92 C ANISOU 515 C ALA A 98 6449 6449 6449 0 0 0 C ATOM 516 O ALA A 98 165.022 182.921 170.772 1.00 50.92 O ANISOU 516 O ALA A 98 6449 6449 6449 0 0 0 O ATOM 517 CB ALA A 98 164.715 184.707 173.493 1.00 50.92 C ANISOU 517 CB ALA A 98 6449 6449 6449 0 0 0 C ATOM 518 N TYR A 99 163.152 182.404 171.909 1.00 50.92 N ANISOU 518 N TYR A 99 6449 6449 6449 0 0 0 N ATOM 519 CA TYR A 99 163.092 181.054 171.362 1.00 50.92 C ANISOU 519 CA TYR A 99 6449 6449 6449 0 0 0 C ATOM 520 C TYR A 99 162.852 181.081 169.862 1.00 50.92 C ANISOU 520 C TYR A 99 6449 6449 6449 0 0 0 C ATOM 521 O TYR A 99 163.495 180.343 169.107 1.00 50.92 O ANISOU 521 O TYR A 99 6449 6449 6449 0 0 0 O ATOM 522 CB TYR A 99 161.998 180.258 172.070 1.00 50.92 C ANISOU 522 CB TYR A 99 6449 6449 6449 0 0 0 C ATOM 523 CG TYR A 99 161.645 178.948 171.404 1.00 50.92 C ANISOU 523 CG TYR A 99 6449 6449 6449 0 0 0 C ATOM 524 CD1 TYR A 99 162.440 177.828 171.569 1.00 50.92 C ANISOU 524 CD1 TYR A 99 6449 6449 6449 0 0 0 C ATOM 525 CD2 TYR A 99 160.502 178.830 170.629 1.00 50.92 C ANISOU 525 CD2 TYR A 99 6449 6449 6449 0 0 0 C ATOM 526 CE1 TYR A 99 162.118 176.631 170.969 1.00 50.92 C ANISOU 526 CE1 TYR A 99 6449 6449 6449 0 0 0 C ATOM 527 CE2 TYR A 99 160.171 177.638 170.024 1.00 50.92 C ANISOU 527 CE2 TYR A 99 6449 6449 6449 0 0 0 C ATOM 528 CZ TYR A 99 160.982 176.542 170.197 1.00 50.92 C ANISOU 528 CZ TYR A 99 6449 6449 6449 0 0 0 C ATOM 529 OH TYR A 99 160.660 175.345 169.600 1.00 50.92 O ANISOU 529 OH TYR A 99 6449 6449 6449 0 0 0 O ATOM 530 N LEU A 100 161.922 181.922 169.409 1.00 50.92 N ANISOU 530 N LEU A 100 6449 6449 6449 0 0 0 N ATOM 531 CA LEU A 100 161.636 182.005 167.982 1.00 50.92 C ANISOU 531 CA LEU A 100 6449 6449 6449 0 0 0 C ATOM 532 C LEU A 100 162.834 182.542 167.213 1.00 50.92 C ANISOU 532 C LEU A 100 6449 6449 6449 0 0 0 C ATOM 533 O LEU A 100 163.135 182.071 166.114 1.00 50.92 O ANISOU 533 O LEU A 100 6449 6449 6449 0 0 0 O ATOM 534 CB LEU A 100 160.397 182.862 167.744 1.00 50.92 C ANISOU 534 CB LEU A 100 6449 6449 6449 0 0 0 C ATOM 535 CG LEU A 100 159.087 182.125 168.013 1.00 50.92 C ANISOU 535 CG LEU A 100 6449 6449 6449 0 0 0 C ATOM 536 CD1 LEU A 100 157.895 182.970 167.624 1.00 50.92 C ANISOU 536 CD1 LEU A 100 6449 6449 6449 0 0 0 C ATOM 537 CD2 LEU A 100 159.076 180.814 167.257 1.00 50.92 C ANISOU 537 CD2 LEU A 100 6449 6449 6449 0 0 0 C ATOM 538 N VAL A 101 163.525 183.538 167.766 1.00 50.92 N ANISOU 538 N VAL A 101 6449 6449 6449 0 0 0 N ATOM 539 CA VAL A 101 164.731 184.050 167.118 1.00 50.92 C ANISOU 539 CA VAL A 101 6449 6449 6449 0 0 0 C ATOM 540 C VAL A 101 165.798 182.963 167.030 1.00 50.92 C ANISOU 540 C VAL A 101 6449 6449 6449 0 0 0 C ATOM 541 O VAL A 101 166.435 182.776 165.986 1.00 50.92 O ANISOU 541 O VAL A 101 6449 6449 6449 0 0 0 O ATOM 542 CB VAL A 101 165.246 185.298 167.853 1.00 50.92 C ANISOU 542 CB VAL A 101 6449 6449 6449 0 0 0 C ATOM 543 CG1 VAL A 101 166.583 185.727 167.293 1.00 50.92 C ANISOU 543 CG1 VAL A 101 6449 6449 6449 0 0 0 C ATOM 544 CG2 VAL A 101 164.248 186.426 167.709 1.00 50.92 C ANISOU 544 CG2 VAL A 101 6449 6449 6449 0 0 0 C ATOM 545 N GLY A 102 166.014 182.233 168.124 1.00 50.92 N ANISOU 545 N GLY A 102 6449 6449 6449 0 0 0 N ATOM 546 CA GLY A 102 166.991 181.159 168.103 1.00 50.92 C ANISOU 546 CA GLY A 102 6449 6449 6449 0 0 0 C ATOM 547 C GLY A 102 166.631 180.052 167.136 1.00 50.92 C ANISOU 547 C GLY A 102 6449 6449 6449 0 0 0 C ATOM 548 O GLY A 102 167.514 179.427 166.544 1.00 50.92 O ANISOU 548 O GLY A 102 6449 6449 6449 0 0 0 O ATOM 549 N LEU A 103 165.337 179.790 166.963 1.00 50.92 N ANISOU 549 N LEU A 103 6449 6449 6449 0 0 0 N ATOM 550 CA LEU A 103 164.899 178.783 166.005 1.00 50.92 C ANISOU 550 CA LEU A 103 6449 6449 6449 0 0 0 C ATOM 551 C LEU A 103 165.041 179.278 164.572 1.00 50.92 C ANISOU 551 C LEU A 103 6449 6449 6449 0 0 0 C ATOM 552 O LEU A 103 165.408 178.508 163.683 1.00 50.92 O ANISOU 552 O LEU A 103 6449 6449 6449 0 0 0 O ATOM 553 CB LEU A 103 163.453 178.390 166.286 1.00 50.92 C ANISOU 553 CB LEU A 103 6449 6449 6449 0 0 0 C ATOM 554 CG LEU A 103 162.866 177.323 165.370 1.00 50.92 C ANISOU 554 CG LEU A 103 6449 6449 6449 0 0 0 C ATOM 555 CD1 LEU A 103 163.616 176.015 165.546 1.00 50.92 C ANISOU 555 CD1 LEU A 103 6449 6449 6449 0 0 0 C ATOM 556 CD2 LEU A 103 161.394 177.147 165.661 1.00 50.92 C ANISOU 556 CD2 LEU A 103 6449 6449 6449 0 0 0 C ATOM 557 N PHE A 104 164.752 180.558 164.332 1.00 50.92 N ANISOU 557 N PHE A 104 6449 6449 6449 0 0 0 N ATOM 558 CA PHE A 104 164.917 181.122 162.998 1.00 50.92 C ANISOU 558 CA PHE A 104 6449 6449 6449 0 0 0 C ATOM 559 C PHE A 104 166.378 181.184 162.590 1.00 50.92 C ANISOU 559 C PHE A 104 6449 6449 6449 0 0 0 C ATOM 560 O PHE A 104 166.685 181.076 161.402 1.00 50.92 O ANISOU 560 O PHE A 104 6449 6449 6449 0 0 0 O ATOM 561 CB PHE A 104 164.296 182.513 162.921 1.00 50.92 C ANISOU 561 CB PHE A 104 6449 6449 6449 0 0 0 C ATOM 562 CG PHE A 104 162.819 182.504 162.663 1.00 50.92 C ANISOU 562 CG PHE A 104 6449 6449 6449 0 0 0 C ATOM 563 CD1 PHE A 104 162.305 181.911 161.529 1.00 50.92 C ANISOU 563 CD1 PHE A 104 6449 6449 6449 0 0 0 C ATOM 564 CD2 PHE A 104 161.947 183.112 163.544 1.00 50.92 C ANISOU 564 CD2 PHE A 104 6449 6449 6449 0 0 0 C ATOM 565 CE1 PHE A 104 160.950 181.910 161.287 1.00 50.92 C ANISOU 565 CE1 PHE A 104 6449 6449 6449 0 0 0 C ATOM 566 CE2 PHE A 104 160.594 183.113 163.309 1.00 50.92 C ANISOU 566 CE2 PHE A 104 6449 6449 6449 0 0 0 C ATOM 567 CZ PHE A 104 160.095 182.512 162.178 1.00 50.92 C ANISOU 567 CZ PHE A 104 6449 6449 6449 0 0 0 C ATOM 568 N GLU A 105 167.290 181.376 163.542 1.00 50.92 N ANISOU 568 N GLU A 105 6449 6449 6449 0 0 0 N ATOM 569 CA GLU A 105 168.710 181.326 163.207 1.00 50.92 C ANISOU 569 CA GLU A 105 6449 6449 6449 0 0 0 C ATOM 570 C GLU A 105 169.091 179.956 162.652 1.00 50.92 C ANISOU 570 C GLU A 105 6449 6449 6449 0 0 0 C ATOM 571 O GLU A 105 169.763 179.850 161.618 1.00 50.92 O ANISOU 571 O GLU A 105 6449 6449 6449 0 0 0 O ATOM 572 CB GLU A 105 169.553 181.670 164.433 1.00 50.92 C ANISOU 572 CB GLU A 105 6449 6449 6449 0 0 0 C ATOM 573 CG GLU A 105 169.438 183.117 164.868 1.00 50.92 C ANISOU 573 CG GLU A 105 6449 6449 6449 0 0 0 C ATOM 574 CD GLU A 105 170.176 183.396 166.162 1.00 50.92 C ANISOU 574 CD GLU A 105 6449 6449 6449 0 0 0 C ATOM 575 OE1 GLU A 105 171.246 182.790 166.381 1.00 50.92 O ANISOU 575 OE1 GLU A 105 6449 6449 6449 0 0 0 O ATOM 576 OE2 GLU A 105 169.686 184.220 166.963 1.00 50.92 O ANISOU 576 OE2 GLU A 105 6449 6449 6449 0 0 0 O ATOM 577 N ASP A 106 168.643 178.890 163.317 1.00 50.92 N ANISOU 577 N ASP A 106 6449 6449 6449 0 0 0 N ATOM 578 CA ASP A 106 168.929 177.543 162.835 1.00 50.92 C ANISOU 578 CA ASP A 106 6449 6449 6449 0 0 0 C ATOM 579 C ASP A 106 168.205 177.260 161.525 1.00 50.92 C ANISOU 579 C ASP A 106 6449 6449 6449 0 0 0 C ATOM 580 O ASP A 106 168.745 176.582 160.644 1.00 50.92 O ANISOU 580 O ASP A 106 6449 6449 6449 0 0 0 O ATOM 581 CB ASP A 106 168.543 176.521 163.901 1.00 50.92 C ANISOU 581 CB ASP A 106 6449 6449 6449 0 0 0 C ATOM 582 CG ASP A 106 169.272 176.745 165.212 1.00 50.92 C ANISOU 582 CG ASP A 106 6449 6449 6449 0 0 0 C ATOM 583 OD1 ASP A 106 168.838 176.187 166.241 1.00 50.92 O ANISOU 583 OD1 ASP A 106 6449 6449 6449 0 0 0 O ATOM 584 OD2 ASP A 106 170.285 177.475 165.214 1.00 50.92 O ANISOU 584 OD2 ASP A 106 6449 6449 6449 0 0 0 O ATOM 585 N THR A 107 166.982 177.769 161.382 1.00 50.92 N ANISOU 585 N THR A 107 6449 6449 6449 0 0 0 N ATOM 586 CA THR A 107 166.251 177.627 160.130 1.00 50.92 C ANISOU 586 CA THR A 107 6449 6449 6449 0 0 0 C ATOM 587 C THR A 107 167.003 178.280 158.977 1.00 50.92 C ANISOU 587 C THR A 107 6449 6449 6449 0 0 0 C ATOM 588 O THR A 107 167.102 177.712 157.884 1.00 50.92 O ANISOU 588 O THR A 107 6449 6449 6449 0 0 0 O ATOM 589 CB THR A 107 164.861 178.240 160.279 1.00 50.92 C ANISOU 589 CB THR A 107 6449 6449 6449 0 0 0 C ATOM 590 OG1 THR A 107 164.188 177.629 161.385 1.00 50.92 O ANISOU 590 OG1 THR A 107 6449 6449 6449 0 0 0 O ATOM 591 CG2 THR A 107 164.049 178.030 159.031 1.00 50.92 C ANISOU 591 CG2 THR A 107 6449 6449 6449 0 0 0 C ATOM 592 N ASN A 108 167.540 179.478 159.209 1.00 50.92 N ANISOU 592 N ASN A 108 6449 6449 6449 0 0 0 N ATOM 593 CA ASN A 108 168.322 180.162 158.186 1.00 50.92 C ANISOU 593 CA ASN A 108 6449 6449 6449 0 0 0 C ATOM 594 C ASN A 108 169.594 179.395 157.861 1.00 50.92 C ANISOU 594 C ASN A 108 6449 6449 6449 0 0 0 C ATOM 595 O ASN A 108 170.005 179.328 156.697 1.00 50.92 O ANISOU 595 O ASN A 108 6449 6449 6449 0 0 0 O ATOM 596 CB ASN A 108 168.652 181.581 158.645 1.00 50.92 C ANISOU 596 CB ASN A 108 6449 6449 6449 0 0 0 C ATOM 597 CG ASN A 108 169.099 182.468 157.509 1.00 50.92 C ANISOU 597 CG ASN A 108 6449 6449 6449 0 0 0 C ATOM 598 OD1 ASN A 108 168.656 182.311 156.372 1.00 50.92 O ANISOU 598 OD1 ASN A 108 6449 6449 6449 0 0 0 O ATOM 599 ND2 ASN A 108 169.978 183.413 157.810 1.00 50.92 N ANISOU 599 ND2 ASN A 108 6449 6449 6449 0 0 0 N ATOM 600 N LEU A 109 170.236 178.813 158.875 1.00 50.92 N ANISOU 600 N LEU A 109 6449 6449 6449 0 0 0 N ATOM 601 CA LEU A 109 171.423 178.007 158.606 1.00 50.92 C ANISOU 601 CA LEU A 109 6449 6449 6449 0 0 0 C ATOM 602 C LEU A 109 171.085 176.784 157.761 1.00 50.92 C ANISOU 602 C LEU A 109 6449 6449 6449 0 0 0 C ATOM 603 O LEU A 109 171.841 176.428 156.851 1.00 50.92 O ANISOU 603 O LEU A 109 6449 6449 6449 0 0 0 O ATOM 604 CB LEU A 109 172.095 177.590 159.911 1.00 50.92 C ANISOU 604 CB LEU A 109 6449 6449 6449 0 0 0 C ATOM 605 CG LEU A 109 172.697 178.718 160.743 1.00 50.92 C ANISOU 605 CG LEU A 109 6449 6449 6449 0 0 0 C ATOM 606 CD1 LEU A 109 173.204 178.180 162.065 1.00 50.92 C ANISOU 606 CD1 LEU A 109 6449 6449 6449 0 0 0 C ATOM 607 CD2 LEU A 109 173.815 179.397 159.976 1.00 50.92 C ANISOU 607 CD2 LEU A 109 6449 6449 6449 0 0 0 C ATOM 608 N CYS A 110 169.952 176.134 158.032 1.00 50.92 N ANISOU 608 N CYS A 110 6449 6449 6449 0 0 0 N ATOM 609 CA CYS A 110 169.537 175.005 157.200 1.00 50.92 C ANISOU 609 CA CYS A 110 6449 6449 6449 0 0 0 C ATOM 610 C CYS A 110 169.228 175.446 155.774 1.00 50.92 C ANISOU 610 C CYS A 110 6449 6449 6449 0 0 0 C ATOM 611 O CYS A 110 169.592 174.758 154.811 1.00 50.92 O ANISOU 611 O CYS A 110 6449 6449 6449 0 0 0 O ATOM 612 CB CYS A 110 168.325 174.304 157.810 1.00 50.92 C ANISOU 612 CB CYS A 110 6449 6449 6449 0 0 0 C ATOM 613 SG CYS A 110 168.531 173.753 159.507 1.00 50.92 S ANISOU 613 SG CYS A 110 6449 6449 6449 0 0 0 S ATOM 614 N ALA A 111 168.547 176.581 155.618 1.00 50.92 N ANISOU 614 N ALA A 111 6449 6449 6449 0 0 0 N ATOM 615 CA ALA A 111 168.245 177.080 154.279 1.00 50.92 C ANISOU 615 CA ALA A 111 6449 6449 6449 0 0 0 C ATOM 616 C ALA A 111 169.523 177.361 153.503 1.00 50.92 C ANISOU 616 C ALA A 111 6449 6449 6449 0 0 0 C ATOM 617 O ALA A 111 169.645 176.994 152.331 1.00 50.92 O ANISOU 617 O ALA A 111 6449 6449 6449 0 0 0 O ATOM 618 CB ALA A 111 167.380 178.336 154.368 1.00 50.92 C ANISOU 618 CB ALA A 111 6449 6449 6449 0 0 0 C ATOM 619 N ILE A 112 170.492 178.009 154.150 1.00 50.92 N ANISOU 619 N ILE A 112 6449 6449 6449 0 0 0 N ATOM 620 CA ILE A 112 171.782 178.260 153.517 1.00 50.92 C ANISOU 620 CA ILE A 112 6449 6449 6449 0 0 0 C ATOM 621 C ILE A 112 172.483 176.950 153.191 1.00 50.92 C ANISOU 621 C ILE A 112 6449 6449 6449 0 0 0 C ATOM 622 O ILE A 112 173.165 176.835 152.166 1.00 50.92 O ANISOU 622 O ILE A 112 6449 6449 6449 0 0 0 O ATOM 623 CB ILE A 112 172.630 179.148 154.440 1.00 50.92 C ANISOU 623 CB ILE A 112 6449 6449 6449 0 0 0 C ATOM 624 CG1 ILE A 112 172.065 180.563 154.440 1.00 50.92 C ANISOU 624 CG1 ILE A 112 6449 6449 6449 0 0 0 C ATOM 625 CG2 ILE A 112 174.084 179.150 154.007 1.00 50.92 C ANISOU 625 CG2 ILE A 112 6449 6449 6449 0 0 0 C ATOM 626 CD1 ILE A 112 172.833 181.494 155.298 1.00 50.92 C ANISOU 626 CD1 ILE A 112 6449 6449 6449 0 0 0 C ATOM 627 N HIS A 113 172.320 175.945 154.051 1.00 50.92 N ANISOU 627 N HIS A 113 6449 6449 6449 0 0 0 N ATOM 628 CA HIS A 113 172.871 174.623 153.786 1.00 50.92 C ANISOU 628 CA HIS A 113 6449 6449 6449 0 0 0 C ATOM 629 C HIS A 113 172.308 174.046 152.496 1.00 50.92 C ANISOU 629 C HIS A 113 6449 6449 6449 0 0 0 C ATOM 630 O HIS A 113 173.042 173.462 151.692 1.00 50.92 O ANISOU 630 O HIS A 113 6449 6449 6449 0 0 0 O ATOM 631 CB HIS A 113 172.555 173.704 154.962 1.00 50.92 C ANISOU 631 CB HIS A 113 6449 6449 6449 0 0 0 C ATOM 632 CG HIS A 113 173.252 172.386 154.914 1.00 50.92 C ANISOU 632 CG HIS A 113 6449 6449 6449 0 0 0 C ATOM 633 ND1 HIS A 113 174.614 172.261 155.087 1.00 50.92 N ANISOU 633 ND1 HIS A 113 6449 6449 6449 0 0 0 N ATOM 634 CD2 HIS A 113 172.780 171.134 154.719 1.00 50.92 C ANISOU 634 CD2 HIS A 113 6449 6449 6449 0 0 0 C ATOM 635 CE1 HIS A 113 174.946 170.986 155.008 1.00 50.92 C ANISOU 635 CE1 HIS A 113 6449 6449 6449 0 0 0 C ATOM 636 NE2 HIS A 113 173.853 170.282 154.776 1.00 50.92 N ANISOU 636 NE2 HIS A 113 6449 6449 6449 0 0 0 N ATOM 637 N ALA A 114 171.009 174.207 152.281 1.00 50.92 N ATOM 638 CA ALA A 114 170.352 173.760 151.054 1.00 50.92 C ATOM 639 C ALA A 114 170.658 174.648 149.846 1.00 50.92 C ATOM 640 O ALA A 114 169.962 174.504 148.833 1.00 50.92 O ATOM 641 CB ALA A 114 168.841 173.684 151.274 1.00 50.92 C