>1a07_C mol:protein length:4  ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)
XYEX
>1a07_B mol:protein length:107  C-SRC TYROSINE KINASE
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLN
VKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
>1a07_D mol:protein length:4  ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)
XYEX
>1a07_A mol:protein length:107  C-SRC TYROSINE KINASE
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLN
VKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
>1a07_D mol:protein length:4  ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)
XYEX