>1a6y_A mol:protein length:94  ORPHAN NUCLEAR RECEPTOR NR1D1
TKLNGMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRIN
RNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRM