>>7K63:HELIX   34 AD7 SER H   55  ASN H   84  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 AD7 SER H 55 ASN H 84 1 30 ATOM 5566 N SER H 55 171.753 200.298 185.133 1.00 40.19 N ATOM 5567 CA SER H 55 170.303 200.395 185.196 1.00 40.19 C ATOM 5568 C SER H 55 169.721 199.329 186.124 1.00 40.19 C ATOM 5569 O SER H 55 170.373 198.341 186.470 1.00 40.19 O ATOM 5570 CB SER H 55 169.698 200.264 183.800 1.00 40.19 C ATOM 5571 OG SER H 55 170.100 199.058 183.181 1.00 40.19 O ATOM 5572 N SER H 56 168.465 199.543 186.523 1.00 42.85 N ATOM 5573 CA SER H 56 167.794 198.599 187.411 1.00 42.85 C ATOM 5574 C SER H 56 167.579 197.246 186.750 1.00 42.85 C ATOM 5575 O SER H 56 167.665 196.211 187.417 1.00 42.85 O ATOM 5576 CB SER H 56 166.455 199.168 187.869 1.00 42.85 C ATOM 5577 OG SER H 56 165.565 199.291 186.776 1.00 42.85 O ATOM 5578 N LYS H 57 167.286 197.226 185.451 1.00 39.29 N ATOM 5579 CA LYS H 57 167.106 195.948 184.770 1.00 39.29 C ATOM 5580 C LYS H 57 168.422 195.191 184.666 1.00 39.29 C ATOM 5581 O LYS H 57 168.451 193.961 184.792 1.00 39.29 O ATOM 5582 CB LYS H 57 166.484 196.172 183.395 1.00 39.29 C ATOM 5583 CG LYS H 57 165.061 196.692 183.466 1.00 39.29 C ATOM 5584 CD LYS H 57 164.443 196.856 182.091 1.00 39.29 C ATOM 5585 CE LYS H 57 163.050 197.452 182.195 1.00 39.29 C ATOM 5586 NZ LYS H 57 162.107 196.505 182.849 1.00 39.29 N ATOM 5587 N ALA H 58 169.525 195.906 184.441 1.00 37.74 N ATOM 5588 CA ALA H 58 170.829 195.257 184.484 1.00 37.74 C ATOM 5589 C ALA H 58 171.149 194.752 185.882 1.00 37.74 C ATOM 5590 O ALA H 58 171.769 193.694 186.029 1.00 37.74 O ATOM 5591 CB ALA H 58 171.913 196.213 183.999 1.00 37.74 C ATOM 5592 N MET H 59 170.724 195.477 186.919 1.00 40.11 N ATOM 5593 CA MET H 59 170.858 194.962 188.279 1.00 40.11 C ATOM 5594 C MET H 59 170.062 193.680 188.472 1.00 40.11 C ATOM 5595 O MET H 59 170.536 192.741 189.119 1.00 40.11 O ATOM 5596 CB MET H 59 170.418 196.012 189.293 1.00 40.11 C ATOM 5597 CG MET H 59 170.978 195.764 190.677 1.00 40.11 C ATOM 5598 SD MET H 59 172.768 195.625 190.749 1.00 40.11 S ATOM 5599 CE MET H 59 173.224 197.345 190.657 1.00 40.11 C ATOM 5600 N GLY H 60 168.846 193.626 187.933 1.00 37.01 N ATOM 5601 CA GLY H 60 168.056 192.411 188.049 1.00 37.01 C ATOM 5602 C GLY H 60 168.691 191.237 187.331 1.00 37.01 C ATOM 5603 O GLY H 60 168.713 190.114 187.844 1.00 37.01 O ATOM 5604 N ILE H 61 169.226 191.482 186.136 1.00 35.62 N ATOM 5605 CA ILE H 61 169.894 190.421 185.389 1.00 35.62 C ATOM 5606 C ILE H 61 171.142 189.954 186.125 1.00 35.62 C ATOM 5607 O ILE H 61 171.448 188.758 186.160 1.00 35.62 O ATOM 5608 CB ILE H 61 170.214 190.891 183.959 1.00 35.62 C ATOM 5609 CG1 ILE H 61 168.933 190.939 183.132 1.00 35.62 C ATOM 5610 CG2 ILE H 61 171.229 189.975 183.308 1.00 35.62 C ATOM 5611 CD1 ILE H 61 168.969 191.929 182.023 1.00 35.62 C ATOM 5612 N MET H 62 171.881 190.884 186.728 1.00 36.62 N ATOM 5613 CA MET H 62 173.070 190.493 187.477 1.00 36.62 C ATOM 5614 C MET H 62 172.698 189.697 188.724 1.00 36.62 C ATOM 5615 O MET H 62 173.399 188.748 189.089 1.00 36.62 O ATOM 5616 CB MET H 62 173.885 191.732 187.844 1.00 36.62 C ATOM 5617 CG MET H 62 174.732 192.290 186.704 1.00 36.62 C ATOM 5618 SD MET H 62 176.089 191.284 186.051 1.00 36.62 S ATOM 5619 CE MET H 62 176.466 190.162 187.394 1.00 36.62 C ATOM 5620 N ASN H 63 171.598 190.064 189.383 1.00 37.78 N ATOM 5621 CA ASN H 63 171.108 189.279 190.513 1.00 37.78 C ATOM 5622 C ASN H 63 170.768 187.860 190.084 1.00 37.78 C ATOM 5623 O ASN H 63 171.139 186.887 190.754 1.00 37.78 O ATOM 5624 CB ASN H 63 169.880 189.952 191.124 1.00 37.78 C ATOM 5625 CG ASN H 63 170.232 191.140 191.981 1.00 37.78 C ATOM 5626 OD1 ASN H 63 170.692 190.988 193.109 1.00 37.78 O ATOM 5627 ND2 ASN H 63 170.029 192.335 191.447 1.00 37.78 N ATOM 5628 N SER H 64 170.051 187.726 188.968 1.00 35.93 N ATOM 5629 CA SER H 64 169.714 186.400 188.463 1.00 35.93 C ATOM 5630 C SER H 64 170.965 185.605 188.121 1.00 35.93 C ATOM 5631 O SER H 64 171.036 184.404 188.395 1.00 35.93 O ATOM 5632 CB SER H 64 168.805 186.516 187.243 1.00 35.93 C ATOM 5633 OG SER H 64 167.656 187.288 187.536 1.00 35.93 O ATOM 5634 N PHE H 65 171.962 186.255 187.518 1.00 34.68 N ATOM 5635 CA PHE H 65 173.207 185.570 187.188 1.00 34.68 C ATOM 5636 C PHE H 65 173.904 185.060 188.440 1.00 34.68 C ATOM 5637 O PHE H 65 174.362 183.911 188.490 1.00 34.68 O ATOM 5638 CB PHE H 65 174.135 186.507 186.418 1.00 34.68 C ATOM 5639 CG PHE H 65 175.520 185.965 186.242 1.00 34.68 C ATOM 5640 CD1 PHE H 65 175.752 184.879 185.423 1.00 34.68 C ATOM 5641 CD2 PHE H 65 176.587 186.521 186.922 1.00 34.68 C ATOM 5642 CE1 PHE H 65 177.023 184.379 185.262 1.00 34.68 C ATOM 5643 CE2 PHE H 65 177.859 186.018 186.773 1.00 34.68 C ATOM 5644 CZ PHE H 65 178.077 184.942 185.946 1.00 34.68 C ATOM 5645 N VAL H 66 174.013 185.915 189.459 1.00 35.58 N ATOM 5646 CA VAL H 66 174.683 185.517 190.695 1.00 35.58 C ATOM 5647 C VAL H 66 173.954 184.346 191.333 1.00 35.58 C ATOM 5648 O VAL H 66 174.575 183.363 191.754 1.00 35.58 O ATOM 5649 CB VAL H 66 174.789 186.707 191.662 1.00 35.58 C ATOM 5650 CG1 VAL H 66 175.417 186.259 192.963 1.00 35.58 C ATOM 5651 CG2 VAL H 66 175.613 187.812 191.044 1.00 35.58 C ATOM 5652 N ASN H 67 172.625 184.427 191.406 1.00 36.39 N ATOM 5653 CA ASN H 67 171.865 183.336 192.004 1.00 36.39 C ATOM 5654 C ASN H 67 172.030 182.047 191.213 1.00 36.39 C ATOM 5655 O ASN H 67 172.211 180.974 191.797 1.00 36.39 O ATOM 5656 CB ASN H 67 170.392 183.714 192.110 1.00 36.39 C ATOM 5657 CG ASN H 67 170.094 184.516 193.352 1.00 36.39 C ATOM 5658 OD1 ASN H 67 169.925 185.732 193.297 1.00 36.39 O ATOM 5659 ND2 ASN H 67 170.039 183.837 194.492 1.00 36.39 N ATOM 5660 N ASP H 68 171.978 182.130 189.882 1.00 36.39 N ATOM 5661 CA ASP H 68 172.094 180.933 189.059 1.00 36.39 C ATOM 5662 C ASP H 68 173.446 180.262 189.250 1.00 36.39 C ATOM 5663 O ASP H 68 173.523 179.046 189.451 1.00 36.39 O ATOM 5664 CB ASP H 68 171.866 181.289 187.593 1.00 36.39 C ATOM 5665 CG ASP H 68 171.900 180.079 186.688 1.00 36.39 C ATOM 5666 OD1 ASP H 68 171.397 179.012 187.096 1.00 36.39 O ATOM 5667 OD2 ASP H 68 172.436 180.193 185.566 1.00 36.39 O ATOM 5668 N ILE H 69 174.529 181.039 189.189 1.00 34.96 N ATOM 5669 CA ILE H 69 175.856 180.453 189.361 1.00 34.96 C ATOM 5670 C ILE H 69 176.025 179.904 190.770 1.00 34.96 C ATOM 5671 O ILE H 69 176.664 178.862 190.972 1.00 34.96 O ATOM 5672 CB ILE H 69 176.950 181.475 189.012 1.00 34.96 C ATOM 5673 CG1 ILE H 69 176.733 182.003 187.605 1.00 34.96 C ATOM 5674 CG2 ILE H 69 178.317 180.840 189.106 1.00 34.96 C ATOM 5675 CD1 ILE H 69 176.736 180.922 186.553 1.00 34.96 C ATOM 5676 N PHE H 70 175.463 180.590 191.767 1.00 34.95 N ATOM 5677 CA PHE H 70 175.524 180.080 193.130 1.00 34.95 C ATOM 5678 C PHE H 70 174.861 178.715 193.226 1.00 34.95 C ATOM 5679 O PHE H 70 175.430 177.776 193.791 1.00 34.95 O ATOM 5680 CB PHE H 70 174.868 181.067 194.096 1.00 34.95 C ATOM 5681 CG PHE H 70 174.741 180.548 195.498 1.00 34.95 C ATOM 5682 CD1 PHE H 70 173.613 179.855 195.906 1.00 34.95 C ATOM 5683 CD2 PHE H 70 175.760 180.746 196.409 1.00 34.95 C ATOM 5684 CE1 PHE H 70 173.510 179.377 197.192 1.00 34.95 C ATOM 5685 CE2 PHE H 70 175.659 180.270 197.695 1.00 34.95 C ATOM 5686 CZ PHE H 70 174.534 179.585 198.088 1.00 34.95 C ATOM 5687 N GLU H 71 173.643 178.590 192.689 1.00 36.54 N ATOM 5688 CA GLU H 71 172.953 177.306 192.748 1.00 36.54 C ATOM 5689 C GLU H 71 173.685 176.237 191.953 1.00 36.54 C ATOM 5690 O GLU H 71 173.732 175.082 192.382 1.00 36.54 O ATOM 5691 CB GLU H 71 171.511 177.435 192.255 1.00 36.54 C ATOM 5692 CG GLU H 71 170.741 178.588 192.863 1.00 36.54 C ATOM 5693 CD GLU H 71 169.344 178.718 192.296 1.00 36.54 C ATOM 5694 OE1 GLU H 71 169.106 178.200 191.184 1.00 36.54 O ATOM 5695 OE2 GLU H 71 168.487 179.342 192.957 1.00 36.54 O ATOM 5696 N ARG H 72 174.299 176.598 190.826 1.00 33.53 N ATOM 5697 CA ARG H 72 175.046 175.608 190.054 1.00 33.53 C ATOM 5698 C ARG H 72 176.232 175.075 190.847 1.00 33.53 C ATOM 5699 O ARG H 72 176.414 173.858 190.969 1.00 33.53 O ATOM 5700 CB ARG H 72 175.526 176.210 188.737 1.00 33.53 C ATOM 5701 CG ARG H 72 174.439 176.579 187.755 1.00 33.53 C ATOM 5702 CD ARG H 72 174.982 177.561 186.743 1.00 33.53 C ATOM 5703 NE ARG H 72 175.327 176.926 185.477 1.00 33.53 N ATOM 5704 CZ ARG H 72 175.280 177.545 184.304 1.00 33.53 C ATOM 5705 NH1 ARG H 72 174.901 178.812 184.243 1.00 33.53 N ATOM 5706 NH2 ARG H 72 175.609 176.899 183.195 1.00 33.53 N ATOM 5707 N ILE H 73 177.049 175.973 191.400 1.00 31.97 N ATOM 5708 CA ILE H 73 178.239 175.538 192.124 1.00 31.97 C ATOM 5709 C ILE H 73 177.851 174.787 193.391 1.00 31.97 C ATOM 5710 O ILE H 73 178.459 173.768 193.733 1.00 31.97 O ATOM 5711 CB ILE H 73 179.160 176.730 192.434 1.00 31.97 C ATOM 5712 CG1 ILE H 73 179.660 177.367 191.139 1.00 31.97 C ATOM 5713 CG2 ILE H 73 180.333 176.276 193.272 1.00 31.97 C ATOM 5714 CD1 ILE H 73 180.332 178.704 191.338 1.00 31.97 C ATOM 5715 N ALA H 74 176.844 175.283 194.112 1.00 32.30 N ATOM 5716 CA ALA H 74 176.413 174.613 195.332 1.00 32.30 C ATOM 5717 C ALA H 74 175.856 173.227 195.041 1.00 32.30 C ATOM 5718 O ALA H 74 176.154 172.271 195.766 1.00 32.30 O ATOM 5719 CB ALA H 74 175.377 175.467 196.056 1.00 32.30 C ATOM 5720 N GLY H 75 175.050 173.091 193.987 1.00 32.33 N ATOM 5721 CA GLY H 75 174.535 171.782 193.630 1.00 32.33 C ATOM 5722 C GLY H 75 175.627 170.825 193.203 1.00 32.33 C ATOM 5723 O GLY H 75 175.607 169.643 193.559 1.00 32.33 O ATOM 5724 N GLU H 76 176.603 171.318 192.439 1.00 33.00 N ATOM 5725 CA GLU H 76 177.690 170.445 192.017 1.00 33.00 C ATOM 5726 C GLU H 76 178.538 170.015 193.206 1.00 33.00 C ATOM 5727 O GLU H 76 178.974 168.862 193.278 1.00 33.00 O ATOM 5728 CB GLU H 76 178.553 171.141 190.969 1.00 33.00 C ATOM 5729 CG GLU H 76 179.601 170.235 190.356 1.00 33.00 C ATOM 5730 CD GLU H 76 178.994 169.016 189.689 1.00 33.00 C ATOM 5731 OE1 GLU H 76 177.856 169.112 189.183 1.00 33.00 O ATOM 5732 OE2 GLU H 76 179.648 167.953 189.680 1.00 33.00 O ATOM 5733 N ALA H 77 178.785 170.928 194.148 1.00 31.39 N ATOM 5734 CA ALA H 77 179.529 170.573 195.350 1.00 31.39 C ATOM 5735 C ALA H 77 178.761 169.569 196.200 1.00 31.39 C ATOM 5736 O ALA H 77 179.352 168.642 196.766 1.00 31.39 O ATOM 5737 CB ALA H 77 179.841 171.829 196.155 1.00 31.39 C ATOM 5738 N SER H 78 177.443 169.742 196.306 1.00 32.32 N ATOM 5739 CA SER H 78 176.629 168.785 197.044 1.00 32.32 C ATOM 5740 C SER H 78 176.708 167.404 196.410 1.00 32.32 C ATOM 5741 O SER H 78 176.847 166.393 197.109 1.00 32.32 O ATOM 5742 CB SER H 78 175.182 169.263 197.102 1.00 32.32 C ATOM 5743 OG SER H 78 174.599 169.271 195.814 1.00 32.32 O ATOM 5744 N ARG H 79 176.611 167.341 195.081 1.00 33.49 N ATOM 5745 CA ARG H 79 176.724 166.057 194.400 1.00 33.49 C ATOM 5746 C ARG H 79 178.106 165.445 194.588 1.00 33.49 C ATOM 5747 O ARG H 79 178.225 164.232 194.768 1.00 33.49 O ATOM 5748 CB ARG H 79 176.390 166.202 192.919 1.00 33.49 C ATOM 5749 CG ARG H 79 174.901 166.327 192.653 1.00 33.49 C ATOM 5750 CD ARG H 79 174.599 166.444 191.168 1.00 33.49 C ATOM 5751 NE ARG H 79 175.046 167.718 190.615 1.00 33.49 N ATOM 5752 CZ ARG H 79 174.228 168.691 190.222 1.00 33.49 C ATOM 5753 NH1 ARG H 79 172.915 168.540 190.317 1.00 33.49 N ATOM 5754 NH2 ARG H 79 174.728 169.818 189.734 1.00 33.49 N ATOM 5755 N LEU H 80 179.161 166.258 194.532 1.00 32.32 N ATOM 5756 CA LEU H 80 180.503 165.736 194.786 1.00 32.32 C ATOM 5757 C LEU H 80 180.607 165.135 196.183 1.00 32.32 C ATOM 5758 O LEU H 80 181.151 164.035 196.362 1.00 32.32 O ATOM 5759 CB LEU H 80 181.534 166.848 194.619 1.00 32.32 C ATOM 5760 CG LEU H 80 181.917 167.285 193.213 1.00 32.32 C ATOM 5761 CD1 LEU H 80 182.450 168.696 193.262 1.00 32.32 C ATOM 5762 CD2 LEU H 80 182.964 166.347 192.661 1.00 32.32 C ATOM 5763 N ALA H 81 180.085 165.843 197.184 1.00 34.37 N ATOM 5764 CA ALA H 81 180.131 165.340 198.553 1.00 34.37 C ATOM 5765 C ALA H 81 179.349 164.042 198.680 1.00 34.37 C ATOM 5766 O ALA H 81 179.786 163.100 199.350 1.00 34.37 O ATOM 5767 CB ALA H 81 179.590 166.394 199.516 1.00 34.37 C ATOM 5768 N HIS H 82 178.176 163.978 198.048 1.00 36.48 N ATOM 5769 CA HIS H 82 177.380 162.757 198.091 1.00 36.48 C ATOM 5770 C HIS H 82 178.099 161.606 197.399 1.00 36.48 C ATOM 5771 O HIS H 82 178.045 160.462 197.864 1.00 36.48 O ATOM 5772 CB HIS H 82 176.017 163.007 197.455 1.00 36.48 C ATOM 5773 CG HIS H 82 175.100 161.827 197.505 1.00 36.48 C ATOM 5774 ND1 HIS H 82 174.019 161.764 198.356 1.00 36.48 N ATOM 5775 CD2 HIS H 82 175.096 160.668 196.805 1.00 36.48 C ATOM 5776 CE1 HIS H 82 173.392 160.615 198.183 1.00 36.48 C ATOM 5777 NE2 HIS H 82 174.024 159.931 197.249 1.00 36.48 N ATOM 5778 N TYR H 83 178.767 161.887 196.279 1.00 35.45 N ATOM 5779 CA TYR H 83 179.517 160.852 195.576 1.00 35.45 C ATOM 5780 C TYR H 83 180.649 160.313 196.431 1.00 35.45 C ATOM 5781 O TYR H 83 180.940 159.113 196.392 1.00 35.45 O ATOM 5782 CB TYR H 83 180.084 161.396 194.264 1.00 35.45 C ATOM 5783 CG TYR H 83 179.053 161.845 193.255 1.00 35.45 C ATOM 5784 CD1 TYR H 83 177.719 161.491 193.383 1.00 35.45 C ATOM 5785 CD2 TYR H 83 179.417 162.643 192.181 1.00 35.45 C ATOM 5786 CE1 TYR H 83 176.781 161.909 192.463 1.00 35.45 C ATOM 5787 CE2 TYR H 83 178.488 163.066 191.260 1.00 35.45 C ATOM 5788 CZ TYR H 83 177.173 162.697 191.404 1.00 35.45 C ATOM 5789 OH TYR H 83 176.248 163.122 190.481 1.00 35.45 O ATOM 5790 N ASN H 84 181.298 161.176 197.207 1.00 37.10 N ATOM 5791 CA ASN H 84 182.397 160.750 198.062 1.00 37.10 C ATOM 5792 C ASN H 84 181.938 160.328 199.451 1.00 37.10 C ATOM 5793 O ASN H 84 182.780 160.076 200.316 1.00 37.10 O ATOM 5794 CB ASN H 84 183.431 161.865 198.178 1.00 37.10 C ATOM 5795 CG ASN H 84 184.072 162.188 196.856 1.00 37.10 C ATOM 5796 OD1 ASN H 84 183.901 163.281 196.326 1.00 37.10 O ATOM 5797 ND2 ASN H 84 184.817 161.238 196.310 1.00 37.10 N