>1a00_D mol:protein length:146  HEMOGLOBIN (BETA CHAIN)
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPYTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHF
GKEFTPPVQAAYQKVVAGVANALAHKYH