>>7KHC:HELIX  103 AL4 ASN D  768  ALA D  804  1                                  37    
NVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 103 AL4 ASN D 768 ALA D 804 1 37 ATOM 21392 N ASN D 768 171.214 168.487 175.796 1.00 40.74 N ATOM 21393 CA ASN D 768 169.941 168.639 176.471 1.00 40.74 C ATOM 21394 C ASN D 768 170.195 169.168 177.872 1.00 40.74 C ATOM 21395 O ASN D 768 171.330 169.212 178.351 1.00 40.74 O ATOM 21396 CB ASN D 768 169.179 167.313 176.518 1.00 40.74 C ATOM 21397 CG ASN D 768 170.018 166.187 177.061 1.00 40.74 C ATOM 21398 OD1 ASN D 768 170.809 166.381 177.981 1.00 40.74 O ATOM 21399 ND2 ASN D 768 169.862 165.002 176.488 1.00 40.74 N ATOM 21400 N VAL D 769 169.106 169.562 178.529 1.00 44.91 N ATOM 21401 CA VAL D 769 169.203 170.269 179.804 1.00 44.91 C ATOM 21402 C VAL D 769 170.174 169.569 180.752 1.00 44.91 C ATOM 21403 O VAL D 769 171.207 170.130 181.141 1.00 44.91 O ATOM 21404 CB VAL D 769 167.807 170.439 180.429 1.00 44.91 C ATOM 21405 CG1 VAL D 769 167.047 171.509 179.682 1.00 44.91 C ATOM 21406 CG2 VAL D 769 167.009 169.143 180.403 1.00 44.91 C ATOM 21407 N LEU D 770 169.868 168.330 181.130 1.00 47.53 N ATOM 21408 CA LEU D 770 170.692 167.655 182.125 1.00 47.53 C ATOM 21409 C LEU D 770 172.128 167.474 181.641 1.00 47.53 C ATOM 21410 O LEU D 770 173.075 167.638 182.421 1.00 47.53 O ATOM 21411 CB LEU D 770 170.048 166.323 182.511 1.00 47.53 C ATOM 21412 CG LEU D 770 169.669 165.331 181.415 1.00 47.53 C ATOM 21413 CD1 LEU D 770 170.816 164.398 181.080 1.00 47.53 C ATOM 21414 CD2 LEU D 770 168.444 164.546 181.842 1.00 47.53 C ATOM 21415 N GLN D 771 172.320 167.118 180.370 1.00 45.85 N ATOM 21416 CA GLN D 771 173.684 166.922 179.892 1.00 45.85 C ATOM 21417 C GLN D 771 174.491 168.200 180.055 1.00 45.85 C ATOM 21418 O GLN D 771 175.645 168.178 180.524 1.00 45.85 O ATOM 21419 CB GLN D 771 173.665 166.485 178.430 1.00 45.85 C ATOM 21420 CG GLN D 771 173.228 165.051 178.214 1.00 45.85 C ATOM 21421 CD GLN D 771 172.932 164.754 176.764 1.00 45.85 C ATOM 21422 OE1 GLN D 771 172.845 165.662 175.941 1.00 45.85 O ATOM 21423 NE2 GLN D 771 172.792 163.478 176.437 1.00 45.85 N ATOM 21424 N TYR D 772 173.883 169.335 179.717 1.00 48.54 N ATOM 21425 CA TYR D 772 174.553 170.596 179.968 1.00 48.54 C ATOM 21426 C TYR D 772 174.883 170.711 181.442 1.00 48.54 C ATOM 21427 O TYR D 772 176.053 170.768 181.816 1.00 48.54 O ATOM 21428 CB TYR D 772 173.703 171.772 179.501 1.00 48.54 C ATOM 21429 CG TYR D 772 174.570 172.893 179.011 1.00 48.54 C ATOM 21430 CD1 TYR D 772 175.230 172.798 177.801 1.00 48.54 C ATOM 21431 CD2 TYR D 772 174.785 174.016 179.785 1.00 48.54 C ATOM 21432 CE1 TYR D 772 176.046 173.804 177.358 1.00 48.54 C ATOM 21433 CE2 TYR D 772 175.603 175.028 179.351 1.00 48.54 C ATOM 21434 CZ TYR D 772 176.230 174.916 178.136 1.00 48.54 C ATOM 21435 OH TYR D 772 177.050 175.923 177.694 1.00 48.54 O ATOM 21436 N PHE D 773 173.862 170.662 182.296 1.00 71.99 N ATOM 21437 CA PHE D 773 174.085 170.722 183.735 1.00 71.99 C ATOM 21438 C PHE D 773 175.363 169.995 184.141 1.00 71.99 C ATOM 21439 O PHE D 773 176.214 170.531 184.867 1.00 71.99 O ATOM 21440 CB PHE D 773 172.880 170.112 184.442 1.00 71.99 C ATOM 21441 CG PHE D 773 172.574 170.741 185.747 1.00 71.99 C ATOM 21442 CD1 PHE D 773 171.855 171.911 185.805 1.00 71.99 C ATOM 21443 CD2 PHE D 773 173.017 170.171 186.917 1.00 71.99 C ATOM 21444 CE1 PHE D 773 171.578 172.499 187.008 1.00 71.99 C ATOM 21445 CE2 PHE D 773 172.743 170.753 188.123 1.00 71.99 C ATOM 21446 CZ PHE D 773 172.021 171.919 188.171 1.00 71.99 C ATOM 21447 N ILE D 774 175.504 168.756 183.675 1.00 48.89 N ATOM 21448 CA ILE D 774 176.658 167.954 184.071 1.00 48.89 C ATOM 21449 C ILE D 774 177.947 168.624 183.610 1.00 48.89 C ATOM 21450 O ILE D 774 178.892 168.824 184.394 1.00 48.89 O ATOM 21451 CB ILE D 774 176.538 166.524 183.515 1.00 48.89 C ATOM 21452 CG1 ILE D 774 175.182 165.903 183.876 1.00 48.89 C ATOM 21453 CG2 ILE D 774 177.704 165.671 183.993 1.00 48.89 C ATOM 21454 CD1 ILE D 774 175.087 165.376 185.286 1.00 48.89 C ATOM 21455 N SER D 775 178.008 168.990 182.327 1.00 46.45 N ATOM 21456 CA SER D 775 179.241 169.615 181.860 1.00 46.45 C ATOM 21457 C SER D 775 179.493 170.929 182.583 1.00 46.45 C ATOM 21458 O SER D 775 180.648 171.336 182.762 1.00 46.45 O ATOM 21459 CB SER D 775 179.179 169.844 180.356 1.00 46.45 C ATOM 21460 OG SER D 775 178.187 170.800 180.045 1.00 46.45 O ATOM 21461 N THR D 776 178.423 171.608 182.989 1.00 47.92 N ATOM 21462 CA THR D 776 178.554 172.837 183.756 1.00 47.92 C ATOM 21463 C THR D 776 179.330 172.576 185.029 1.00 47.92 C ATOM 21464 O THR D 776 180.267 173.309 185.370 1.00 47.92 O ATOM 21465 CB THR D 776 177.183 173.416 184.075 1.00 47.92 C ATOM 21466 OG1 THR D 776 176.434 173.563 182.865 1.00 47.92 O ATOM 21467 CG2 THR D 776 177.338 174.768 184.731 1.00 47.92 C ATOM 21468 N HIS D 777 178.912 171.555 185.774 1.00 42.75 N ATOM 21469 CA HIS D 777 179.660 171.183 186.968 1.00 42.75 C ATOM 21470 C HIS D 777 181.123 170.958 186.629 1.00 42.75 C ATOM 21471 O HIS D 777 182.027 171.432 187.336 1.00 42.75 O ATOM 21472 CB HIS D 777 179.082 169.925 187.602 1.00 42.75 C ATOM 21473 CG HIS D 777 179.898 169.417 188.745 1.00 42.75 C ATOM 21474 ND1 HIS D 777 181.188 168.958 188.591 1.00 42.75 N ATOM 21475 CD2 HIS D 777 179.622 169.328 190.065 1.00 42.75 C ATOM 21476 CE1 HIS D 777 181.665 168.591 189.765 1.00 42.75 C ATOM 21477 NE2 HIS D 777 180.735 168.807 190.677 1.00 42.75 N ATOM 21478 N GLY D 778 181.370 170.172 185.584 1.00 42.32 N ATOM 21479 CA GLY D 778 182.749 169.898 185.210 1.00 42.32 C ATOM 21480 C GLY D 778 183.552 171.176 185.068 1.00 42.32 C ATOM 21481 O GLY D 778 184.618 171.341 185.675 1.00 42.32 O ATOM 21482 N ALA D 779 183.032 172.111 184.277 1.00 35.56 N ATOM 21483 CA ALA D 779 183.769 173.336 184.004 1.00 35.56 C ATOM 21484 C ALA D 779 183.965 174.152 185.272 1.00 35.56 C ATOM 21485 O ALA D 779 185.025 174.756 185.471 1.00 35.56 O ATOM 21486 CB ALA D 779 183.040 174.161 182.948 1.00 35.56 C ATOM 21487 N ARG D 780 182.938 174.231 186.116 1.00 41.80 N ATOM 21488 CA ARG D 780 183.063 175.011 187.342 1.00 41.80 C ATOM 21489 C ARG D 780 184.215 174.495 188.190 1.00 41.80 C ATOM 21490 O ARG D 780 185.080 175.266 188.647 1.00 41.80 O ATOM 21491 CB ARG D 780 181.759 174.938 188.133 1.00 41.80 C ATOM 21492 CG ARG D 780 181.708 175.812 189.366 1.00 41.80 C ATOM 21493 CD ARG D 780 181.689 177.280 189.002 1.00 41.80 C ATOM 21494 NE ARG D 780 180.380 177.734 188.544 1.00 41.80 N ATOM 21495 CZ ARG D 780 179.250 177.647 189.234 1.00 41.80 C ATOM 21496 NH1 ARG D 780 179.215 177.145 190.457 1.00 41.80 N ATOM 21497 NH2 ARG D 780 178.120 178.070 188.678 1.00 41.80 N ATOM 21498 N LYS D 781 184.227 173.184 188.430 1.00 39.69 N ATOM 21499 CA LYS D 781 185.316 172.609 189.204 1.00 39.69 C ATOM 21500 C LYS D 781 186.647 172.960 188.558 1.00 39.69 C ATOM 21501 O LYS D 781 187.594 173.361 189.242 1.00 39.69 O ATOM 21502 CB LYS D 781 185.139 171.096 189.336 1.00 39.69 C ATOM 21503 CG LYS D 781 186.420 170.319 189.601 1.00 39.69 C ATOM 21504 CD LYS D 781 186.847 170.551 191.043 1.00 39.69 C ATOM 21505 CE LYS D 781 188.124 169.818 191.403 1.00 39.69 C ATOM 21506 NZ LYS D 781 188.490 170.049 192.828 1.00 39.69 N ATOM 21507 N GLY D 782 186.744 172.780 187.238 1.00 38.78 N ATOM 21508 CA GLY D 782 187.988 173.099 186.551 1.00 38.78 C ATOM 21509 C GLY D 782 188.462 174.511 186.835 1.00 38.78 C ATOM 21510 O GLY D 782 189.637 174.743 187.144 1.00 38.78 O ATOM 21511 N LEU D 783 187.562 175.481 186.687 1.00 37.63 N ATOM 21512 CA LEU D 783 187.939 176.875 186.884 1.00 37.63 C ATOM 21513 C LEU D 783 188.490 177.092 188.283 1.00 37.63 C ATOM 21514 O LEU D 783 189.538 177.726 188.455 1.00 37.63 O ATOM 21515 CB LEU D 783 186.752 177.794 186.618 1.00 37.63 C ATOM 21516 CG LEU D 783 186.306 177.840 185.161 1.00 37.63 C ATOM 21517 CD1 LEU D 783 184.962 178.525 185.024 1.00 37.63 C ATOM 21518 CD2 LEU D 783 187.358 178.562 184.348 1.00 37.63 C ATOM 21519 N ALA D 784 187.786 176.596 189.302 1.00 42.01 N ATOM 21520 CA ALA D 784 188.302 176.781 190.657 1.00 42.01 C ATOM 21521 C ALA D 784 189.672 176.126 190.791 1.00 42.01 C ATOM 21522 O ALA D 784 190.594 176.680 191.415 1.00 42.01 O ATOM 21523 CB ALA D 784 187.327 176.204 191.679 1.00 42.01 C ATOM 21524 N ASP D 785 189.819 174.940 190.203 1.00 45.44 N ATOM 21525 CA ASP D 785 191.084 174.224 190.244 1.00 45.44 C ATOM 21526 C ASP D 785 192.225 175.114 189.768 1.00 45.44 C ATOM 21527 O ASP D 785 193.261 175.219 190.429 1.00 45.44 O ATOM 21528 CB ASP D 785 190.962 172.958 189.396 1.00 45.44 C ATOM 21529 CG ASP D 785 192.144 172.038 189.539 1.00 45.44 C ATOM 21530 OD1 ASP D 785 192.846 171.842 188.529 1.00 45.44 O ATOM 21531 OD2 ASP D 785 192.376 171.522 190.653 1.00 45.44 O ATOM 21532 N THR D 786 192.060 175.745 188.605 1.00 45.71 N ATOM 21533 CA THR D 786 193.115 176.634 188.112 1.00 45.71 C ATOM 21534 C THR D 786 193.304 177.814 189.058 1.00 45.71 C ATOM 21535 O THR D 786 194.438 178.206 189.382 1.00 45.71 O ATOM 21536 CB THR D 786 192.813 177.142 186.700 1.00 45.71 C ATOM 21537 OG1 THR D 786 191.902 178.245 186.774 1.00 45.71 O ATOM 21538 CG2 THR D 786 192.247 176.049 185.805 1.00 45.71 C ATOM 21539 N ALA D 787 192.193 178.423 189.478 1.00 42.88 N ATOM 21540 CA ALA D 787 192.230 179.623 190.302 1.00 42.88 C ATOM 21541 C ALA D 787 192.865 179.335 191.654 1.00 42.88 C ATOM 21542 O ALA D 787 192.998 180.236 192.487 1.00 42.88 O ATOM 21543 CB ALA D 787 190.823 180.186 190.491 1.00 42.88 C ATOM 21544 N LEU D 788 193.247 178.084 191.883 1.00 42.13 N ATOM 21545 CA LEU D 788 194.013 177.735 193.072 1.00 42.13 C ATOM 21546 C LEU D 788 195.384 177.163 192.753 1.00 42.13 C ATOM 21547 O LEU D 788 196.324 177.355 193.543 1.00 42.13 O ATOM 21548 CB LEU D 788 193.233 176.718 193.916 1.00 42.13 C ATOM 21549 CG LEU D 788 193.778 176.328 195.291 1.00 42.13 C ATOM 21550 CD1 LEU D 788 192.627 175.921 196.192 1.00 42.13 C ATOM 21551 CD2 LEU D 788 194.779 175.182 195.199 1.00 42.13 C ATOM 21552 N LYS D 789 195.544 176.510 191.601 1.00 41.40 N ATOM 21553 CA LYS D 789 196.876 176.089 191.206 1.00 41.40 C ATOM 21554 C LYS D 789 197.771 177.280 190.977 1.00 41.40 C ATOM 21555 O LYS D 789 198.982 177.181 191.189 1.00 41.40 O ATOM 21556 CB LYS D 789 196.862 175.311 189.894 1.00 41.40 C ATOM 21557 CG LYS D 789 196.274 173.944 189.912 1.00 41.40 C ATOM 21558 CD LYS D 789 196.400 173.360 188.516 1.00 41.40 C ATOM 21559 CE LYS D 789 195.901 171.946 188.466 1.00 41.40 C ATOM 21560 NZ LYS D 789 196.004 171.334 187.114 1.00 41.40 N ATOM 21561 N THR D 790 197.192 178.434 190.656 1.00 37.89 N ATOM 21562 CA THR D 790 198.044 179.597 190.451 1.00 37.89 C ATOM 21563 C THR D 790 198.615 180.097 191.770 1.00 37.89 C ATOM 21564 O THR D 790 199.815 180.383 191.864 1.00 37.89 O ATOM 21565 CB THR D 790 197.267 180.699 189.734 1.00 37.89 C ATOM 21566 OG1 THR D 790 198.129 181.820 189.509 1.00 37.89 O ATOM 21567 CG2 THR D 790 196.064 181.150 190.546 1.00 37.89 C ATOM 21568 N ALA D 791 197.799 180.129 192.820 1.00 33.73 N ATOM 21569 CA ALA D 791 198.308 180.566 194.112 1.00 33.73 C ATOM 21570 C ALA D 791 199.325 179.580 194.666 1.00 33.73 C ATOM 21571 O ALA D 791 200.382 179.984 195.174 1.00 33.73 O ATOM 21572 CB ALA D 791 197.158 180.748 195.098 1.00 33.73 C ATOM 21573 N ASN D 792 199.042 178.280 194.562 1.00 35.37 N ATOM 21574 CA ASN D 792 200.013 177.322 195.078 1.00 35.37 C ATOM 21575 C ASN D 792 201.319 177.380 194.302 1.00 35.37 C ATOM 21576 O ASN D 792 202.402 177.339 194.900 1.00 35.37 O ATOM 21577 CB ASN D 792 199.442 175.910 195.062 1.00 35.37 C ATOM 21578 CG ASN D 792 198.806 175.536 196.378 1.00 35.37 C ATOM 21579 OD1 ASN D 792 199.324 175.868 197.442 1.00 35.37 O ATOM 21580 ND2 ASN D 792 197.677 174.844 196.317 1.00 35.37 N ATOM 21581 N SER D 793 201.253 177.467 192.973 1.00 32.22 N ATOM 21582 CA SER D 793 202.487 177.521 192.207 1.00 32.22 C ATOM 21583 C SER D 793 203.274 178.772 192.548 1.00 32.22 C ATOM 21584 O SER D 793 204.507 178.737 192.625 1.00 32.22 O ATOM 21585 CB SER D 793 202.181 177.475 190.718 1.00 32.22 C ATOM 21586 OG SER D 793 201.098 178.327 190.404 1.00 32.22 O ATOM 21587 N GLY D 794 202.580 179.886 192.784 1.00 31.22 N ATOM 21588 CA GLY D 794 203.288 181.099 193.148 1.00 31.22 C ATOM 21589 C GLY D 794 204.023 180.946 194.462 1.00 31.22 C ATOM 21590 O GLY D 794 205.203 181.290 194.578 1.00 31.22 O ATOM 21591 N TYR D 795 203.344 180.392 195.466 1.00 29.82 N ATOM 21592 CA TYR D 795 204.002 180.202 196.753 1.00 29.82 C ATOM 21593 C TYR D 795 205.210 179.287 196.605 1.00 29.82 C ATOM 21594 O TYR D 795 206.295 179.568 197.136 1.00 29.82 O ATOM 21595 CB TYR D 795 203.016 179.632 197.769 1.00 29.82 C ATOM 21596 CG TYR D 795 203.603 179.449 199.146 1.00 29.82 C ATOM 21597 CD1 TYR D 795 204.418 180.418 199.704 1.00 29.82 C ATOM 21598 CD2 TYR D 795 203.391 178.284 199.861 1.00 29.82 C ATOM 21599 CE1 TYR D 795 204.976 180.247 200.950 1.00 29.82 C ATOM 21600 CE2 TYR D 795 203.943 178.104 201.109 1.00 29.82 C ATOM 21601 CZ TYR D 795 204.733 179.090 201.650 1.00 29.82 C ATOM 21602 OH TYR D 795 205.292 178.917 202.893 1.00 29.82 O ATOM 21603 N LEU D 796 205.040 178.182 195.878 1.00 29.15 N ATOM 21604 CA LEU D 796 206.131 177.228 195.733 1.00 29.15 C ATOM 21605 C LEU D 796 207.332 177.876 195.064 1.00 29.15 C ATOM 21606 O LEU D 796 208.466 177.757 195.545 1.00 29.15 O ATOM 21607 CB LEU D 796 205.665 176.016 194.930 1.00 29.15 C ATOM 21608 CG LEU D 796 206.775 175.169 194.311 1.00 29.15 C ATOM 21609 CD1 LEU D 796 207.684 174.632 195.393 1.00 29.15 C ATOM 21610 CD2 LEU D 796 206.186 174.038 193.499 1.00 29.15 C ATOM 21611 N THR D 797 207.108 178.563 193.945 1.00 30.20 N ATOM 21612 CA THR D 797 208.238 179.152 193.244 1.00 30.20 C ATOM 21613 C THR D 797 208.897 180.222 194.089 1.00 30.20 C ATOM 21614 O THR D 797 210.120 180.391 194.028 1.00 30.20 O ATOM 21615 CB THR D 797 207.809 179.743 191.904 1.00 30.20 C ATOM 21616 OG1 THR D 797 208.946 180.321 191.259 1.00 30.20 O ATOM 21617 CG2 THR D 797 206.772 180.826 192.097 1.00 30.20 C ATOM 21618 N ARG D 798 208.117 180.949 194.888 1.00 33.54 N ATOM 21619 CA ARG D 798 208.726 181.971 195.725 1.00 33.54 C ATOM 21620 C ARG D 798 209.657 181.325 196.738 1.00 33.54 C ATOM 21621 O ARG D 798 210.797 181.763 196.921 1.00 33.54 O ATOM 21622 CB ARG D 798 207.648 182.807 196.409 1.00 33.54 C ATOM 21623 CG ARG D 798 208.192 184.078 197.013 1.00 33.54 C ATOM 21624 CD ARG D 798 207.471 184.557 198.234 1.00 33.54 C ATOM 21625 NE ARG D 798 207.952 185.900 198.542 1.00 33.54 N ATOM 21626 CZ ARG D 798 208.377 186.321 199.724 1.00 33.54 C ATOM 21627 NH1 ARG D 798 208.807 187.559 199.900 1.00 33.54 N ATOM 21628 NH2 ARG D 798 208.313 185.505 200.769 1.00 33.54 N ATOM 21629 N ARG D 799 209.194 180.258 197.390 1.00 30.89 N ATOM 21630 CA ARG D 799 210.068 179.536 198.310 1.00 30.89 C ATOM 21631 C ARG D 799 211.336 179.090 197.597 1.00 30.89 C ATOM 21632 O ARG D 799 212.455 179.270 198.098 1.00 30.89 O ATOM 21633 CB ARG D 799 209.338 178.326 198.883 1.00 30.89 C ATOM 21634 CG ARG D 799 208.507 178.617 200.108 1.00 30.89 C ATOM 21635 CD ARG D 799 207.694 177.399 200.483 1.00 30.89 C ATOM 21636 NE ARG D 799 206.569 177.232 199.573 1.00 30.89 N ATOM 21637 CZ ARG D 799 205.924 176.092 199.377 1.00 30.89 C ATOM 21638 NH1 ARG D 799 206.257 174.988 200.025 1.00 30.89 N ATOM 21639 NH2 ARG D 799 204.930 176.053 198.494 1.00 30.89 N ATOM 21640 N LEU D 800 211.171 178.507 196.409 1.00 31.04 N ATOM 21641 CA LEU D 800 212.309 177.953 195.688 1.00 31.04 C ATOM 21642 C LEU D 800 213.356 179.020 195.422 1.00 31.04 C ATOM 21643 O LEU D 800 214.537 178.839 195.733 1.00 31.04 O ATOM 21644 CB LEU D 800 211.827 177.333 194.381 1.00 31.04 C ATOM 21645 CG LEU D 800 211.090 176.013 194.571 1.00 31.04 C ATOM 21646 CD1 LEU D 800 210.300 175.644 193.331 1.00 31.04 C ATOM 21647 CD2 LEU D 800 212.073 174.924 194.918 1.00 31.04 C ATOM 21648 N VAL D 801 212.944 180.145 194.837 1.00 32.03 N ATOM 21649 CA VAL D 801 213.919 181.196 194.569 1.00 32.03 C ATOM 21650 C VAL D 801 214.499 181.694 195.877 1.00 32.03 C ATOM 21651 O VAL D 801 215.662 182.106 195.937 1.00 32.03 O ATOM 21652 CB VAL D 801 213.304 182.354 193.767 1.00 32.03 C ATOM 21653 CG1 VAL D 801 212.075 182.885 194.451 1.00 32.03 C ATOM 21654 CG2 VAL D 801 214.319 183.462 193.567 1.00 32.03 C ATOM 21655 N ASP D 802 213.700 181.679 196.941 1.00 35.48 N ATOM 21656 CA ASP D 802 214.192 182.108 198.241 1.00 35.48 C ATOM 21657 C ASP D 802 215.419 181.314 198.659 1.00 35.48 C ATOM 21658 O ASP D 802 216.452 181.889 199.017 1.00 35.48 O ATOM 21659 CB ASP D 802 213.090 181.960 199.278 1.00 35.48 C ATOM 21660 CG ASP D 802 213.443 182.605 200.582 1.00 35.48 C ATOM 21661 OD1 ASP D 802 214.596 183.060 200.736 1.00 35.48 O ATOM 21662 OD2 ASP D 802 212.556 182.668 201.448 1.00 35.48 O ATOM 21663 N VAL D 803 215.325 179.986 198.632 1.00 30.12 N ATOM 21664 CA VAL D 803 216.443 179.195 199.140 1.00 30.12 C ATOM 21665 C VAL D 803 217.664 179.331 198.240 1.00 30.12 C ATOM 21666 O VAL D 803 218.801 179.296 198.721 1.00 30.12 O ATOM 21667 CB VAL D 803 216.042 177.717 199.305 1.00 30.12 C ATOM 21668 CG1 VAL D 803 215.478 177.157 198.013 1.00 30.12 C ATOM 21669 CG2 VAL D 803 217.228 176.888 199.775 1.00 30.12 C ATOM 21670 N ALA D 804 217.463 179.469 196.931 1.00 30.24 N ATOM 21671 CA ALA D 804 218.533 179.365 195.949 1.00 30.24 C ATOM 21672 C ALA D 804 219.102 180.719 195.535 1.00 30.24 C ATOM 21673 O ALA D 804 219.729 180.817 194.479 1.00 30.24 O ATOM 21674 CB ALA D 804 218.038 178.615 194.714 1.00 30.24 C