>1a1o_A mol:protein length:276  HLA class I histocompatibility antigen, BW-53 B*5301 alpha chain
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRPPWIEQEGPEY
WDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAY
DGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKE
TLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPA
GDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP