>>7KHE:HELIX  130 AO4 ASN M   33  ALA M   66  1                                  34    
NEAQLAHFRRILEAWRNQLRDEVDRTVTHMQDEA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 130 AO4 ASN M 33 ALA M 66 1 34 ATOM 31311 N ASN M 33 205.133 129.316 227.135 1.00119.68 N ATOM 31312 CA ASN M 33 204.230 128.741 228.120 1.00119.68 C ATOM 31313 C ASN M 33 203.075 129.707 228.346 1.00119.68 C ATOM 31314 O ASN M 33 203.076 130.842 227.865 1.00119.68 O ATOM 31315 CB ASN M 33 204.950 128.454 229.441 1.00119.68 C ATOM 31316 CG ASN M 33 205.647 129.670 229.993 1.00119.68 C ATOM 31317 OD1 ASN M 33 205.049 130.740 230.096 1.00119.68 O ATOM 31318 ND2 ASN M 33 206.924 129.529 230.311 1.00119.68 N ATOM 31319 N GLU M 34 202.079 129.239 229.093 1.00115.56 N ATOM 31320 CA GLU M 34 200.929 130.077 229.416 1.00115.56 C ATOM 31321 C GLU M 34 201.364 131.402 230.037 1.00115.56 C ATOM 31322 O GLU M 34 200.876 132.472 229.654 1.00115.56 O ATOM 31323 CB GLU M 34 199.983 129.331 230.360 1.00115.56 C ATOM 31324 CG GLU M 34 199.478 127.995 229.830 1.00115.56 C ATOM 31325 CD GLU M 34 200.390 126.838 230.189 1.00115.56 C ATOM 31326 OE1 GLU M 34 201.616 127.054 230.283 1.00115.56 O ATOM 31327 OE2 GLU M 34 199.882 125.714 230.377 1.00115.56 O ATOM 31328 N ALA M 35 202.281 131.347 231.006 1.00114.37 N ATOM 31329 CA ALA M 35 202.644 132.548 231.754 1.00114.37 C ATOM 31330 C ALA M 35 203.247 133.624 230.858 1.00114.37 C ATOM 31331 O ALA M 35 202.901 134.802 230.987 1.00114.37 O ATOM 31332 CB ALA M 35 203.617 132.186 232.874 1.00114.37 C ATOM 31333 N GLN M 36 204.156 133.254 229.955 1.00115.20 N ATOM 31334 CA GLN M 36 204.760 134.255 229.076 1.00115.20 C ATOM 31335 C GLN M 36 203.711 134.905 228.180 1.00115.20 C ATOM 31336 O GLN M 36 203.706 136.128 227.990 1.00115.20 O ATOM 31337 CB GLN M 36 205.880 133.642 228.233 1.00115.20 C ATOM 31338 CG GLN M 36 206.932 132.888 229.025 1.00115.20 C ATOM 31339 CD GLN M 36 208.208 132.677 228.241 1.00115.20 C ATOM 31340 OE1 GLN M 36 208.267 132.949 227.043 1.00115.20 O ATOM 31341 NE2 GLN M 36 209.241 132.185 228.915 1.00115.20 N ATOM 31342 N LEU M 37 202.849 134.090 227.572 1.00113.09 N ATOM 31343 CA LEU M 37 201.808 134.634 226.710 1.00113.09 C ATOM 31344 C LEU M 37 200.897 135.587 227.480 1.00113.09 C ATOM 31345 O LEU M 37 200.567 136.675 226.990 1.00113.09 O ATOM 31346 CB LEU M 37 201.006 133.481 226.108 1.00113.09 C ATOM 31347 CG LEU M 37 201.532 132.874 224.799 1.00113.09 C ATOM 31348 CD1 LEU M 37 201.386 133.810 223.628 1.00113.09 C ATOM 31349 CD2 LEU M 37 202.990 132.457 224.947 1.00113.09 C ATOM 31350 N ALA M 38 200.479 135.196 228.689 1.00112.08 N ATOM 31351 CA ALA M 38 199.687 136.092 229.531 1.00112.08 C ATOM 31352 C ALA M 38 200.438 137.389 229.807 1.00112.08 C ATOM 31353 O ALA M 38 199.863 138.484 229.753 1.00112.08 O ATOM 31354 CB ALA M 38 199.322 135.392 230.839 1.00112.08 C ATOM 31355 N HIS M 39 201.720 137.272 230.155 1.00108.07 N ATOM 31356 CA HIS M 39 202.564 138.434 230.405 1.00108.07 C ATOM 31357 C HIS M 39 202.503 139.410 229.240 1.00108.07 C ATOM 31358 O HIS M 39 202.231 140.607 229.413 1.00108.07 O ATOM 31359 CB HIS M 39 203.997 137.950 230.643 1.00108.07 C ATOM 31360 CG HIS M 39 205.010 139.045 230.730 1.00108.07 C ATOM 31361 ND1 HIS M 39 206.181 139.028 230.004 1.00108.07 N ATOM 31362 CD2 HIS M 39 205.039 140.180 231.464 1.00108.07 C ATOM 31363 CE1 HIS M 39 206.888 140.106 230.288 1.00108.07 C ATOM 31364 NE2 HIS M 39 206.217 140.823 231.171 1.00108.07 N ATOM 31365 N PHE M 40 202.762 138.905 228.038 1.00107.47 N ATOM 31366 CA PHE M 40 202.812 139.770 226.869 1.00107.47 C ATOM 31367 C PHE M 40 201.441 140.366 226.574 1.00107.47 C ATOM 31368 O PHE M 40 201.339 141.528 226.158 1.00107.47 O ATOM 31369 CB PHE M 40 203.340 138.979 225.673 1.00107.47 C ATOM 31370 CG PHE M 40 204.844 138.845 225.638 1.00107.47 C ATOM 31371 CD1 PHE M 40 205.670 139.750 226.290 1.00107.47 C ATOM 31372 CD2 PHE M 40 205.428 137.775 224.989 1.00107.47 C ATOM 31373 CE1 PHE M 40 207.041 139.605 226.261 1.00107.47 C ATOM 31374 CE2 PHE M 40 206.800 137.626 224.959 1.00107.47 C ATOM 31375 CZ PHE M 40 207.606 138.540 225.599 1.00107.47 C ATOM 31376 N ARG M 41 200.374 139.590 226.779 1.00108.66 N ATOM 31377 CA ARG M 41 199.035 140.139 226.595 1.00108.66 C ATOM 31378 C ARG M 41 198.794 141.311 227.536 1.00108.66 C ATOM 31379 O ARG M 41 198.272 142.355 227.129 1.00108.66 O ATOM 31380 CB ARG M 41 197.985 139.059 226.839 1.00108.66 C ATOM 31381 CG ARG M 41 196.657 139.327 226.159 1.00108.66 C ATOM 31382 CD ARG M 41 195.740 138.129 226.260 1.00108.66 C ATOM 31383 NE ARG M 41 195.524 137.750 227.652 1.00108.66 N ATOM 31384 CZ ARG M 41 194.528 138.193 228.409 1.00108.66 C ATOM 31385 NH1 ARG M 41 193.633 139.052 227.947 1.00108.66 N ATOM 31386 NH2 ARG M 41 194.432 137.770 229.666 1.00108.66 N ATOM 31387 N ARG M 42 199.150 141.144 228.811 1.00106.64 N ATOM 31388 CA ARG M 42 199.011 142.234 229.770 1.00106.64 C ATOM 31389 C ARG M 42 199.772 143.465 229.301 1.00106.64 C ATOM 31390 O ARG M 42 199.252 144.589 229.328 1.00106.64 O ATOM 31391 CB ARG M 42 199.507 141.797 231.149 1.00106.64 C ATOM 31392 CG ARG M 42 199.590 142.942 232.148 1.00106.64 C ATOM 31393 CD ARG M 42 199.816 142.457 233.570 1.00106.64 C ATOM 31394 NE ARG M 42 201.163 141.933 233.767 1.00106.64 N ATOM 31395 CZ ARG M 42 201.590 141.353 234.881 1.00106.64 C ATOM 31396 NH1 ARG M 42 202.828 140.902 234.994 1.00106.64 N ATOM 31397 NH2 ARG M 42 200.755 141.227 235.909 1.00106.64 N ATOM 31398 N ILE M 43 201.022 143.263 228.883 1.00100.78 N ATOM 31399 CA ILE M 43 201.852 144.379 228.441 1.00100.78 C ATOM 31400 C ILE M 43 201.164 145.129 227.309 1.00100.78 C ATOM 31401 O ILE M 43 201.021 146.359 227.345 1.00100.78 O ATOM 31402 CB ILE M 43 203.237 143.861 228.012 1.00100.78 C ATOM 31403 CG1 ILE M 43 204.060 143.508 229.254 1.00100.78 C ATOM 31404 CG2 ILE M 43 203.952 144.892 227.124 1.00100.78 C ATOM 31405 CD1 ILE M 43 205.514 143.196 228.988 1.00100.78 C ATOM 31406 N LEU M 44 200.740 144.396 226.278 1.00 99.78 N ATOM 31407 CA LEU M 44 200.147 145.047 225.116 1.00 99.78 C ATOM 31408 C LEU M 44 198.856 145.766 225.486 1.00 99.78 C ATOM 31409 O LEU M 44 198.601 146.880 225.014 1.00 99.78 O ATOM 31410 CB LEU M 44 199.894 144.020 224.014 1.00 99.78 C ATOM 31411 CG LEU M 44 201.159 143.447 223.372 1.00 99.78 C ATOM 31412 CD1 LEU M 44 200.971 141.982 223.019 1.00 99.78 C ATOM 31413 CD2 LEU M 44 201.561 144.249 222.151 1.00 99.78 C ATOM 31414 N GLU M 45 198.017 145.136 226.312 1.00102.48 N ATOM 31415 CA GLU M 45 196.755 145.759 226.696 1.00102.48 C ATOM 31416 C GLU M 45 196.996 147.071 227.429 1.00102.48 C ATOM 31417 O GLU M 45 196.340 148.086 227.152 1.00102.48 O ATOM 31418 CB GLU M 45 195.946 144.800 227.567 1.00102.48 C ATOM 31419 CG GLU M 45 195.196 143.736 226.789 1.00102.48 C ATOM 31420 CD GLU M 45 194.037 143.156 227.573 1.00102.48 C ATOM 31421 OE1 GLU M 45 193.075 142.669 226.944 1.00102.48 O ATOM 31422 OE2 GLU M 45 194.088 143.187 228.820 1.00102.48 O ATOM 31423 N ALA M 46 197.932 147.067 228.382 1.00 98.56 N ATOM 31424 CA ALA M 46 198.265 148.300 229.085 1.00 98.56 C ATOM 31425 C ALA M 46 198.743 149.366 228.110 1.00 98.56 C ATOM 31426 O ALA M 46 198.269 150.512 228.137 1.00 98.56 O ATOM 31427 CB ALA M 46 199.328 148.024 230.148 1.00 98.56 C ATOM 31428 N TRP M 47 199.708 149.012 227.258 1.00 95.64 N ATOM 31429 CA TRP M 47 200.230 149.975 226.296 1.00 95.64 C ATOM 31430 C TRP M 47 199.097 150.602 225.496 1.00 95.64 C ATOM 31431 O TRP M 47 198.983 151.832 225.404 1.00 95.64 O ATOM 31432 CB TRP M 47 201.233 149.290 225.366 1.00 95.64 C ATOM 31433 CG TRP M 47 202.190 150.230 224.695 1.00 95.64 C ATOM 31434 CD1 TRP M 47 202.304 151.573 224.903 1.00 95.64 C ATOM 31435 CD2 TRP M 47 203.172 149.895 223.708 1.00 95.64 C ATOM 31436 NE1 TRP M 47 203.292 152.094 224.107 1.00 95.64 N ATOM 31437 CE2 TRP M 47 203.842 151.083 223.364 1.00 95.64 C ATOM 31438 CE3 TRP M 47 203.550 148.704 223.082 1.00 95.64 C ATOM 31439 CZ2 TRP M 47 204.866 151.117 222.423 1.00 95.64 C ATOM 31440 CZ3 TRP M 47 204.568 148.740 222.147 1.00 95.64 C ATOM 31441 CH2 TRP M 47 205.213 149.937 221.826 1.00 95.64 C ATOM 31442 N ARG M 48 198.226 149.762 224.937 1.00 94.02 N ATOM 31443 CA ARG M 48 197.132 150.267 224.118 1.00 94.02 C ATOM 31444 C ARG M 48 196.264 151.227 224.918 1.00 94.02 C ATOM 31445 O ARG M 48 196.135 152.405 224.564 1.00 94.02 O ATOM 31446 CB ARG M 48 196.300 149.103 223.581 1.00 94.02 C ATOM 31447 CG ARG M 48 195.020 149.536 222.894 1.00 94.02 C ATOM 31448 CD ARG M 48 194.451 148.430 222.028 1.00 94.02 C ATOM 31449 NE ARG M 48 194.035 147.283 222.827 1.00 94.02 N ATOM 31450 CZ ARG M 48 192.936 146.570 222.617 1.00 94.02 C ATOM 31451 NH1 ARG M 48 192.101 146.853 221.630 1.00 94.02 N ATOM 31452 NH2 ARG M 48 192.664 145.548 223.422 1.00 94.02 N ATOM 31453 N ASN M 49 195.674 150.739 226.013 1.00 94.12 N ATOM 31454 CA ASN M 49 194.784 151.580 226.807 1.00 94.12 C ATOM 31455 C ASN M 49 195.417 152.931 227.117 1.00 94.12 C ATOM 31456 O ASN M 49 194.747 153.972 227.051 1.00 94.12 O ATOM 31457 CB ASN M 49 194.411 150.862 228.103 1.00 94.12 C ATOM 31458 CG ASN M 49 193.348 149.807 227.897 1.00 94.12 C ATOM 31459 OD1 ASN M 49 192.409 150.000 227.126 1.00 94.12 O ATOM 31460 ND2 ASN M 49 193.489 148.683 228.587 1.00 94.12 N ATOM 31461 N GLN M 50 196.720 152.945 227.411 1.00 91.15 N ATOM 31462 CA GLN M 50 197.395 154.218 227.645 1.00 91.15 C ATOM 31463 C GLN M 50 197.342 155.091 226.397 1.00 91.15 C ATOM 31464 O GLN M 50 197.027 156.286 226.471 1.00 91.15 O ATOM 31465 CB GLN M 50 198.838 153.981 228.089 1.00 91.15 C ATOM 31466 CG GLN M 50 199.565 155.251 228.517 1.00 91.15 C ATOM 31467 CD GLN M 50 200.182 156.009 227.364 1.00 91.15 C ATOM 31468 OE1 GLN M 50 200.018 155.639 226.206 1.00 91.15 O ATOM 31469 NE2 GLN M 50 200.891 157.085 227.678 1.00 91.15 N ATOM 31470 N LEU M 51 197.679 154.515 225.240 1.00 91.16 N ATOM 31471 CA LEU M 51 197.713 155.313 224.016 1.00 91.16 C ATOM 31472 C LEU M 51 196.342 155.916 223.726 1.00 91.16 C ATOM 31473 O LEU M 51 196.227 157.093 223.354 1.00 91.16 O ATOM 31474 CB LEU M 51 198.171 154.453 222.837 1.00 91.16 C ATOM 31475 CG LEU M 51 199.504 153.710 222.958 1.00 91.16 C ATOM 31476 CD1 LEU M 51 199.801 152.920 221.700 1.00 91.16 C ATOM 31477 CD2 LEU M 51 200.638 154.659 223.236 1.00 91.16 C ATOM 31478 N ARG M 52 195.290 155.120 223.898 1.00 93.38 N ATOM 31479 CA ARG M 52 193.943 155.614 223.631 1.00 93.38 C ATOM 31480 C ARG M 52 193.553 156.713 224.614 1.00 93.38 C ATOM 31481 O ARG M 52 192.908 157.698 224.229 1.00 93.38 O ATOM 31482 CB ARG M 52 192.951 154.455 223.651 1.00 93.38 C ATOM 31483 CG ARG M 52 193.037 153.641 222.370 1.00 93.38 C ATOM 31484 CD ARG M 52 192.820 152.158 222.577 1.00 93.38 C ATOM 31485 NE ARG M 52 191.424 151.788 222.386 1.00 93.38 N ATOM 31486 CZ ARG M 52 190.912 151.359 221.239 1.00 93.38 C ATOM 31487 NH1 ARG M 52 191.652 151.245 220.147 1.00 93.38 N ATOM 31488 NH2 ARG M 52 189.625 151.037 221.186 1.00 93.38 N ATOM 31489 N ASP M 53 193.933 156.575 225.888 1.00 92.94 N ATOM 31490 CA ASP M 53 193.625 157.648 226.828 1.00 92.94 C ATOM 31491 C ASP M 53 194.368 158.922 226.449 1.00 92.94 C ATOM 31492 O ASP M 53 193.848 160.032 226.626 1.00 92.94 O ATOM 31493 CB ASP M 53 193.980 157.224 228.251 1.00 92.94 C ATOM 31494 CG ASP M 53 193.022 156.191 228.806 1.00 92.94 C ATOM 31495 OD1 ASP M 53 191.842 156.192 228.397 1.00 92.94 O ATOM 31496 OD2 ASP M 53 193.447 155.376 229.652 1.00 92.94 O ATOM 31497 N GLU M 54 195.571 158.780 225.889 1.00 89.28 N ATOM 31498 CA GLU M 54 196.299 159.955 225.427 1.00 89.28 C ATOM 31499 C GLU M 54 195.566 160.608 224.262 1.00 89.28 C ATOM 31500 O GLU M 54 195.526 161.842 224.150 1.00 89.28 O ATOM 31501 CB GLU M 54 197.719 159.566 225.020 1.00 89.28 C ATOM 31502 CG GLU M 54 198.634 160.746 224.757 1.00 89.28 C ATOM 31503 CD GLU M 54 198.846 161.600 225.991 1.00 89.28 C ATOM 31504 OE1 GLU M 54 199.659 161.207 226.853 1.00 89.28 O ATOM 31505 OE2 GLU M 54 198.198 162.662 226.101 1.00 89.28 O ATOM 31506 N VAL M 55 194.995 159.789 223.377 1.00 86.25 N ATOM 31507 CA VAL M 55 194.209 160.334 222.272 1.00 86.25 C ATOM 31508 C VAL M 55 193.016 161.110 222.813 1.00 86.25 C ATOM 31509 O VAL M 55 192.650 162.168 222.287 1.00 86.25 O ATOM 31510 CB VAL M 55 193.751 159.214 221.322 1.00 86.25 C ATOM 31511 CG1 VAL M 55 192.722 159.757 220.333 1.00 86.25 C ATOM 31512 CG2 VAL M 55 194.934 158.619 220.593 1.00 86.25 C ATOM 31513 N ASP M 56 192.380 160.583 223.860 1.00 86.26 N ATOM 31514 CA ASP M 56 191.243 161.283 224.453 1.00 86.26 C ATOM 31515 C ASP M 56 191.680 162.630 225.012 1.00 86.26 C ATOM 31516 O ASP M 56 190.989 163.647 224.847 1.00 86.26 O ATOM 31517 CB ASP M 56 190.610 160.431 225.551 1.00 86.26 C ATOM 31518 CG ASP M 56 189.283 160.988 226.024 1.00 86.26 C ATOM 31519 OD1 ASP M 56 188.265 160.764 225.336 1.00 86.26 O ATOM 31520 OD2 ASP M 56 189.258 161.655 227.080 1.00 86.26 O ATOM 31521 N ARG M 57 192.830 162.656 225.682 1.00 82.35 N ATOM 31522 CA ARG M 57 193.359 163.923 226.166 1.00 82.35 C ATOM 31523 C ARG M 57 193.495 164.902 225.007 1.00 82.35 C ATOM 31524 O ARG M 57 192.889 165.981 225.010 1.00 82.35 O ATOM 31525 CB ARG M 57 194.710 163.702 226.845 1.00 82.35 C ATOM 31526 CG ARG M 57 194.632 162.932 228.151 1.00 82.35 C ATOM 31527 CD ARG M 57 195.737 163.340 229.107 1.00 82.35 C ATOM 31528 NE ARG M 57 195.940 162.341 230.149 1.00 82.35 N ATOM 31529 CZ ARG M 57 196.625 161.216 229.987 1.00 82.35 C ATOM 31530 NH1 ARG M 57 197.192 160.912 228.831 1.00 82.35 N ATOM 31531 NH2 ARG M 57 196.742 160.374 231.010 1.00 82.35 N ATOM 31532 N THR M 58 194.344 164.555 224.037 1.00 76.93 N ATOM 31533 CA THR M 58 194.494 165.349 222.821 1.00 76.93 C ATOM 31534 C THR M 58 193.181 165.903 222.285 1.00 76.93 C ATOM 31535 O THR M 58 193.087 167.092 221.976 1.00 76.93 O ATOM 31536 CB THR M 58 195.166 164.517 221.732 1.00 76.93 C ATOM 31537 OG1 THR M 58 196.463 164.110 222.174 1.00 76.93 O ATOM 31538 CG2 THR M 58 195.294 165.328 220.447 1.00 76.93 C ATOM 31539 N VAL M 59 192.178 165.042 222.090 1.00 75.10 N ATOM 31540 CA VAL M 59 190.930 165.513 221.491 1.00 75.10 C ATOM 31541 C VAL M 59 190.260 166.547 222.386 1.00 75.10 C ATOM 31542 O VAL M 59 189.719 167.545 221.896 1.00 75.10 O ATOM 31543 CB VAL M 59 189.986 164.343 221.146 1.00 75.10 C ATOM 31544 CG1 VAL M 59 189.420 163.691 222.381 1.00 75.10 C ATOM 31545 CG2 VAL M 59 188.865 164.825 220.232 1.00 75.10 C ATOM 31546 N THR M 60 190.273 166.336 223.706 1.00 75.24 N ATOM 31547 CA THR M 60 189.638 167.323 224.579 1.00 75.24 C ATOM 31548 C THR M 60 190.362 168.659 224.480 1.00 75.24 C ATOM 31549 O THR M 60 189.732 169.725 224.416 1.00 75.24 O ATOM 31550 CB THR M 60 189.629 166.828 226.022 1.00 75.24 C ATOM 31551 OG1 THR M 60 189.161 165.475 226.060 1.00 75.24 O ATOM 31552 CG2 THR M 60 188.731 167.701 226.877 1.00 75.24 C ATOM 31553 N HIS M 61 191.689 168.609 224.409 1.00 71.84 N ATOM 31554 CA HIS M 61 192.487 169.821 224.263 1.00 71.84 C ATOM 31555 C HIS M 61 192.137 170.532 222.964 1.00 71.84 C ATOM 31556 O HIS M 61 191.892 171.745 222.939 1.00 71.84 O ATOM 31557 CB HIS M 61 193.974 169.474 224.299 1.00 71.84 C ATOM 31558 CG HIS M 61 194.874 170.663 224.182 1.00 71.84 C ATOM 31559 ND1 HIS M 61 195.085 171.319 222.989 1.00 71.84 N ATOM 31560 CD2 HIS M 61 195.623 171.311 225.105 1.00 71.84 C ATOM 31561 CE1 HIS M 61 195.922 172.322 223.182 1.00 71.84 C ATOM 31562 NE2 HIS M 61 196.265 172.338 224.458 1.00 71.84 N ATOM 31563 N MET M 62 192.123 169.774 221.872 1.00 71.49 N ATOM 31564 CA MET M 62 191.857 170.324 220.553 1.00 71.49 C ATOM 31565 C MET M 62 190.476 170.951 220.499 1.00 71.49 C ATOM 31566 O MET M 62 190.273 171.985 219.854 1.00 71.49 O ATOM 31567 CB MET M 62 191.894 169.166 219.564 1.00 71.49 C ATOM 31568 CG MET M 62 191.676 169.477 218.113 1.00 71.49 C ATOM 31569 SD MET M 62 192.356 168.123 217.128 1.00 71.49 S ATOM 31570 CE MET M 62 194.075 168.054 217.619 1.00 71.49 C ATOM 31571 N GLN M 63 189.515 170.336 221.185 1.00 69.20 N ATOM 31572 CA GLN M 63 188.145 170.820 221.146 1.00 69.20 C ATOM 31573 C GLN M 63 187.988 172.078 221.981 1.00 69.20 C ATOM 31574 O GLN M 63 187.172 172.945 221.652 1.00 69.20 O ATOM 31575 CB GLN M 63 187.204 169.714 221.622 1.00 69.20 C ATOM 31576 CG GLN M 63 185.756 170.120 221.781 1.00 69.20 C ATOM 31577 CD GLN M 63 184.910 168.986 222.316 1.00 69.20 C ATOM 31578 OE1 GLN M 63 184.775 168.812 223.526 1.00 69.20 O ATOM 31579 NE2 GLN M 63 184.347 168.193 221.412 1.00 69.20 N ATOM 31580 N ASP M 64 188.759 172.192 223.063 1.00 70.34 N ATOM 31581 CA ASP M 64 188.678 173.378 223.906 1.00 70.34 C ATOM 31582 C ASP M 64 189.390 174.577 223.285 1.00 70.34 C ATOM 31583 O ASP M 64 188.852 175.689 223.295 1.00 70.34 O ATOM 31584 CB ASP M 64 189.267 173.069 225.283 1.00 70.34 C ATOM 31585 CG ASP M 64 189.020 174.175 226.288 1.00 70.34 C ATOM 31586 OD1 ASP M 64 188.876 175.345 225.877 1.00 70.34 O ATOM 31587 OD2 ASP M 64 188.967 173.870 227.497 1.00 70.34 O ATOM 31588 N GLU M 65 190.591 174.379 222.738 1.00 73.10 N ATOM 31589 CA GLU M 65 191.414 175.524 222.351 1.00 73.10 C ATOM 31590 C GLU M 65 190.887 176.219 221.099 1.00 73.10 C ATOM 31591 O GLU M 65 190.789 177.450 221.063 1.00 73.10 O ATOM 31592 CB GLU M 65 192.860 175.078 222.139 1.00 73.10 C ATOM 31593 CG GLU M 65 193.802 176.196 221.707 1.00 73.10 C ATOM 31594 CD GLU M 65 193.736 177.412 222.613 1.00 73.10 C ATOM 31595 OE1 GLU M 65 193.284 177.276 223.769 1.00 73.10 O ATOM 31596 OE2 GLU M 65 194.138 178.508 222.167 1.00 73.10 O ATOM 31597 N ALA M 66 190.566 175.453 220.058 1.00 73.68 N ATOM 31598 CA ALA M 66 190.285 175.995 218.732 1.00 73.68 C ATOM 31599 C ALA M 66 189.412 177.241 218.786 1.00 73.68 C ATOM 31600 O ALA M 66 188.289 177.207 219.298 1.00 73.68 O ATOM 31601 CB ALA M 66 189.608 174.925 217.876 1.00 73.68 C