>1a9t_A mol:protein length:284  PURINE NUCLEOSIDE PHOSPHORYLASE
MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPES
TVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAG
GLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHST
WKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVF
GFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV
>1a9t_A mol:protein length:284  PURINE NUCLEOSIDE PHOSPHORYLASE
MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPES
TVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAG
GLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHST
WKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVF
GFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV