>108l_A mol:protein length:164  T4 LYSOZYME
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKIELDKAIGRNTNGVIT
KDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL
RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL